The Boring PartsFederalLocal · USLocal · Canada

Franklin Town, Massachusetts

Franklin Town   Massachusetts average (US Census ACS)
Population33,067
Per-capita income$63,724
Median home value$567,100
📰 Resúmenes

Próximas reuniones

Thu Jul 23, 2026

Franklin's 250th Anniversary Celebration Committee

Events Subcommittee plans 250th Anniversary celebrations

The 250th Anniversary Celebration Committee Events Subcommittee is discussing a series of launch events and long-term planning for the town's anniversary. The body is reviewing past events and coordinating future schedules through November 2028.

anniversarycommunity-eventsplanningfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Events Subcommittee Agenda July 23, 2026 7:30 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97743314781?pwd=z5IAQUQs0JilNVIyloAWw4VpvskoT4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair a. Welcome! 2. Approval of minutes a. April 15, 2026 and May 19, 2026 3. Agenda items a. Strawberry Stroll recap b. Fourth of July recap c. Discussion of Opening Launches: i. September 17, 2026 Dean College Breakfast 8-9:30 am ii. October 16, 2026 Dean College Lunch 11:30 am-1 pm iii. November 19, 2026 Dean College Breakfast 8-9:30 am d. Discussion regarding invitations and guest list e. March 2027 Community Launch; begin planning f. Parade Marshall’s g. Anniversary Bell Ringing: RT reached out to Mary Diehl, Chair of Interfaith Council. She will report back to us after she meets with the IC h. March 2027 Library Event, small local business groups i. Parade: updates from Lee? i. Discussion of Fi [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 23, 2026

Zoning Board of Appeals

The July 23, 2026, Zoning Board of Appeals meeting is cancelled

There will be no Zoning Board of Appeals meeting held on July 23, 2026. The next scheduled meeting for this body is August 6, 2026.

administrative
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING July 23, 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR August 6, 2026
Thu Jul 23, 2026

Economic Development Subcommittee

Economic Development Subcommittee to discuss 'New Growth' tax impacts

The subcommittee will hold a discussion and Q&A session with the Franklin Board of Assessors regarding 'New Growth.' The meeting will cover how new construction, specifically apartment developments, affects the town's assessed value and tax revenue.

economic-developmenttaxeshousingassessmentbudget
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Economic Development Subcommittee Agenda & Meeting Packet July 23, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #867 7184 7369 & Link: https://us02web.zoom.us/j/86771847369 Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Call to Order 2. New Growth 101 with the Franklin Board of Assessors - a discussion & question and answer se [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 23, 2026

Board of Assessors

Franklin Board of Assessors to review tax abatements and exemptions

The Board of Assessors will meet to discuss motor vehicle, personal property, and real estate tax matters. The session includes a scheduled joint meeting with the Town Council Economic Development Subcommittee. The board may also enter executive session to vote on confidential abatement and exemption matters.

taxesassessmentsreal-estatemotor-vehicle-excise
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF ASSESSORS MEETING AT FRANKLIN MUNICIPAL BUILDING, ROOM 106, 355 EAST CENTRAL STREET, FRANKLIN, MASSACHUSETTS THURSDAY, JULY 23, 2026 AT 5:30 PM AGENDA The following is a list of matters reasonably anticipated by the Chair that may be discussed. Not all items may be discussed and other related items not listed may be raised for discussion to the extent permitted under Massachusetts General Law. A. APPROVAL OF MINUTES: Regular & Executive Sessions B. ADMINISTRATION, OLD BUSINESS AND NEW BUSINESS (any matters not otherwise in a specific category below). 1. At 6:00 PM Board will recess to reconvene with the Town Council Economic Development Subcommittee in the 3rd Floor Training Room. C. MOTOR VEHICLE EXCISE 1. MV Excise Tax Abatement Denials. 2. MV Monthly Letters. D. PERSONAL PROPERTY 1. PP abatements. 2. PP Monthly Letters. E. BOAT EXCISE F. REAL ESTATE 1. RE Abatements, Exemptions & ATB Appeals. 2. RE Monthly Letters. G. EXECUTIVE SESSION 1. I move that the Board vote to go into Executive Session under Purpose 7 to discuss and vote on matters that are confidential in accordance with law, such as, but not limited to abatements and exemptions (MGL Ch. 59, Sec. 60), or property income & expense disclosures (MGL Ch. 59, Sec 52B). Following Executive Session, the Board will return to Open Session.
Thu Jul 23, 2026

Tri-County School Committee Nominating Committee

Appointment of Peter Wiernicki to the Tri-County Vocational School Committee

The Tri-County Regional Vocational Technical School Committee Appointment Committee will meet on July 22, 2026 at 5:15 PM in the Franklin Municipal Building. The sole agenda item is the appointment of Peter Wiernicki as a committee member. The meeting will be open to the public in person and via phone or Zoom.

