Auburn, CA
No tenemos próximas reuniones registradas para Auburn. El registro más reciente que tenemos es del Mon Sep 28, 2026. Es posible que las reuniones más nuevas aún no se hayan publicado en el portal oficial, o que aún no las hayamos recopilado. Esto describe nuestro registro, no si el consejo o junta se ha reunido.
AuburnCA averageUS Census ACS
Median home value
$642,400 Typical home value $627,776 +1% yr/yr · +1.6% 5-yr
Reuniones recientes
Mon Sep 28, 2026
City Council Meeting
Auburn council weighs $200,000 solar system purchase at wastewater plant
The Auburn City Council meets September 28, 2026 at 1225 Lincoln Way to work through a consent calendar and several business items. The consent calendar covers meeting minutes, habitat restoration agreements with the Placer County Resource Conservation District, a surplus land declaration, and an investment report. Council business includes a $200,000 amendment to a professional services agreement with Pacific Power Management, LLC for a solar photovoltaic system at the Wastewater Treatment Plant, permission to advertise a sewer lateral project at 1226 Lincoln Way, and a presentation by AlmostFreeToAll, Inc. The agenda also lists routine reports from the City Manager and Council committees.
- Amendment to Professional Services Agreement with Pacific Power Management, LLC (Nella Holdings) for the solar photovoltaic system at the Wastewater Treatment Plant, not to exceed $200,000
- Habitat restoration agreements with the Placer County Resource Conservation District at City Hall, the Auburn Police Department, and 55 College Way
- Resolution declaring certain City-owned properties as 'exempt surplus land' under California Government Code Section 54221(f)(1)(B)
- Permission to advertise the 1226 Lincoln Way Sewer Lateral Project and explore cost reimbursement options
- Presentation of the AlmostFreeToAll, Inc. Annual Report for Branches at the Carnegie
budgetsolarwastewaterpublic-workssurplus-landhabitat-restorationcity-council
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
September 28, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (incl closed session)
Agenda Packet (large file)
Mayor’s Proclamation
Consent Calendar:
1.
Minutes
By Motion, approve the City Council minutes of 7/13/2026, 8/10/2026, 8/19/2026 and 8/24/2026.
PDF
2.
Agreement Authorizing Placer Resource Conservation District to Conduct Habitat Restoration at City Hall & Auburn Police Department
By Resolution, authorize the City Manager or designee to enter into an agreement with Placer County Resource Conservation to Conduct …
Thu Sep 24, 2026
City Council Special Session
Auburn City Council holds closed session on City Manager employment
The Auburn City Council meets in a special session on September 29, 2026 at 3:30 p.m. at City Hall, 1225 Lincoln Way. The only substantive item is a closed session on public employment for the position of City Manager, held under California Government Code 54957. The agenda also includes public comment on items not listed, a report out of any closed-session action required by the Ralph M. Brown Act, and adjournment. No decisions, contracts, or dollar amounts appear on the posted agenda.
- Closed session: public employment, title City Manager (G.C. 54957)
- Public comment period, 3-minute limit, no action allowed on non-agenda items
- Report out of closed session required by the Ralph M. Brown Act
- Agenda posted September 24, 2026 by City Clerk Amy Lind
city-councilclosed-sessioncity-managerpublic-employmentauburn
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
1 | P a g e
Auburn City Council
City Hall – City Council Chambers
1225 Lincoln Way, Auburn, CA 95603
September 29, 2026
Special Session 3:30 p.m.
Kelley Davis, Mayor
Sandy Amara, Council Member
Alice Dowdin Calvillo, Council Member
Bridget Powers, Council Member Rachel Radell-Harris, Vice Mayor
CALL TO ORDER/ ROLL CALL/ PLEDGE OF ALLEGIANCE
PUBLIC COMMENT:
This is the time provided so that the public may speak to the Council on any item not on this
agenda. Please make your comments as brief as possible (not to exceed 3 minutes). The
Council cannot act on items not included on this agenda; items may be referred to staff or
placed on a future agenda.
CLOSED SESSION:
By consensus of the Council without objection, adjourn to a Closed Session:
PUBLIC EMPLOYMENT (G.C. 54957):
Title: City Manager
Report Out of Closed Session: Announcement of any action taken by the City Council in
Closed Session required by the Ralph M. Brown Act.
ADJOURNMENT
Certification of Posting Agenda
I, Amy Lind, City Clerk for the City of Auburn, declare that the foregoing agenda for the
special session September 29, 2026 of the Auburn City Council was posted September 24,
2026 at the entrance of City Hall
Signed September 24, 2026 at Auburn, California
____________________________________________________________
Amy Lind, City Clerk
Thu Sep 24, 2026
City Council Meeting
Auburn council weighs $200,000 solar system amendment at wastewater plant
The Auburn City Council meets on September 28, 2026 at 1225 Lincoln Way to act on a consent calendar and several business items. The consent calendar covers meeting minutes, habitat restoration agreements, a surplus land declaration, and an investment report. Council business includes a sewer lateral project at 1226 Lincoln Way and a $200,000 amendment to a solar power agreement at the wastewater treatment plant. Several items are reports or presentations only, with no vote indicated.
- Consent calendar: approve minutes of 7/13/2026, 8/10/2026, 8/19/2026 and 8/24/2026
- Agreements with Placer County Resource Conservation for habitat restoration at City Hall, the Auburn Police Department, and 55 College Way
- Declare City-owned properties in Exhibit A as 'exempt surplus land' under California Government Code Section 54221(f)(1)(B)
- Authorize advertising the 1226 Lincoln Way Sewer Lateral Project and explore cost reimbursement options
- Amendment to Professional Services Agreement with Pacific Power Management, LLC (Nella Holdings) for the solar photovoltaic system at the Wastewater Treatment Plant, not to exceed $200,000
city-councilwastewatersolarsurplus-landhabitat-restorationsewerbudgetpublic-works
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
September 28, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (incl closed session)
Agenda Packet (large file)
Mayor’s Proclamation
Consent Calendar:
1.
Minutes
By Motion, approve the City Council minutes of 7/13/2026, 8/10/2026, 8/19/2026 and 8/24/2026.
PDF
2.
Agreement Authorizing Placer Resource Conservation District to Conduct Habitat Restoration at City Hall & Auburn Police Department
By Resolution, authorize the City Manager or designee to enter into an agreement with Placer County Resource Conservation to Conduct …
Mon Sep 21, 2026
City Council Town Hall
Auburn City Council holds town hall; agenda is procedural only
This is a City Council Town Hall meeting with no substantive agenda items listed. The agenda contains only standard administrative notices regarding ADA accommodations, agenda materials, and meeting logistics. No decisions, proposals, or discussions are specified in the provided text.
- Meeting location: 1225 Lincoln Way, Auburn, CA 95603
- ADA accommodation notice with 72-hour advance request requirement
- Agenda and PowerPoint materials available as PDFs
- Video to be posted by Auburn Community Television
city-counciltown-hallmeeting-logisticsada
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Town Hall
1225 Lincoln Way, Auburn, CA 95603
September 21, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda
PDF
Powerpoint
PDF copy (large file)
Video will be posted here as soon as it is available from our partners at Auburn Community Television.
Materials related to an item on this Agenda submitted to the Council after distribution of the agenda packet are available for public inspection in the City Clerk's Office, 1225 Lincoln Way, Room 8, Auburn, CA 95603 during normal business hours.