appointmentseducationschool-committee
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tri-County Regional Vocational School Committee Appointment Committee Meeting Agenda July 22, 2026 5:15 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. ZOOM WEBINAR DETAILS: ID #848 5662 0995 & Link: https://us02web.zoom.us/j/84856620995 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Appointment of Tri-County Regional Vocational Technical School Committee Member a. Peter Wiernicki 2. Adjourn
Mon Jul 27, 2026

Agricultural Commission

Agricultural Commission to discuss Pumpkin Festival and future goals

The Agricultural Commission will review a report on the July 24 Zucchini Race and Farmers Market event. Members will continue discussions on future goals and plan for the upcoming Pumpkin Festival.

agriculturefarmers-marketcommunity-events
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 7/27/2026 7:00pmA NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded.ZOOM MEETING DETAILS: Ag Com Time: Jul 27, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/84196747034?pwd=SuT2kMCl4gbRymploCiFPfPJCxOGVE.1 Meeting ID: 841 9674 7034 Passcode: 302802 One tap mobile +13017158592,,88308465960#,,,,*260560# US (Washington DC) +13052241968,,88308465960#,,,,*260560# US l. Approval of the minutes - from June 29, 2026 meeting. ll. Old Business: A. 7-24-26 Zucchini Race/Farmers Market Event- Report B. Continue to discuss future goals and actions. III. New Business: A. Upcoming Farmers Market Events: Pumpkin Festival Respectfully Submitted, Marian Szymanski
Mon Jul 27, 2026

Planning Board

Franklin Planning Board meeting cancelled

The Planning Board meeting scheduled for July 27, 2026, was cancelled. The public hearing for 9 & 13-25 Main Street has been postponed to August 10, 2026.

planning-boardpublic-hearingcancelled
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD July 27, 2026 CANCELLED PUBLIC HEARINGS 1. 9 & 13-25 Main Street – Special Permit & Site Plan Postponed to August 10, 2026 GENERAL BUSINESS: This agenda is subject to change. The next meeting of the Planning Board is scheduled for August 10, 2026.
Mon Jul 27, 2026

Legal Notices

Audiencia pública sobre edificio de uso mixto de 4 pisos en 9-15 Main Street

La Junta de Planificación de Franklin llevará a cabo una audiencia pública el 27 de julio de 2026, para considerar un Permiso Especial y una Solicitud de Plan de Sitio para un edificio de uso mixto de cuatro pisos en 9, 13 y 15 Main Street. El solicitante, Fourzol, LLC, propone la construcción del edificio con el estacionamiento, el paisajismo y los servicios públicos asociados en el Distrito de Zonificación Comercial del Centro. La audiencia es el único aviso escrito; cualquier aplazamiento se publicará en el sitio web de la Junta de Planificación.

planning-boardpublic-hearingspecial-permitmixed-usedevelopmentdowntownzoning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, July 27 , 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Special Permit and Site Plan Application titled “Franklin Plaza A Mixed Use Development ” prepared by Guerriere & Halnon, Inc., Milford, MA, and submitted to the Department of Planning & Community Development on July 6, 2026, by Fourzol, LLC, Franklin, MA. The property is located in the Downtown Commercial Zoning District (Assessors Map 279 Lots 172 and 173) at 9, 13 and 15 Main Street. The applicant is proposing to construct a four-story mixed -use building with associated parking, landscaping and utilities . The applicant is applying for a Special Permit under Chapter 185 attachment 9: Schedule of Lot, Area, Frontage, Yard and Height requirements. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Copie [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Aug 10, 2026

Legal Notices

Planning Board to hear proposal for Franklin Plaza mixed-use development

The Franklin Planning Board will hold a public hearing regarding a Special Permit and Site Plan Application for a project titled “Franklin Plaza A Mixed Use Development”. The applicant, Fourzol, LLC, proposes constructing a four-story mixed-use building.

zoningmixed-usedevelopmentplanning-boardmain-street
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE REVISED ON JULY 14, 2026 In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, August 10, 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Special Permit and Site Plan Application titled “Franklin Plaza A Mixed Use Development ” prepared by Guerriere & Halnon, Inc., Milford, MA, and submitted to the Department of Planning & Community Development on July 6, 2026, by Fourzol, LLC, Franklin, MA. The property is located in the Downtown Commercial Zoning District (Assessors Map 279 Lots 172 and 173) at 9, 13 and 15 Main Street. The applicant is proposing to construct a four-story mixed -use building with associated parking, landscaping and utilities . The applicant is applying for a Special Permit under Chapter 185 attachment 9: Schedule of Lot, Area, Frontage, Yard and Height requirements. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Aug 13, 2026

Legal Notices

Public hearing for accessory pool project at 23 Anchorage Road

The Franklin Conservation Commission will hold a hybrid public hearing regarding a Notice of Intent for a project at 23 Anchorage Road. The commission will discuss a proposal to construct an accessory pool area.

conservationwetlandspublic-hearingzoning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 1 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, August 13th, 2026 at 7:04 PM on a Notice of Intent filed by Matthew S. Marro of Matthew S. Marro Environmental Consulting on behalf of Domenic Fruci of 23 Anchorage Rd, Franklin, MA. The applicant is proposing to construct an accessory pool area. Approximately 1,300 Square Feet (SF) of proposed work is entirely within the 50-100-foot Buffer Zone to Bordering Vegetated Wetlands (BVW.) The Project is located at 23 Anchorage Road, Map 207 Lot 7 within the Rural Residential I Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to access the meeting. All records and files for this project can be viewed at the Conservation Office located on the first floor of the Franklin Municipal Building. Any person or organization so wishing will be afforded an opportunity to be heard. The hearing location is accessible to persons with physical disabilities. If you require a t [Excerpt truncated on this listing page; use the official record for the full text.]

Reuniones recientes

Wed Jul 22, 2026

Legal Notices

Franklin Town Council hears request to transfer Lincoln Street Market liquor license.

The Franklin Town Council will hold a public hearing on July 22, 2026, regarding an application by Contractor & Sons Inc. d/b/a Lincoln Street Market. The applicant seeks modifications to their Section 15 All Alcoholic Beverages Package Store License to change officers/directors/LLC managers and stock interest. Residents may provide public input during the meeting at the Municipal Building or via Zoom.

liquor-licensepublic-hearingbusiness-transferfranklin-town-council
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA Modification of a Section 15 All Alcoholic Beverages Package Store License: Change of Officers/Directors/LLC Managers & Change of Stock Interest - Contractor & Sons Inc. d/b/a Lincoln Street Market, Located at 465 Lincoln St., Franklin, MA The Franklin Town Council will hold a Public Hearing on an application by Contractor & Sons Inc. d/b/a Lincoln Street Market, located at 465 Lincoln St., Franklin for multiple modifications of their Section 15 All Alcoholic Beverages Package Store License to include a Change of Officers/Directors/LLC Managers & Change of Stock Interest. This public hearing will take place during the Town Council Public Meeting beginning at 6:00 pm on Wednesday, July 22, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after July 17, 2026. Please call the Town Administrator’s Office at (508) 520-4949 if you require further information or to make arrangements for translation services. Respectfu [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026

Town Council

Council votes on sewer capacity transfers and other resolutions

The Franklin Town Council meeting on July 22, 2026 will consider several pieces of legislation, including resolutions to transfer portions of the town’s excess sewer capacity at the Charles River Treatment Plant to the towns of Millis and Medway. The agenda also includes a public hearing on the order of layout and acceptance of the J. Victor Lane drainage lot parcel, and multiple Section 15 alcoholic‑beverage license transactions for Georgio’s Liquors, Dacey’s Market, and Lincoln Street Market. Additional items are a bylaw amendment establishing a winter‑storm overnight parking ban, and the adoption of social media and email guidelines for elected and appointed officials. The council will also approve minutes, appointments, and recognize a new firefighter/paramedic.

sewerlicensingbylawszoningpublic-hearings
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet July 22, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #817 9687 9137 & Link: https://us02web.zoom.us/j/81796879137 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026

Charles River Pollution Control District (CRPCD)

Board will approve Warrant 27-01 covering $425,081 O&M and $117,075 capital costs

The Charles River Pollution Control District board will discuss revisions to its employee handbook and receive updates on the 2025 NPDES permit appeal and the aeration valve project. It will also consider the sale of capacity from Franklin to Millis. The meeting includes approval of two warrants totaling over $760,000 for operations and capital expenses, followed by reports, public comment, and routine approvals.

budgetoperationscapitalenvironmentpermitsinfrastructure
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING JULY 22, 2026 at 3:00 P.M. CONFERENCE ROOM AGENDA 1. Discussion and Potential Vote on Revisions to Employee Handbook 2. Update on 2025 NPDES Permit Appeal 3. Discussion on Aeration Valve Project 4. Update on Sale of Capacity from Franklin to Millis 5. Approval of Warrant 26-13 a) O & M $ 337,433.70 b) Capital $ 3,632.50 6. Approval of Warrant 27-01 a) O & M $ 425,080.96 b) Capital $ 117,075.00 7. Engineer’s Report a) Submitted Technical Evaluation for Need to Revise Local Limits b) Garelick Farms Report 8. Executive Director’s Report a) Sewer Connections (June 2026) Franklin 6 homes 1,870 gpd Medway 1 home 330 gpd Millis 1 home 440 gpd b) NPDES Permit Compliance Report (June 2026) c) Update on New Heating Oil Tanks d) Bank Account Balances as of June 30, 2026 9. Public Comment 10. Approval of Minutes from the June 10, 2026 Monthly Meeting 11. Anticipated Topics for the Wednesday, August 12, 2026 Monthly Board Meeting at 3:30 pm a) None
Wed Jul 22, 2026