Tue Sep 15, 2026
City Council Meeting
Council to submit Auburn airport master plan to FAA for review
The Auburn City Council will consider consent items including appointments, a grand jury response, an IT services contract, and a triathlon host agreement. In council business, members will hear a presentation on the Auburn Municipal Airport Master Plan Update and decide whether to authorize its submittal to the FAA for technical review, with further steps to follow. The agenda also includes routine reports from the city manager and council members.
- Appoint Aaron Semenoff to the Economic Development Commission as Downtown Business Association representative
- Approve response letter to Placer County Grand Jury reports on public communication and public safety
- Approve 3-year IT services agreement with ABSO Technologies, Inc. with option to renew for 3 more years
- Approve Host Venue Agreement with World Triathlon for the Canyons Races
- Authorize submittal of Auburn Municipal Airport Master Plan Update to FAA for technical review
airportappointmentscontractsgrand jurypublic safetytechnologytriathlon
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
September 15, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (incl closed session)
Agenda Packet (large file)
Mayor Proclamation
National Rehabilitation Awareness Week Proclamation
Consent Calendar:
1.
Appointment to Economic Development Commission
By Resolution, appoint Aaron Semenoff to the Economic Development Commission as the representative of the Downtown Business Association.
Staff Report
2.
Proposed 2026 Placer County Grand Jury Response
By Motion, approve a letter drafted in response to the Placer County …
Mon Sep 14, 2026
City Council Special Session - Town Hall
Council workshop on automatic license plate recognition technology
The Auburn City Council is holding a special session and town hall to gather public input on automatic license plate recognition (ALPR) technology. Staff will provide information, but no formal action will be taken at this meeting.
- Community workshop on Automatic License Plate Recognition Technology
- Public comment period for items not on the agenda
- No formal action scheduled
license-plate-recognitionpublic-safetytechnologytown-hall
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
1 | P a g e
Auburn City Council
City Hall – Rose Room
1225 Lincoln Way, Auburn, CA 95603
September 21, 2026
6:00 PM
Special Session/ Town Hall
Kelley Davis, Mayor
Rachel Radell-Harris, Vice Mayor
Alice Dowdin Calvillo, Council Member
Bridget Powers, Council Member Sandy Amara, Council Member
CALL TO ORDER/ ROLL CALL/ PLEDGE OF ALLEGIANCE
PUBLIC COMMENT:
This is the time provided so that the public may speak to the Council on any item not
on this agenda. Please make your comments as brief as possible (not to exceed 3
minutes). The Council cannot act on items not included on this agenda; items may be
referred to staff or placed on a future agenda.
Community Workshop on Automatic License Plate Recognition Technology
Staff will provide information and gather public input from the public.
No formal action will be taken.
____________
Certification of Posting of Agenda
I, Amy Lind, City Clerk for the City of Auburn, declare that the foregoing agenda for the special session
September 21, 2026 of the Auburn City Council was posted September 14, 2026 at the entrance of City
Hall
Signed September 14, 2026 at Auburn, California
Amy Lind, City Clerk
Thu Sep 10, 2026
Historic Design Review Commission Meeting
Historic Design Review Commission to continue Kee Building permit review
The Auburn Historic Design Review Commission is holding a regular session with one public hearing item. The Commission will consider a motion to continue the Historic Design Review Permit for the Kee Building at 202 Sacramento St to the November 17, 2026 meeting. The rest of the agenda consists of routine items: public comment, staff follow-up reports, and commissioner discussion of future agenda items.
- Public hearing: Historic Design Review Permit – Kee Building – 202 Sacramento St – File HDRP 26-03; motion to continue to November 17, 2026
historic-preservationdesign-reviewpublic-hearingpermits
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
CITY OF AUBURN HISTORIC DESIGN REVIEW COMMISSION
MEETING AGENDA
City Hall, Council Chambers
1225 Lincoln Way, Auburn, CA 95603
September 15, 2026
Regular Session 6:00 p.m.
To watch a meeting being streamed live, please visit
https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live
1.
CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE
2.
PUBLIC COMMENT
This is the time provided so that persons may speak to the Commission on any item not on this agenda.
Please make your comments as brief as possible. The Commission cannot act on items not included on
this agenda; however, the items will be referred to City staff automatically.
3. PUBLIC HEARING
HISTORIC DESIGN REVIEW PERMIT – Kee Building – 202 Sacramento St – File HDRP 26-03
By MOTION, continue this item to the regularly scheduled meeting on November 17, 2026.
3.
STAFF FOLLOW-UP REPORTS
a. Future Commission Meetings
b. City Council Meetings
4.
COMMISSION DISCUSSION AND REPORTS / FUTURE COMMISSION AGENDA ITEMS
Commissioners will discuss and agree on items and/or projects to be placed on future Commission
agendas for the purpose of updating the Commission on the progress of items and/or projects.
ADJOURNMENT
The Planning Commission welcomes your interest and participation. If you want to speak on any item on the agenda, as directed by the Chairman, simply go to the
lectern, give your name, address, sign in and speak on the subject. Please try to keep your remarks t …
Thu Sep 10, 2026
City Council Meeting
Council to submit Auburn Airport Master Plan to FAA for review
The Auburn City Council will consider consent items including appointments, a Grand Jury response, an IT services contract, and a World Triathlon host venue agreement. The main business item is authorizing submission of the Auburn Municipal Airport Master Plan Update to the FAA for technical review, with CEQA review and formal adoption to follow. The agenda also includes routine reports and future agenda discussions.
- Approve Professional Services Agreement with ABSO Technologies, Inc. for citywide IT services, effective Sept 15, 2026–Sept 14, 2029, with 3-year renewal option
- Approve Host Venue Agreement with World Triathlon for the Canyons Races
- Authorize Airport Manager to submit Auburn Municipal Airport Master Plan Update and Airport Layout Plan to FAA for technical review
- Approve letter responding to Placer County Grand Jury Final Report on public communication and public safety
- Appoint Aaron Semenoff to Economic Development Commission
airportcontractsappointmentspublic-safetytechnologyevents
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
September 14, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (incl closed session)
Agenda Packet (large file)
Mayor Proclamation
National Rehabilitation Awareness Week Proclamation
Consent Calendar:
1.
Appointment to Economic Development Commission
By Resolution, appoint Aaron Semenoff to the Economic Development Commission as the representative of the Downtown Business Association.
Staff Report
2.
Proposed 2026 Placer County Grand Jury Response
By Motion, approve a letter drafted in response to the Placer Coun …
Thu Sep 10, 2026
Endurance Capital Committee
Auburn Endurance Capital Committee meets to review projects and events
The Auburn Endurance Capital Committee is holding a hybrid meeting to discuss routine administrative items, including approving the agenda and minutes, and receiving the Treasurer's Report. Informational updates cover the Brick Pillar Refresh Project, Central Square Water Station, upcoming events, and various committee reports. No major decisions or proposals are on the agenda.
- Approve Sept. 16, 2026 meeting agenda
- Discuss July 17, 2026 meeting minutes
- Treasurer's Report (Larry Grilli)
- Brick Pillar Refresh Project update
- Central Square Water Station report
meetingendurance-capitaltreasurer-reporteventsprojects
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
CITY OF AUBURN
AUBURN ENDURANCE CAPITAL OF THE WORLD
® COMMITTEE
MEETING AGENDA
Wednesday, September 16, 2026 • 6:00 PM • Room 10, Auburn City Hall
Hybrid Meeting – In Person & Zoom • https://us02web.zoom.us/j/4647233700
CALL TO ORDER / PUBLIC COMMENT
This is an opportunity for any member of the public, including Committee members, to address the Committee
on a matter not on this agenda. The Committee may not take action on said item(s) but can schedule them for
consideration at a future meeting. Comments may be limited in time by the Chair. This is also an opportunity
for the ECC Chair to adjust the order of Action and Informational items as needed.