Legal Notices

Public hearing on liquor license transfer for Dacey’s Market

The Franklin Town Council will hold a public hearing regarding an application by Contractors Family Market Inc. d/b/a Dacey’s Market. The body will consider the transfer of a Section 15 All Alcoholic Beverages Package Store License, along with a pledge of license and inventory.

liquor-licensepublic-hearingbusiness-permits
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA Transfer, Pledge of License & Pledge of Inventory of a Section 15 All Alcoholic Beverages Package Store License - Contractors Family Market Inc. d/b/a Dacey’s Market, Located at 353 Lincoln Street, Franklin, MA 02038 The Franklin Town Council will hold a Public Hearing on an application by Contractors Family Market Inc. d/b/a Dacey’s Market for a transfer to it of a Section 15 All Alcoholic Beverages Package Store License, presently held by Shikshapatri Corporation d/b/a Dacey’s Market and Deli, located at 353 Lincoln Street, Franklin, MA 02038, to be exercised by it at the same location, as well as a Pledge of License and Pledge of Inventory. This hearing will take place during the Town Council’s public meeting beginning at 6:00 PM on Wednesday, July 22, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after July 17, 2026. Please call the Town Administrator’s Office at (508) 520-4949 if you [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026

Legal Notices

Final vote on raising winter storm parking fines to $100-$300

The Franklin Town Council will hold a second reading and final vote on Bylaw Amendment 26-953, which increases fines for violating the winter storm overnight parking ban. Current $25 flat fine would be replaced with a tiered structure: $100 for first offense, $200 for second, and $300 for third and subsequent offenses. Public input will be accepted before the vote at the July 22, 2026 meeting.

parkingfineswinter-stormbylaw-amendmentpublic-hearingtown-council
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
LEGAL NOTICE FRANKLIN, MA The Franklin Town Council will hold a second reading and final vote on the adoption of Town Code Bylaw Amendment 26-953: A Bylaw to Amend the Code of the Town of Franklin at Chapter 170, Article X, Winter Storm Overnight Parking Ban, as follows: Section 170-63 Violations and Penalties. A. Winter storm overnight parking ban violators shall be charged a fine of $25 for each offense is hereby deleted and replaced with: A. Winter storm overnight parking ban violators shall be fined as follows for offenses occurring during each “effective time period” as defined in Section 170-64: 1. First offense: $100 2. Second offense: $200 3. Third and any subsequent offense: $300 The second reading and final vote will take place during the Town Council Public Meeting beginning at 6:00 pm on July 22, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after July 17, 2026. Please call the Town Administrator’s Office at (508) 520-4949 if you require further informatio [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026

Council on Aging

Wed Jul 22, 2026

Tri-County School Committee Nominating Committee

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tri-County Regional Vocational School Committee Appointment Committee Meeting Agenda July 22, 2026 5:15 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. ZOOM WEBINAR DETAILS: ID #848 5662 0995 & Link: https://us02web.zoom.us/j/84856620995 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Appointment of Tri-County Regional Vocational Technical School Committee Member a. Peter Wiernicki 2. Adjourn
Wed Jul 22, 2026

Legal Notices

Town Council to hear road acceptance request for J Victor Lane

The Franklin Town Council will hold a public hearing on July 22, 2026, to determine if it is in the public interest to accept J Victor Lane and a related drainage lot as a public way. The hearing will be held at the Municipal Building and via Zoom.

town-councilpublic-hearingroad-acceptancezoninginfrastructuremunicipal-building
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA Pursuant to Chapter 163 of the Legislative Acts of 2011, The Franklin Town Council will hold a public hearing to determine whether it is in the public interest to accept the following named road as a public way, together with related drainage lot. The roadway shown as J Victor Lane and the drainage lot identified as Parcel 1 on plan entitled “J Victor Lane Road Acceptance Plan Franklin Massachusetts” prepared by Colonial Engineering, Inc., dated April 28, 2026. The public hearing will take place during the Town Council Public Meeting beginning at 6:00 pm on July 22, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after July 17, 2026. Please call the Town Administrator’s Office at (508) 520-4949 if you require further information or to make arrangements for translation services. Respectfully Submitted by, Julie McCann
Wed Jul 22, 2026

Legal Notices

Public hearing on transfer of liquor license at 60 Franklin Village Drive

The Franklin Town Council will hold a public hearing on July 22, 2026, to consider an application by Franklin Georgios LLC d/b/a Georgio’s Liquors for transfer of a Section 15 All Alcoholic Beverages Package Store License currently held by Village Mall Liquors, Inc. d/b/a Village Mall Liquors at 60 Franklin Village Drive. The hearing also includes a pledge of license and pledge of inventory. The public may attend in person or via Zoom.

liquor-licensepublic-hearingalcoholtransferfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA Transfer, Pledge of License & Pledge of Inventory of a Section 15 All Alcoholic Beverages Package Store License - Franklin Georgios LLC d/b/a Georgio’s Liquors, Located at 60 Franklin Village Drive, Franklin, MA 02038 The Franklin Town Council will hold a Public Hearing on an application by Franklin Georgios LLC d/b/a Georgio’s Liquors for a transfer to it of a Section 15 All Alcoholic Beverages Package Store License, presently held by Village Mall Liquors, Inc., d/b/a Village Mall Liquors, located at 60 Franklin Village Drive, Franklin, MA 02038 Franklin, to be exercised by it at the same location, as well as a Pledge of License and Pledge of Inventory. This hearing will take place during the Town Council’s public meeting beginning at 6:00 PM on Wednesday, July 22, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after July 17, 2026. Please call the Town Administrator’s Office at (508) 520-494 [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 21, 2026

Design Review Commission

Design Review Commission will consider officer nominations and two project reviews

The Design Review Commission will meet on July 21, 2026 at 7:00 PM in the Town Council Chambers and via Zoom. The agenda includes officer nominations, a review of the Fresh Monkee project at 5 West Central Street, and a review of the Franklin Plaza project at 9, 13 and 15 Main Street. The commission will also consider the minutes from the June 16, 2026 meeting and address any new or old business items.

design-reviewnominationszoningmeetingsfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission 355 E. Central St. Franklin, MA 02038 P. 508.520.4907 www.franklinma.gov Agenda July 21, 2026 Town Council Chambers 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted in the Town Council Chambers, second floor of the Municipal Building at 355 East Central Street, while also available to be attended via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: July 21, 2026 07:00 PM Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/85043715386 Phone one-tap: +16469313860,,85043715386# 1. Officer Nominations 2. New Business a. Fresh Monkee – 5 West Central Street b. Franklin Plaza – 9, 13 and 15 Main Street 3. Meeting Minutes a. June 16, 2026 4. New Business/Old Business
Tue Jul 21, 2026

Housing Authority

Board will consider asphalt paving for office area parking under FISH Project #101199

The board will receive an update on net‑metering and discuss two FISH infrastructure projects: asphalt walkways (Project #101198) and asphalt paving for office‑area parking (Project #101199). It will also consider the salary for the Executive Director and plan the End‑of‑Summer Cookout for elderly residents. An executive session will follow the public agenda items.

net-meteringinfrastructureparkingsalarysenior-servicesexecutive-session
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing Authority Peter L. Brunelli Community Center 1000 Central Park Terrace Franklin, MA 02038 Special Meeting of the Board of Commissioners July 21, 2026 4:30 PM AGENDA  Chairman requests all cell phones to be silenced  Roll Call  Net Metering - Update  FISH Project #101198 - Asphalt Walkways  FISH Project #101199 – Asphalt Paving – Office Area Parking  ED Salary  End Of Summer Cookout Elderly  Executive Session  Adjournment
Thu Jul 16, 2026

Conservation

Conservation Commission to hold public hearings on three project sites

The Conservation Commission will conduct public hearings for projects at 110 Populatic Street, 23 Anchorage Road, and the Nicholas Drive/Prospect Street emergency culvert replacement. The body will also consider expenditures for Franklin Town Forest crossing rehabilitation and Farmers Market table cloths.

conservationpublic-hearingsenvironmentinfrastructuretown-forest
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission AGENDA JULY 16, 2026 REVISED 7/9/26 7:00 PM This Conservation Commission Meeting is available to be attended in person and via the ZOOM platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click/copy and paste the link https://us02web.zoom.us/j/89788467620 or call on your phone at 929-205-6099, meeting number is 897 8846 7620. Attendees are muted until they use the ‘raise hand’ function to indicate that they wish to speak. If you are having trouble accessing through the link, please call on your phone and use *6 to toggle between mute/unmute and *9 to raise your hand. If you wish to attend in person, this meeting will be held in the Council Chambers, second floor of the Municipal Building. The Franklin Conservation Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Conservation Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal Building. If you receive a suspicious email or are unsure if a request is legitimate, please contact the Department at 508-520-49 [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 16, 2026

Legal Notices

Audiencia pública sobre el proyecto de piscina en la zona de amortiguamiento de humedales en 23 Anchorage Rd

La Comisión de Conservación de Franklin llevará a cabo una audiencia pública híbrida sobre un Aviso de Intención para una piscina accesoria en 23 Anchorage Road. Aproximadamente 1,300 square feet de la obra propuesta se encuentran dentro de la zona de amortiguamiento de 50-100 pies de los Humedales Vegetados Colindantes. La audiencia permite comentarios del público.