CONSENT ITEMS
Require a vote — All
I.
Approve Sept. 16, 2026 Meeting Agenda – (All)
II.
Discuss July 17, 2026 Meeting Minutes – (All)
ACTION ITEMS
Require a vote
I. Treasurer’s Report (Larry Grilli)
INFORMATIONAL ITEMS
I. Brick Pillar Refresh Project (Cynci Calvin)
II. Central Square Water Station Report (Cynci Calvin)
III. 2026-2027 Events – Review, Attendance & Representation
•
December 5 – Festival of Lights Parade
•
December 16 – ECC Holiday Dinner
•
Other events
•
Resolution Run
•
Other events to add?
•
Volunteer Outreach Plan
IV. Swag Update (Cynci Calvin)
V.
Cycling Report (Bob Peterson)
VI. Trail & Equestrian Updates (Lori Stewart, Shannon Weil)
VII. Website Update (Cynci Calvin, Darci Pierce, Bob Peterson)
VIII.Social Media Update (Shannon Weil, Erika Thompson)
IX.
Event Promotion …
Tue Sep 8, 2026
Arts Commission Meeting
Auburn Arts Commission discusses public art projects and district planning
The Commission will review reports on several ongoing art projects, including the Wind Phone cost proposal and roundabout public art. Members will also discuss the Downtown Arts & Entertainment District and potential recruitment for two vacancies.
- Wind Phone project artwork cost proposal
- Roundabout Public Art proposal report
- Downtown Arts & Entertainment District discussion
- Mosaic Project ideas including Carnegie tiles and downtown sidewalk repair
- Public Art Sculpture Proposal by Katy Fries
artspublic-artdowntowncommunity-projectsplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN ARTS COMMISSION SPECIAL MEETING
Thursday September 10, 2026, 5:30pm
Room 10 City Hall
1225 Lincoln Way, Auburn CA
AGENDA
Call to Order
Roll Call
Declaration of a Quorum
Minutes for approval: August 2026
Public Comment: This for anyone to speak on any item not on the agenda. Commissioners cannot act on item that is not
on this agenda; items presented may be placed on a future meeting agenda. Comments should be brief.
Agenda Approval Commissioners and/or the public may ask to remove, postpone or change sequence of agenda items.
Ongoing Business - Committee and Project Reports
1. Roundabout Public Art proposal report by Marsh team
2. Wind Phone project – artwork cost proposal
3. Mosaic Project Ideas: Carnegie tiles; Downtown sidewalk mosaic repair
4. School Park Preserve activities – mosaic mural; CNPS garden;
5. OT/High Street underpass path project update
6. Art Walk – Downtown/City Hall August 7 - debrief
7. City Hall Gallery report
8. SPP summer movie series – August 8, 15, 29; Sept 5 - debrief
9. A.R.T. Artist Resources and Training Workshop - update
10. City Hall back entrance improvement ideas
11. Repair/upgrade of Peter Hazel fish statue in Central Square + “fence” - update
12. New Art Park signage update; Lee Buckingham tile fund
13. Recruitment ideas for two AAC vacancies
New Business
1. Downtown Arts & Entertainment District
2. SPP Commission
Other Projects
1. Freestanding 4x8 frames for public art for OT/High St path …
Fri Aug 28, 2026
Youth Advisory Committee
Youth Advisory Commission holds orientation and planning meeting
The Commission will conduct an orientation and discuss its mission, vision, and scope. Members will also discuss potential project ideas, areas of interest, and outreach strategies.
- Commission orientation
- Discussion of mission, vision, and scope
- Discussion of project ideas and outreach
youthgovernmentplanningcommunity-outreach
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
1
AUBURN YOUTH ADVISORY COMMISSION
AGENDA
City Hall, Room 10
1225 Lincoln Way, Auburn, CA 95603
September 3, 2026 - 6:00 p.m. to 7:00 p.m.
CALL TO ORDER
PLEDGE OF ALLEGIANCE
ROLL CALL
Determination of a Quorum
Public Comment
This is the time provided so that persons may speak to the Commission on any
item not on this agenda.
COMMISSION BUSINESS
1 Commission Orientation
2. Discuss Mission, Vision, Scope
3. Possible Areas of Interest
4. Project Ideas
5. Outreach
ADJOURNMENT
Delia Kobzoff
Jaylee Lake
Asher Thompson
West Simmons
Jocelyn Deane
Cora Bourgault
Makenna Rogas
Mila Orozco
Madison Schroeder
Bella Reci
Ava Wolfgang
Lena Harris
Isabella Cherry
Sara Liebert
Jamie Ross
Council Member Rachel Radell-Harris
Wed Aug 26, 2026
City Council Special Session
City Council to hold closed session regarding anticipated litigation
The Auburn City Council will hold a special session to conduct a closed session conference with legal counsel. The council anticipates one potential case involving litigation exposure that is not yet known to potential plaintiffs.
- Closed session: Conference with legal counsel regarding anticipated litigation
legalcity-councillitigation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
1 | P a g e
Auburn City Council
City Hall – City Council Chambers
1225 Lincoln Way, Auburn, CA 95603
August 19, 2026
Special Session 6:00 p.m.
Kelley Davis, Mayor
Sandy Amara, Council Member
Alice Dowdin Calvillo, Council Member
Vacant, Council Member Rachel Radell-Harris, Vice Mayor
The public is encouraged to participate or observe this meeting by:
1. Participate: Attend this meeting in person at the City of Auburn City Council Chambers
located at 1225 Lincoln Way, Auburn, California.
Public comments may be made:
1. In person: Live at the meeting. Members of the public desiring to speak on a matter
appearing on the agenda should ask the Mayor for the opportunity to be heard when the
item comes up for Council consideration. Comments for all agenda items are limited to
a speaking time of three minutes.
2. In writing: Email your comments to
[email protected] Comments will be
accepted until 5pm on the Friday prior to the meeting date. Comments will not be read
during the City Council meeting but will be forwarded to all Council Members prior to
the City Council Meeting.
In compliance with the Americans with Disabilities Act of 1990, if you need special
assistance to participate in this meeting, please contact the City Clerk at 530-823-4211
Extension 112. Notification at least 48 hours prior to the meeting will enable the City to
make reasonable arrangements to ensure accessibility to this meeting. [2 …
Tue Aug 25, 2026
City Council Meeting
Council to fill vacancy, decide bike lane design on Pacific Ave
The Auburn City Council will fill a vacancy on the council and consider design options for bicycle facilities along Pacific Avenue that preserve on-street parking. The consent calendar includes routine approvals, such as accepting a $10,000 grant for a downtown arts district and authorizing a storm drain improvement contract. The council will also receive reports on park impact fees and investment transactions.
- Appointment to fill City Council vacancy
- Direction on Pacific Avenue bicycle facilities with on-street parking
- Accept $10,000 Placer Community Foundation grant for Downtown Arts and Entertainment District
- Authorize $92,400 construction agreement with Gabe Mendez, Inc. for Airport Industrial Park Storm Drain Crossing
- Adopt ordinance amending mobile food vendor zoning regulations
appointmentsbicyclesgrantsstorm-drainzoningpublic-works
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
August 25, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda
Agenda Packet (large file)
Mayor’s Proclamations:
Hunger Action Month
* Consent Calendar *
1.
League of CA Cities/ Voting Delegate
By motion, select Council Member Dowdin Calvillo as voting delegate to the League of California Cities Annual Conference.
Staff Report
2.
Council Appointed Fire Safe Council
By Resolution, rescind Resolution 2003-27, which approved the memorandum of understanding relating to the Greater Auburn Area Fire Safe Council; and b …
Thu Aug 20, 2026
City Council Meeting
Council to fill vacancy, decide Pacific Ave bike lane design
The Auburn City Council will fill a City Council vacancy by appointment and give direction on bicycle facilities along Pacific Avenue, weighing the Active Transportation Plan against retaining on-street parking. The consent calendar includes a $10,000 grant for a Downtown Arts and Entertainment District, a $92,400 storm drain construction contract, and adoption of a mobile food vendor ordinance. The Council will also receive investment reports and a park impact fee report, then adjourn to closed session on potential litigation and the City Manager position.
- Appointment to fill City Council vacancy
- Direction on Pacific Avenue bike facilities with on-street parking
- $10,000 Placer Community Foundation grant for Downtown Arts & Entertainment District
- $92,400 construction contract for Airport Industrial Park storm drain project
- Adoption of ordinance amending mobile food vendor regulations
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
August 24, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda
Agenda Packet (large file)
Mayor’s Proclamations:
Hunger Action Month
* Consent Calendar *
1.
League of CA Cities/ Voting Delegate
By motion, select Council Member Dowdin Calvillo as voting delegate to the League of California Cities Annual Conference.
Staff Report
2.
Council Appointed Fire Safe Council
By Resolution, rescind Resolution 2003-27, which approved the memorandum of understanding relating to the Greater Auburn Area Fire Saf …
Wed Aug 19, 2026
Planning Commission Study Session
Mon Aug 17, 2026
Greater Auburn Area Fire Safe Council
Fire Safe Council to hear EV and lithium battery safety briefing
The Greater Auburn Area Fire Safe Council is meeting to discuss fire safety coordination, hear agency reports, and receive a guest presentation on electric vehicle and lithium battery safety. The agenda includes routine approvals, updates on council membership and a potential merger, and planning for community events.
- Guest speaker: EV and lithium battery safety by Battalion Chiefs Eric Reams and Nick Salas
- Status update on North Auburn/Ophir Fire Safe Council merger
- Financial report under new business
- First Responders Fair, October 3, 2026, Granite Bay Park, 6010 Douglas Blvd.
- UCANR Walking Tour of Hidden Valley Firewise Community, August 11, 2026
fire-safetyelectric-vehicleslithium-batteriescommunity-eventscouncil-meeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
GREATER AUBURN AREA FIRE SAFE COUNCIL
MEETING AGENDA
Date:
July 17th, 2026,
Time:
9:00 a.m.
Location: Auburn City Hall, Rm 10, 1275 Lincoln Way, Auburn, CA
Virtual via ZOOM: https://us02web.zoom.us/j/4647233700
1. Call to Order:
a. Pledge of Allegiance
b. Introduction of Council Members
2. Approval of today’s Agenda
3. Approval of Meeting Minutes
a. GAAFSC meeting minutes, June 19th, 2026
4. Agency and Stakeholder Reports
a. Penryn Fire/Newcastle Fire/Placer Hills Fire
b. Auburn Fire
c. American Red Cross
d. U.S. Bureau of Reclamation (BOR)
e. Placer Resource Conservation District (RCD)
f.
Regional Forest Health
g. OES, Placer County/Fire Alliance/Firewise Community Report
h. CAL FIRE/Placer County Fire
5. Guest Speaker
a. Electric Vehicle and Lithium Battery Safety-
• Placer Hills Battalion Chief Eric Reams
• Cal Fire Battalion Chief Nick Salas
6. Old Business
a. Status of Placer County Board Appointed council members
b. Status of North Auburn/Ophir Fire Safe Council merger
c. CAL FIRE NEU OPEN HOUSE July 11, 2026, at 9:00AM, Bowman Station 10, at
13760 Lincoln Way, Auburn, CA 95603
d. UPRR communication
7. New Business
a. Financial Report
b. UCANR Walking Tour Hidden Valley Firewise Community, Granite Bay CA.,
August 11th, 2026
c. PCWA Fire and Water 2026
d. First Responders Fair Event scheduled for October 3, 2026, at 10:00AM-1:30PM,
Granite Bay Park, 6010 Douglas Blvd., Granite Bay
8. Public Comment
a. Any member of …
Thu Aug 13, 2026
Planning Commission - Study Session
Planning Commission reviews draft Auburn 2045 General Plan and EIR
The Planning Commission will hold a study session to receive an informational report on the Draft Auburn 2045 General Plan and its Draft Environmental Impact Report (DEIR). No formal action will be taken; the session is for commissioners to ask questions and receive public comment before public hearings scheduled for October 2026. The DEIR comment period closes September 21, 2026.
- Study session on Draft Auburn 2045 General Plan and DEIR (informational only)
- Public comment period for DEIR closes September 21, 2026
- First public hearing tentatively scheduled for October 6, 2026
- Planning Commission action anticipated October 20, 2026
- Approval of July 21, 2026 meeting minutes
general-planenvironmental-impact-reportplanning-commissionpublic-hearingland-use
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
CITY OF AUBURN PLANNING COMMISSION
MEETING AGENDA
City Hall, Council Chambers
1225 Lincoln Way, Auburn, CA 95603
August 18, 2026
Regular Session 6:00 p.m.
To watch a meeting being streamed live, please visit
https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live
1.
CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE
2.
PUBLIC COMMENT
This is the time provided so that persons may speak to the Commission on any item not on this agenda.
Please make your comments as brief as possible. The Commission cannot act on items not included on
this agenda; however, the items will be referred to City staff automatically.
3.
APPROVAL OF MINUTES
By MOTION, approve the meeting minutes of July 21, 2026.
4.
STUDY SESSION ON THE DRAFT AUBURN 2045 GENERAL PLAN AND ENVIRONMENTAL IMPACT
REPORT (EIR)
Receive an informational report on the Draft General Plan and EIR from Barry Miller, General Plan
Consultant Project Manager. This is informational only - no authoritative action will be taken.
5.
STAFF FOLLOW-UP REPORTS
a. Future Commission Meetings
b. City Council Meetings
6.
COMMISSION DISCUSSION AND REPORTS / FUTURE COMMISSION AGENDA ITEMS
Planning Commissioners will discuss and agree on items and/or projects to be placed on future
Commission agendas for the purpose of updating the Commission on the progress of items and/or
projects.
ADJOURNMENT
The Planning Commission welcomes your interest and participation. If you want to sp …
Wed Aug 12, 2026
EDC Town Hall - Small Town Talk
Auburn EDC town hall features local business speakers and community Q&A
The Auburn Economic Development Commission is hosting a town hall event on August 11, 2026, from 5:30-8:00 PM at City Hall Council Chamber. The agenda includes a speaker lineup of local business owners discussing what makes businesses successful in Auburn, how they grow, and how the community can support entrepreneurs. The event is facilitated by Natalie Otis and includes a welcome and community questions segment.