conservation-commissionwetlandspublic-hearingbuffer-zonepool
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, July 16th, 2026 at 7:04 PM on a Notice of Intent filed by Matthew S. Marro of Matthew S. Marro Environmental Consulting on behalf of Domenic Fruci of 23 Anchorage Rd, Franklin, MA. The applicant is proposing to construct an accessory pool area. Approximately 1,300 Square Feet (SF) of proposed work is entirely within the 50-100-foot Buffer Zone to Bordering Vegetated Wetlands (BVW.) The Project is located at 23 Anchorage Road, Map 207 Lot 7 within the Rural Residential I Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to access the meeting. All records and files for this project can be viewed at the Conservation Office located on the first floor of the Franklin Municipal Building. Any person or organization so wishing will be afforded an opportunity to be heard. The hearing location is accessible to persons with physical disabilities. If you require a tra [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 16, 2026

Legal Notices

La Comisión de Conservación escucha el reemplazo de emergencia de un muro frontal en Prospect Street

La Comisión de Conservación de Franklin llevará a cabo una audiencia pública híbrida sobre un Aviso de Intención para el reemplazo de emergencia de un muro frontal de piedra y una alcantarilla a lo largo del lado sur de Prospect Street. El proyecto incluye el reemplazo de piedras del muro frontal, la remoción de sedimentos y el reemplazo de tuberías de aguas pluviales dentro de las zonas de amortiguamiento de humedales.

conservationwetlandspublic-hearingemergency-replacementheadwallculvertprospect-streetfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, July 16, 2025 at 7:05 PM on a Notice of Intent filed by Derek Adams on behalf of the Town of Franklin Department of Public Works for the emergency replacement of a stone headwall and culvert along the southern side of Prospect Street. Work includes replacement of headwall stones, removal of sediment caused by bank erosion, and replacement of stormwater pipes, all of which entail working within Bordering Vegetated Wetlands (BVW), the 100-foot Buffer Zone to BVW, Land Under Waterbodies/Waterways (LUWW), and the 200-foot Riverfront Area. Additionally, approximately 24 feet of the work is along Inland Bank. The Project is located at 12 Nicholas Drive along the side facing Prospect Street, Map 326, Lot 84, within the Rural Residential I Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to access the meeting. All records and files for this project can be viewed at the C [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 15, 2026

Communications Subcommittee

Subcommittee discusses council communication policies and engagement guidelines

The Communications Subcommittee will review protocols for email responses and social media engagement by elected and appointed officials. Members will also discuss Town Council office hours and debrief on recent community event attendance.

government-policycommunicationcommunity-engagementtown-council
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Communications Subcommittee Agenda & Meeting Packet July 15, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #811 0022 1126 & Link: https://us02web.zoom.us/j/81100221126 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Discussion: Debrief on Town Councilor attendance/presence at early summer 2026 community events 2. Town Council [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 13, 2026

Planning Board

Planning Board discusses Elena Estates subdivision and Grillo Estates endorsement

The Planning Board will hold a public hearing regarding a preliminary subdivision plan for 266 & 0 Pleasant Street. The board will also consider an endorsement for Grillo Estates.

zoningsubdivisionhousingland-use
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet July 13, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/89452658341 or call on your phone at 312- 626-6799, meeting #89452658341. PUBLIC HEARINGS 1. 266 & 0 Pleasant Street (Elena Estates) – Preliminary Subdivision Subdivision Plan Correspondence GENERAL BUSINESS: A. Endorsement: Grillo Estates B. Meeting Minutes: May 11, June 1 & June 22, 2026 This agenda is subject to change. The next meeting of the Planning Board is scheduled for July 27, 2026.
Mon Jul 13, 2026

School Committee

El Subcomité del Legado de Horace Mann discutirá el diseño del campus y las finanzas

El Subcomité del Legado de Horace Mann del Comité Escolar de Franklin se reúne para discutir una actualización del diseño del campus, una revisión financiera y un evento de mercado de agricultores. Todos los puntos están enumerados para discusión y pueden o no ser objeto de acción.

educationschool-committeesubcommitteecampus-designfinancial-reviewfarmers-market
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee July 13, 2026 7:00 PM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/81713274442?pwd=M0sryF5Burn5agXq1b7oCJemNHFptZ.1 Passcode:171766 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Campus Design Update ● Financial Review ● Farmer's Market Event
Mon Jul 13, 2026

Franklin's 250th Anniversary Celebration Committee

Committee discusses donor lists, grants, and book contracts

The committee is meeting to discuss the planning of the town's 250th anniversary. Discussion topics include individual donor event invitations, grant application processes, and a book contract.