- Speaker: Reese Browning (Old Town Pizza)
- Speaker: Heather Mauel (8 Dutch B)
- Speaker: Dmitriy Sergeyev (Serg Supply)
- Facilitator: Natalie Otis (City of Auburn EDC & Auburn Gymnastics)
- Community Q&A session
economic-developmentsmall-businesstown-hallcommunity-engagement
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
_{ pV Y\_
GINY OF
AUBURN&
ECONOMIC DEVELOPMENT COMMISSION
THE SPEAKER LINEUP
Reese Browning
Old Town Pizza
Heather Mauel
8 Dutch B
Explore what makes businesses mes
successful in Auburn, what helps
them grow, and how the community
can better support local
entrepreneurs and small business
owners.
Dmitriy Sergeyev
Serg Supply
August 11", 2026
© 5:30-8:00 PM Ken McGuire
@ CITY HALL COUNCIL CHAMBER if Tin Latern and McGuire's
WELCOME &
COMMUNITYQUESTIONS
Melissa Johnson
Chamber Board , Planning
Commission, Economic
Development
FACILITATED BY
Natalie Otis
City of Auburn Economic
Development Commission &
Auburn Gymnastics
Register now at :
Mon Aug 10, 2026
City Council Meeting
Council to consider $231K CHP grant for DUI enforcement, fire captain funding
The Auburn City Council is meeting to decide on a consent calendar of routine items, including accepting a $231,013.84 California Highway Patrol grant for DUI enforcement equipment and overtime, funding a fire captain position, and purchasing a hybrid truck for the airport. The council will also hold a first reading of a zoning ordinance amendment on mobile food vendors and hear a presentation on the Surplus Land Act. The agenda includes several standard administrative approvals and reports.
- Approve $231,013.84 CHP CTF grant for DUI patrol pickup, motorcycle, narcotics analyzer, and overtime enforcement
- Approve funding of one Fire Captain position and updated position allocation
- Approve $40,000 budget adjustment to purchase hybrid pick-up truck for Auburn Airport and surplus vehicle AIR-2
- First reading of ordinance amending Section 159.180 on Mobile Food Vendors
- Approve Amended and Restated Agreement for Legal Services with Colantuono, Highsmith & Whatley, PC
policebudgetzoningpublic-safetyairportcontractsfire
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
August 10, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (incl closed session)
Agenda Packet (large file)
Consent Calendar:
1.
Funding of One Fire Captain Position and Updated Position Allocation
By Resolution, approve the funding of one Fire Captain position.
Staff Report
2.
Vehicle Purchase and Surplus for the Auburn Airport
By Resolution, approve a FY 2026-27 budget adjustment of $40,000 and authorize the Public Works Director to purchase a hybrid pick-up truck for Auburn Airport operations, and surplus vehicle AIR-2 in accordance …
Thu Aug 6, 2026
City Council Meeting
Council to vote on $231K CHP grant for DUI enforcement
The Auburn City Council will consider consent calendar items including funding a fire captain position, purchasing a hybrid truck for the airport, accepting a $231,013.84 California Highway Patrol grant for DUI enforcement, and appointing Youth Advisory Commission members. A public hearing will introduce an ordinance amending mobile food vendor regulations. Council business includes a Surplus Land Act presentation and adoption of revised council rules.
- Accept $231,013.84 from CHP CTF Grant for DUI patrol vehicles, narcotics analyzer, and enforcement outreach
- Approve $40,000 budget adjustment to purchase hybrid pickup truck for Auburn Airport and surplus vehicle AIR-2
- First reading of ordinance amending Section 159.180 on mobile food vendor regulations
- Adoption of revised City Council Rules and Procedures
- Funding of one Fire Captain position by resolution
budgetpolicezoningpublic-safetyairportyouthlegal-services
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
August 10, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (incl closed session)
Agenda Packet (large file)
Consent Calendar:
1.
Funding of One Fire Captain Position and Updated Position Allocation
By Resolution, approve the funding of one Fire Captain position.
Staff Report
2.
Vehicle Purchase and Surplus for the Auburn Airport
By Resolution, approve a FY 2026-27 budget adjustment of $40,000 and authorize the Public Works Director to purchase a hybrid pick-up truck for Auburn Airport operations, and surplus vehicle AIR-2 in …
Fri Jul 31, 2026
Arts Commission Meeting
Arts Commission reviews public art projects and upcoming events
The Auburn Arts Commission is discussing updates on several public art installations and community events. The body will review proposals for a 2027 Art Retreat sponsorship and a September 5 fundraiser.
- Repair and upgrade of Peter Hazel fish statue in Central Square
- Art Walk scheduled for August 7
- SPP summer movie series on August 8, 15, 29, and September 5
- Public Art Sculpture Proposal from Katy Fries
- Proposal for fundraiser at Armed Forces Pavilion and Community Garden on September 5
public-artcommunity-eventsarts-commissioncity-beautification
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN ARTS COMMISSION MEETING
Monday , August 3 , 2026, 5:30pm
Room 10 City Hall
1225 Lincoln Way, Auburn CA
AGENDA
Call to Order
Roll Call
Declaration of a Quorum
Minutes for approval: July 2026
Public Comment: This for anyone to speak on any item not on the agenda. Commissioners cannot act on item that is not
on this agenda; items presented may be placed on a future meeting agenda. Comments should be brief.
Agenda Approval Commissioners and/or the public may ask to remove, postpone or change sequence of agenda items.
Ongoing Business - Committee and Project Reports
1. Repair/upgrade of Peter Hazel fish statue in Central Square + “fence” update
2. Wind Phone project update
3. Art Walk – Downtown/City Hall August 7
4. City Hall Gallery
5. SPP summer movie series – August 8, 15, 29; Sept 5
6. A.R.T. Artist Resources and Training Workshop
7. City Hall back entrance improvement ideas; plants
8. Mosaic Project Ideas: Carnegie tiles; Downtown sidewalk repair
9. OT/High Street underpass path project update
10. Roundabout Public Art update
11. New Art Park signage update; Lee Buckingham tile fund
12. Recruitment ideas for two AAC vacancies
New Business
1. Request for AAC sponsorship of 2027 Art Retreat
2. Proposal for Fundraiser at Armed Forces Pavilion and Community Garden on Sept 5
3. Review of mural process
Other Projects
1. School Park Preserve activities – mosaic mural
2. Freestanding 4x8 frames for public art for OT/High St path
3. …
Fri Jul 17, 2026
Greater Auburn Area Fire Safe Council
First Responders Fair scheduled for Oct 3, 2026 at Granite Bay Park
The Greater Auburn Area Fire Safe Council will approve the agenda and the June 19, 2026 meeting minutes. Council members will hear reports from local fire agencies, the American Red Cross, and other stakeholders, followed by a guest speaker on electric‑vehicle and lithium‑battery safety. New business includes a financial report and discussion of the First Responders Fair planned for October 3, 2026 at Granite Bay Park.