anniversarygrantscommunity-events
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda July 13, 2026 7:30 PM Meeting will be virtual only A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97513480997?pwd=k4bn4LFsYP5qVqBmuox4kEZKZ0Zn7J.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Invitation list to our donor events of individuals 3. Process for researching, tracking, and applying for state and local grants 4. Book contract 5. Adjourn
Mon Jul 13, 2026

Legal Notices

Audiencia pública para la subdivisión de 4 lotes Elena Estates en Pleasant Street

La Junta de Planificación de Franklin llevará a cabo una audiencia pública el 13 de julio de 2026 para una solicitud de subdivisión preliminar llamada Elena Estates. El solicitante propone una subdivisión de 4 lotes con una parcela de drenaje en la propiedad en 266 y 0 Pleasant Street en el Distrito de Zonificación Single Family III. La junta puede votar para continuar la audiencia; cualquier continuación será publicada en su sitio web.

planning-boardpublic-hearingsubdivisionzoningpleasant-streetelena-estatessingle-family-iii
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, July 13 , 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Preliminary Subdivision application titled “Elena Estates” prepared by D&L Design Group , Milford, MA, and submitted to the Department of Planning & Community D evelopment on June 18, 2026, by Eric Marder, Lynnfield, MA. The property is located in the Single Family III Zoning District (Assessors Map 262 Lot 22 and Map 267 Lot 4.1 ) at 266 Pleasant Street and 0 Pleasant Street . The applicant is proposing to construct a 4-lot subdivision along with a separate drainage parcel. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Copies of the plan and supporting documentation may be reviewed in the Department of Planning & Community Development during regular office hours as well as on the Franklin Planning B [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 9, 2026

Legal Notices

La ZBA escuchará una solicitud de varianza para el retroceso del garaje en 9 Julie Dawn Drive

La Junta de Apelaciones de Zonificación (Zoning Board of Appeals) de Franklin llevará a cabo una audiencia pública el 9 de julio de 2026, para considerar una solicitud de varianza de Margaret Driscoll y Jonathan Carmine para un garaje adjunto propuesto en 9 Julie Dawn Drive. El garaje estaría a 25.4 pies del retroceso del patio lateral izquierdo, donde se requieren 40 pies, lo que motiva la necesidad de una varianza.

zoningvarianceboard-of-appealspublic-hearingsetbackgarage
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on July 9 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 0 pm Applicant: Margaret Driscoll Jonathan Carmine Address of Subject Property : 9 Julie Dawn Drive (Map 231 , Lot 026 ) Zoning District: RR I Petition Type: Variance Zoning B y-Law Sections: 1 85 Attachment 9 Schedule of Lot, Area, Frontage, Yard and Height Requirements Reason for Denial : Applicant is seeki ng to construct a 23 ’10 ” x 24 ’6 ” attached garage that is 25.4 ’ from the left side yard setback where 40 ’ is required. The building permit is denied without a Variance from the ZBA. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 9, 2026

Zoning Board of Appeals

La Junta de Zonificación considerará un desarrollo de condominios de 39 unidades y otras tres solicitudes de varianza

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública sobre cuatro solicitudes a las que se les denegaron permisos de construcción. Los puntos incluyen una varianza para el retroceso de un garaje en 9 Julie Dawn Drive, permisos especiales para incrementos de área impermeable en 2 Elizabeth Avenue y 365 Prospect Street, y un permiso integral para un desarrollo de condominios de 39 unidades en 202 Washington Street. La junta también aprobará las actas del 25 de junio de 2026.

zoningvariancesspecial-permitscomprehensive-permitcondominiumfranklinmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board of Appeals Agenda July 9, 2026 7:30 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers and Zoom Platform A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID # 943 0457 0422 & Link: https://zoom.us/launch/jc/94304570422 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR 1. Chair to identify members participating remotely. 2. APPROVAL OF MINUTES June 25, 2026 3. TOPIC 1. 7:30pm: 9 Julie Dawn Drive; Margaret Driscoll Jonathan Carmine: Applicant is seeking to construct a 23’10” x 24’x6” attached garage that is 25.4’ from the left side yard [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 9, 2026

Legal Notices

La ZBA escuchará el permiso especial para una ampliación en 2 Elizabeth Avenue

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública el 9 de julio de 2026, para considerar un permiso especial para una ampliación de 11' x 12' en 2 Elizabeth Avenue. La ampliación aumentaría el área impermeable al 19.6%, superando el límite del 15%, lo que causó que el permiso de construcción fuera denegado sin un permiso especial.

zoning-board-of-appealspublic-hearingspecial-permitimpervious-areaadditionfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on July 9 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 5 pm Applicant: Woodstock Building Associates, LLC Address of Subject Property : 2 Elizabeth Avenue (Map 236 , Lot 040 ) Zoning District: RR I Petition Type: Special Permit Zoning B y-Law Sections: 1 85-40D (I) (i) Reason for Denial : Applicant is seeking to install an 11 ’ x 12 ’ addition that increases the impervious area of the lot to 19.6% where 15% is allowed. The building permit is denied without a Special Permit from the ZBA. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu Jul 9, 2026