- Approval of today’s agenda
- Approval of June 19, 2026 meeting minutes
- Guest speaker on electric‑vehicle and lithium‑battery safety (Battalion Chiefs Eric Reams and Nick Salas)
- Financial report presentation
- First Responders Fair event scheduled for Oct 3, 2026, Granite Bay Park, 6010 Douglas Blvd
fire-safetycommunity-eventsemergency-servicesbudgetpublic-safetymeeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
GREATER AUBURN AREA FIRE SAFE COUNCIL
MEETING AGENDA Date: July 17th, 2026, Time: 9:00 a.m. Location: Auburn City Hall, Rm 10, 1275 Lincoln Way, Auburn, CA Virtual via ZOOM: https://us02web.zoom.us/j/4647233700 1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC meeting minutes, June 19th, 2026 4. Agency and Stakeholder Reports a. Penryn Fire/Newcastle Fire/Placer Hills Fire b. Auburn Fire c. American Red Cross d. U.S. Bureau of Reclamation (BOR) e. Placer Resource Conservation District (RCD) f. Regional Forest Health g. OES, Placer County/Fire Alliance/Firewise Community Report h. CAL FIRE/Placer County Fire 5. Guest Speaker a. Electric Vehicle and Lithium Battery Safety- • Placer Hills Battalion Chief Eric Reams • Cal Fire Battalion Chief Nick Salas 6. Old Business a. Status of Placer County Board Appointed council members b. Status of North Auburn/Ophir Fire Safe Council merger c. CAL FIRE NEU OPEN HOUSE July 11, 2026, at 9:00AM, Bowman Station 10, at 13760 Lincoln Way, Auburn, CA 95603 d. UPRR communication 7. New Business a. Financial Report b. UCANR Walking Tour Hidden Valley Firewise Community, Granite Bay CA., August 11th, 2026 c. PCWA Fire and Water 2026 d. First Responders Fair Event scheduled for October 3, 2026, at 10:00AM-1:30PM, Granite Bay Park, 6010 Douglas Blvd., Granite Bay 8. Public Comment a. Any member of the public may address the council on any matter that …
Thu Jul 16, 2026
Planning Commission/HDRC Joint Meeting
Auburn commissions to consider mobile food vendor rules and cafe signage
The Planning Commission and Historic Design Review Commission are meeting to discuss updates to mobile food vendor regulations. The body will also review a permit for new illuminated signage at a downtown cafe.
- Proposed ordinance amending Section 159.180 of the Auburn Municipal Code regarding mobile food vendors
- Historic Design Review Permit for new illuminated LED wall signage at Baked & Brewed Café & Bistro (958 Lincoln Way)
- Introduction of new Associate Planner Kelly Mumper
zoningmobile-food-vendorssignagehistoric-preservationplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
CITY OF AUBURN PLANNING COMMISSION AND
HISTORIC DESIGN REVIEW COMMISSION JOINT MEETING AGENDA
City Hall, Council Chambers
1225 Lincoln Way, Auburn, CA 95603
July 21, 2026
Regular Session 6:00 p.m.
To watch a meeting being streamed live, please visit
https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live
1. CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE
*Introduction of new Associate Planner, Kelly Mumper
2. PUBLIC COMMENT
This is the time provided so that persons may speak to the Commission on any item not on this agenda.
Please make your comments as brief as possible. The Commission cannot act on items not included on
this agenda; however, the items will be referred to City staff automatically.
3. APPROVAL OF MINUTES
By MOTION, approve the meeting minutes of May 5, 2026.
4. PUBLIC HEARING
A. HISTORIC DESIGN REVIEW PERMIT – 958 LINCOLN WAY – NEW ILLUMINATED LED WALL SIGNAGE
(BAKED & BREWED CAFÉ & BISTRO) - FILE HDRP 26-02
B. ADOPT A RESOLUTION RECOMMENDING THAT THE CITY COUNCIL APPROVE AN ORDINANCE
AMENDING SECTION 159.180 OF CHAPTER 159 (ZONING) OF THE AUBURN MUNCIPAL CODE
RELATING TO MOBILE FOOD VENDORS
*Adjourn Planning Commission and Historic Design Review Commission Joint Meeting and Reconvene Planning
Commission for action of item 4.B.
*CALL TO ORDER Planning Commission
5. STAFF FOLLOW-UP REPORTS
A. Economic Development Updates
B. City Council Meetings
C. Future Planning Commission Meetings
D. Reports
6. COM …
Mon Jul 13, 2026
City Council Meeting
Council to appoint James Lindsay as Interim City Manager
The Auburn City Council will consider approving an employment agreement with James Lindsay as Interim City Manager and discuss the process for filling a City Council vacancy. The consent calendar includes approval of a successor MOU with the Auburn Firefighters IAFF Local 4110, a contract for the 2026 ADA Curb Ramp Upgrade Project ($195,215.90), and a contract for the Pacific Avenue and Pleasant Avenue Bicycle Improvement Project ($85,734.00). The council will also consider designating a census tract as a Qualified Opportunity Zone and adopt revised council rules and procedures.
- Employment Agreement with James Lindsay as Interim City Manager (Item 13)
- Discussion on process for filling City Council vacancy (Item 14)
- Successor Memorandum of Understanding with Auburn Firefighters IAFF Local 4110 for 2026-2028 (Item 12, consent)
- Award of contract for 2026 ADA Curb Ramp Upgrade Project, not to exceed $195,215.90 (Item 7, consent)
- Award of contract for Pacific Avenue and Pleasant Avenue Bicycle Improvement Project, not to exceed $85,734.00 (Item 10, consent)
city-councilappointmentscontractspublic-worksfire-departmentadaroadseconomic-development
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
July 13, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
July 13, 2026 Agenda
Agenda (with closed session)
Agenda Packet (large file)
Consent Calendar:
1.
Minutes
By Motion, approve the City Council minutes of 5/11/2026, 5/18/2026, 6/1/2026 and 6/22/2026.
PDF copy
2.
Report of Investment Transactions - June 2026
Receive, review, and file the City of Auburn Monthly Report of Investment Transactions for the month ending June 30, 2026.
Staff Report
3.
Amended Appropriation (GANN) Limits
By Resolu …
Fri Jul 10, 2026
Arts Commission Meeting
Auburn Arts Commission discusses various public art and park projects
The commission is reviewing updates on several ongoing initiatives, including the Peter Hazel fish statue and the OT/High Street underpass path. Members will also discuss potential mosaic projects and a $3,000 grant from AFTA/Carnegie.
- AFTA/Carnegie $3k grant for mosaic project
- Peter Hazel fish statue repair/upgrade in Central Square
- OT/High Street underpass path project update
- New Art Park signage and Lee Buckingham tile fund
- Public Art Sculpture Proposal by Katy Fries
public-artparksgrantscommunity-projectsinfrastructure
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN ARTS COMMISSION MEETING
Thursday, Ju ly 16, 2026, 5:30pm
Room 10 City Hall
1225 Lincoln Way, Auburn CA
AGENDA
Call to Order
Roll Call
Declaration of a Quorum
Minutes for approval: June 2026
Public Comment: This for anyone to speak on any item not on the agenda. Commissioners cannot act on item that is not
on this agenda; items presented may be placed on a future meeting agenda. Comments should be brief.
Agenda Approval Commissioners and/or the public may ask to remove, postpone or change sequence of agenda items.
Ongoing Business - Committee and Project Reports
1. Repair/upgrade of Peter Hazel fish statue in Central Square + “fence” update
2. Wind Phone project update
3. New Art Park signage update; Lee Buckingham tile fund
4. Leadership Auburn debrief
5. OT/High Street underpass path project update
6. Consider meeting time back to Monday; recruit for vacant seat
7. Art Walk – Downtown August 7
8. City Hall back entrance improvement ideas – need renderings
9. Roundabout Public Art update
10. SPP summer movie series with State Theatre – update
11. A.R.T. Artist Resources and Training Workshop
12. Arts and Culture focus discussion/grants
New Business
1. Mosaic Project Ideas
a. AFTA/Carnegie has $3k grant for mosaic project
b. Downtown sidewalk mosaic idea
Other Projects
1. School Park Preserve activities – mosaic mural
2. Freestanding 4x8 frames for public art for OT/High St path
3. Native plant garden in School Park Preserve …
Fri Jul 10, 2026
Endurance Capital Committee
Endurance Capital Committee meeting on July 15, 2026
The Committee will review the FY2026–27 budget update and several project updates. Discussion items include the Brick Pillar Refresh Project, cycling reports, and trail and equestrian updates.
- FY2026–27 Budget Update
- Brick Pillar Refresh Project
- Western States Endurance Run post-event report
- Festival of Lights Parade review
- ECC Holiday Dinner review
budgeteventsinfrastructurecyclingtrails
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
CITY OF AUBURN
AUBURN ENDURANCE CAPITAL OF THE WORLD
®
COMMITTEE
MEETING AGENDA
Wednesday, July 15, 2026 • 6:00 PM • Room 10, Auburn City Hall Hybrid Meeting – In Person & Zoom • https://us02web.zoom.us/j/4647233700
CALL TO ORDER / PUBLIC COMMENT This is an opportunity for any member of the public, including Committee members, to address the Committee
on
a
matter
not
on
this
agenda.
The
Committee
may
not
take
action
on
said
item(s)
but
can
schedule
them
for
consideration
at
a
future
meeting.
Comments
may
be
limited
in
time
by
the
Chair.
This
is
also
an
opportunity
for
the
ECC
Chair
to
adjust
the
order
of
Action
and
Informational
items
as
needed.
CONSENT ITEMS Require a vote — All
I. Approve July 15, 2026 Meeting Agenda – (All) II. Approve June 17, 2026 Meeting Minutes – (All)
ACTION ITEMS Require a vote
I. Treasurer’s Report (Larry Grilli)
INFORMATIONAL ITEMS I. FY2026–27 Budget Update (Larry Grilli, Bob Peterson) II. Brick Pillar Refresh Project (Cynci Calvin) III. 2026 Events – Review, Attendance & Representation • Western States Endurance Run (June 27–28) – Post-Event Report • December 5 – Festival of Lights Parade • December 16 – ECC Holiday Dinner • Other events to support - open question • Volunteer Outreach Plan IV. Swag Update (Cynci Calvin) V. Cycling Report (Bob Peterson) VI. Trail & Equestrian Updates (Lori Stewart, Shannon Weil) VII. Website …
Thu Jul 9, 2026
City Council Meeting
City Council to approve major ADA curb ramp contract and other key items
The Auburn City Council will consider a consent calendar that includes approvals for minutes, investment reports, amended appropriation limits, an airport ground lease assignment, and several contracts. Major items include a construction agreement for the 2026 ADA Curb Ramp Upgrade Project up to $195,215.90 and a bicycle improvement contract up to $85,734.00. Council business will address the appointment of an interim city manager, a vacancy discussion, a fire department sub‑joint operations review, and a recommendation for Opportunity Zone designation. The meeting will also adopt revised council rules and receive various reports.
- 2026 ADA Curb Ramp Upgrade Project – construction agreement up to $195,215.90 with 10% contingency
- Pacific Avenue and Pleasant Avenue Bicycle Improvement Project – contract up to $85,734.00 with 10% contingency
- Professional Services Agreement with R.E.Y. Engineers, Inc. for on‑call land surveying services
- Assignment of ground lease for Hangar 75, authorizing the Interim City Manager to sign documents
- Employment Agreement appointing James Lindsay as Interim City Manager
public-workscontractsbudgetcity-councilinfrastructureopportunity-zonefire-department
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
July 13, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
July 13, 2026 Agenda
Agenda (with closed session)
Agenda Packet (large file)
Consent Calendar:
1.
Minutes
By Motion, approve the City Council minutes of 5/11/2026, 5/18/2026, 6/1/2026 and 6/22/2026.
PDF copy
2.
Report of Investment Transactions - June 2026
Receive, review, and file the City of Auburn Monthly Report of Investment Transactions for the month ending June 30, 2026.
Staff Report
3.
Amended Appropriation (GANN) Limits
By Resolu …
Mon Jun 22, 2026
City Council Meeting
El Concejo Municipal adoptará el presupuesto de $33.6M para el año fiscal 2026-27
El Concejo Municipal de Auburn considerará adoptar el presupuesto final del año fiscal 2026-27 de $33,607,027, que establece las Reservas del Fondo General en $5,375,542. El calendario de consentimiento incluye múltiples ordenanzas, contratos y acuerdos laborales, incluyendo una nueva zona de entretenimiento en el centro de Auburn, un proyecto de mejora de la estación de bombeo de alcantarillado y la renovación de la política de equipamiento militar policial. Se programan audiencias públicas para el gravamen anual de evaluación del Distrito de Mejora Comercial y los cargos por servicio de alcantarillado.
- Adopción del presupuesto final de $33,607,027 para el año fiscal 2026-27
- Adjudicación de contrato por hasta $1,678,459.20 para el Proyecto de Mejora de la Estación de Bombeo de Alcantarillado de Canyon Court
- Segunda lectura de la ordenanza que establece una Zona de Entretenimiento adicional en el centro de Auburn
- Aprobación del acuerdo de servicios de despacho con CALFIRE para los años fiscales 2026-27 a 2028-29
- Convocatoria para la Elección Municipal General del 3 de noviembre de 2026
budgetpublic-safetyinfrastructureelectionsemployee-relationszoningpolicefire
✓ Decidido: Council adopts $33.6M budget, new downtown entertainment zone
The Auburn City Council approved the FY 2026-27 final budget of $33,607,027, which sets General Fund Reserves at $5,375,542 and the Appropriation Limit at $28,351,238. The Council also adopted ordinances creating an additional Entertainment Zone in Downtown Auburn and amending Historical Design Review Permit requirements for exterior painting. The consent calendar, which included these items, was approved unanimously by the four present members, with Council Member Mike Holmes absent.
- Approved the FY 2026-27 Final Budget of $33,607,027 by Resolution 26-65.
- Adopted Ordinance 26-01 establishing an additional Entertainment Zone in Downtown Auburn.
- Adopted Ordinance 26-02 amending Historical Design Review Permit requirements for exterior painting.
- Approved the annual Military Equipment Use Report and renewed APD policy by Resolution 26-66.
- Authorized a CALFIRE dispatch services agreement for FY 2026-27 through FY 2028-29 by Resolution 26-67.
- Awarded a $1,678,459.20 contract to LaFleur Engineering for the Canyon Court Sewer Lift Station project by Resolution 26-68.
- Approved two-year MOUs with four employee associations (AEA, APOA, APSA, CHEA) by Resolutions 26-71 through 26-74.
- Approved a 5% COLA for unrepresented classifications by Resolution 26-75.
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
AUBURN CITY COUNCIL
City Council Meeting
1225 Lincoln Way, Auburn, CA 95603
June 22, 2026
It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator.
Agenda:
Agenda (with closed session)
Agenda Packet (large file)
Consent Calendar:
1.
Report of Investment Transactions - May 2026
Receive, review, and file the City of Auburn Monthly Report of Investment Transactions for the month ending May 30, 2026.
Staff Report
2.
Fiscal Year 2026-27 Final Budget Adoption
By Resolution, approve the City of Auburn FY 2026-27 Final Budget in the total amount of $33,607,027, which sets General Fund Reserves at $5,375,542, the Appropriation Limit at $28,351,238, and updates the City's Pay Schedule.
Staff Repor …
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
CITY COUNCIL MINUTES
June 22, 2026
REGULAR SESSION
A Regular Meeting of the Auburn City Council was held at Auburn City Hall,
1225 Lincoln Way, Auburn, CA on Monday, June 22, 2026 at 6:00 p.m. with
Mayor Kelley Davis presiding and City Clerk Amy Lind recording the minutes.
CALL TO ORDER/ ROLL CALL
Council Members Present: Sandra Amara, Alice Dowdin Calvillo,
Rachel Radell-Harris, Kelley Davis
Council Members Absent: Mike Holmes
Staff Members Present: City Manager Sean Rabé, City Attorney
Gary Bell, Public Works Director Mengil Deane, Economic Development
Director Jonathan Wright, Building Official Michael Pinola, Fire Chief
John Rogers, Finance Director Gretchen Hoskins, Finance Analyst
Cristina Shafer, Human Resources Analyst Justin Orton, Human
Resources Technician Kim Wilson, City Treasurer Donna Silva
and Police Lt. Ranier Neri
CLOSED SESSION:
By consensus of the Council without objection, adjourn to a Closed Session:
1. PUBLIC EMPLOYEE APPOINTMENT/PUBLIC EMPLOYMENT (Gov. Code,
§ 54957.)
Title: Interim City Manager; City Manager
Report Out of Closed Session: City Manager Rabé reported he will be leaving
the City to take a position with Placer County. He said a contract for an interim
City Manager will come back to the Council at the next meeting.
CALL TO ORDER /ROLL CALL
PLEDGE OF ALLEGIANCE
ADOPTION OF THE AGENDA
The agenda was approved as presented by consensus of the Council.
CONSENT CALENDAR:
1. Report of Investment Transactions — May 2026
Receive, revie …
Fri Jun 12, 2026
Greater Auburn Area Fire Safe Council
Recomendaciones del CWPP y taller sobre incendios forestales planificados
Los consejos conjuntos de North Auburn/Ophir y el Área de Greater Auburn para la Seguridad contra Incendios Forestales llevarán a cabo un taller especial sobre el Plan de Protección contra Incendios Forestales Comunitarios (CWPP) y discutirán las actualizaciones recomendadas. Los consejos también revisarán el estado de la propuesta de fusión entre los dos grupos y los nombramientos de la junta del Condado de Placer.
- Taller del CWPP con la Oficina de Servicios de Emergencia del Condado de Placer y Dudek
- Actualización del estado de la fusión de los consejos de North Auburn/Ophir y el Área de Greater Auburn para la Seguridad contra Incendios Forestales
- Estado de los nombramientos de la junta del Condado de Placer
- Informes de agencias de CAL FIRE, Auburn Fire y otros
fire-safe-councilwildfirecommunity-wildfire-protection-planjoint-meetingauburnplacer-county
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Fire Safe Council Meeting JOINT MEETING North Auburn/Ophir & Greater Auburn Area
MEETING AGENDA Note: New Location for special workshop Date: April 17th, 2026, Time: 9:00 a.m. Location: Health & Human Services Building, HHSC Cordova Room, 11434 B Avenue, Auburn, CA 95603 Virtual via ZOOM: https://placer-ca-gov.zoom.us/j/91766765984?pwd=2anH1JuJwjlP8j9AlYuCDUFzloX4oT.1 Meeting ID: 917 6676 5984 Passcode: 235774
1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC month’s meeting minutes, March 20, 2026 b. North Auburn/Ophir meeting minutes, March 24, 2026 4. Agency and Stakeholder Reports a. CAL FIRE/Placer County Fire b. Auburn Fire c. Penryn Fire/Newcastle Fire/Placer Hills Fire d. U.S. Bureau of Reclamation (BOR) e. Placer Resource Conservation District (RCD) f. Regional Forest Health g. OES, Placer County/Fire Alliance/Firewise Community Report 5. Old Business a. Status of Placer County Board Appointments b. Status of North Auburn/Ophir Fire Safe Council merger 6. New Business a. GAAFSC CWPP recommendations b. NAOFSC CWPP recommendations c. Placer County Office of Emergency Services and Dudek • (CWPP) Community Wildfire Protection Plan Workshop 7. Public Comment a. Any member of the public may address the council on any matter that is NOT listed on the agenda. Please limit comments to 5 minutes b. Discussion of items of mutual interest, introduction of new issues, and propose …
Fri Jun 12, 2026
Greater Auburn Area Fire Safe Council
El Consejo votará sobre la financiación de refrigerios para la jornada de puertas abiertas de CAL FIRE
El Greater Auburn Area Fire Safe Council escuchará informes de agencias de los departamentos de bomberos locales, CAL FIRE, Cruz Roja y otros. Un orador invitado del Insurance Institute for Business & Home Safety hablará sobre seguridad contra incendios forestales. El Consejo votará sobre la donación de fondos para alimentos y refrigerios en la Jornada de Puertas Abiertas de CAL FIRE NEU el 11 de julio de 2026. Los asuntos pendientes incluyen actualizaciones sobre los nombramientos de miembros del consejo y una posible fusión con el North Auburn/Ophir Fire Safe Council.
- Orador invitado Steve Hawks, Director Senior de Incendios Forestales en IBHS
- Votación para donar fondos para alimentos/refrigerios en la Jornada de Puertas Abiertas de CAL FIRE NEU (11 de julio de 2026, Bowman Station 10)
- Actualización sobre el estado de la fusión con el North Auburn/Ophir Fire Safe Council
- Estado de los miembros del consejo designados por la Junta del Condado de Placer
- Informes de agencias de Penryn Fire, Auburn Fire, CAL FIRE, American Red Cross, U.S. Bureau of Reclamation, Placer RCD
firefire-safe-councilwildfireemergency-servicesfundingpublic-safetycal-fire
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
GREATER AUBURN AREA FIRE SAFE COUNCIL
MEETING AGENDA Date: May 15th, 2026, Time: 9:00 a.m. Location: Auburn City Hall, Room 10, Auburn, CA 95603 Virtual via ZOOM: https://us02web.zoom.us/j/4647233700 1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC last month’s meeting minutes, April 17, 2026 4. Agency and Stakeholder Reports a. Penryn Fire/Newcastle Fire/Placer Hills Fire b. Auburn Fire c. CAL FIRE/Placer County Fire d. American Red Cross e. U.S. Bureau of Reclamation (BOR) f. Placer Resource Conservation District (RCD) g. Regional Forest Health h. OES, Placer County/Fire Alliance/Firewise Community Report 5. Guest Speaker a. Steve Hawks, Senior Director for Wildfire, (IBHS) Insurance Institute for Business and Home safety 6. Old Business a. Status of Placer County Board Appointed council members b. Status of North Auburn/Ophir Fire Safe Council merger 7. New Business a. CAL FIRE NEU OPEN HOUSE scheduled for July 11, 2026, at 9:00AM, Bowman Station 10, at 13760 Lincoln Way, Auburn, CA 95603 b. Vote to donate funding for food and refreshments at CAL FIRE event 8. Public Comment a. Any member of the public may address the council on any matter that is NOT listed on the agenda. Please limit comments to 5 minutes b. Discussion of items of mutual interest, introduction of new issues, and proposed future Agenda items 9. Next Meeting Date and Adjourn a. Next GAAFSC meeting; June 19 …
Showing the 30 most recent meetings of 53 on record. See the yearly meeting archives below for the full history.