Municipal Affordable Housing Trust

Confianza para elegir oficiales y continuar discusiones sobre parcelas

La Franklin Municipal Affordable Housing Trust celebrará elecciones de oficiales y continuará las discusiones sobre las parcelas bajo su control. La junta también recibirá una actualización financiera que cubrirá los fondos generales y el proyecto Franklin Ridge. Se seguirá la aprobación de las actas de la reunión anterior y de los asuntos nuevos y antiguos.

affordable-housingmunicipal-housing-trustfinanceparcelsofficer-elections
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.520.4907 www.franklinma.gov Agenda July 9, 2026 Hybrid 2pm To all residents- this meeting is available to be attended in person in the 3rd Floor Training Room of the Town of Franklin Municipal Building or via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. When: Jul 9, 2026 02:00 PM Topic: Franklin Municipal Affordable Housing Trust Fund Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/83530876266 Phone one-tap: +13017158592,,83530876266# 1. Officer Elections 2. Cont. Discussion Trust Parcels 3. Finance Update a. General b. Franklin Ridge 4. Meeting Minutes a. May 14, 2026 5. New Business/Old Business
Thu Jul 9, 2026

Legal Notices

ZBA to hear permit request for 39-unit condominium development

The Zoning Board of Appeals will hold a public hearing regarding a comprehensive permit application. Next Generation Custom Homes Corp. is seeking this permit after a building permit for a condominium project was denied.

zoninghousingcondominiumsland-use
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on July 9 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:40 pm Applicant: Next Generation Custom Homes Corp. Address of Subject Property : 202 Washington Street (313-004, 304-044, 304-052) Zoning District: R-1 and I-1 Petition Type: Comprehensive Permit Zoning B y-Law Sections: See legal memorandum contained in application for a comprehensive permit dated June 2025 Reason for Denial : Applicant is seeking a building permit to construct a 39 unit condominium development. The building permit is denied without a Comprehensive Permit from the ZBA. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physica [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 9, 2026

Cultural District Committee

El Comité del Distrito Cultural revisa los informes de los subcomités y la actualización de la Copa del Mundo

El Comité del Distrito Cultural se reunirá para aprobar las actas de la reunión de junio, recibir los informes del presidente y de los subcomités, y escuchar actualizaciones sobre la Copa del Mundo y Franklin 250. La agenda incluye varias actualizaciones de subcomités como el Wind Phone, Fence Gallery y Artsy Boxes. No se enumeran votos ni decisiones específicas; la reunión es principalmente para actualizaciones informativas y asuntos rutinarios.

cultural-districtcommitteereportsupdatesfranklin-massachusettsartsculture
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee Meeting Thursday, July 9, 2026, 7:00 pm Franklin Recreation Department Conference Room, 235 Wachusett St., Franklin, MA (former Parmenter Elementary School) AGENDA A. Review and Approval of the Meeting Minutes o June 11, 2026, Cultural District Meeting B. Chairperson Report C. Sub-Committee Reports o Wind Phone (John) o Fence Gallery (John) o Artsy Boxes (John) o Storefront Frames (Pete) o Cultural Weekends (Pandora via notes) D. Arts, Culture and the Creative Economy, Updates (Cory Shea, Director) o World Cup Summary E. Franklin 250 update (Roberta Trahan, FCDC representative Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/Feedback Adjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: June 30, 2026 Posted: Sent to Town Clerk on May 6, 2026, for posting
Wed Jul 8, 2026

Historical Commission

La Comisión Histórica discutirá el presupuesto de 2027 y el renombramiento del representante del CPC

La Comisión Histórica de Franklin llevará a cabo una reunión ordinaria el 8 de julio de 2026, centrándose en los informes de los subcomités, incluidos los gastos finales de 2026 y el presupuesto de 2027, así como los comités Franklin 250 y Horace Mann Legacy. La comisión también considerará el renombramiento de Phyllis Malcolm como su representante en el Community Preservation Committee y revisará un MOU propuesto para una noche de Open Mic.

historical-commissionbudgetcommunity-preservationfranklin-250volunteersexhibitsmou
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Agenda, Weds., July 8 , 2026 , 6:00 pm Meeting at the Museum, 80 W. Central St Call to Order: APPROVAL OF MINUTES: June 10, 2026 FFHM REPORT: SUBCOMMITTEE REPORTS:  Final expense total for 2026, Budget for 2027  COMMUNITY PRESERVATION COMMITTEE:  FRANKLIN 250 UPDATE  FRANKLIN 250 Historical Sub Committee  HORACE MANN LEGACY COMMITTEE  ARCHIVIST UPDATE REGULAR BUSINESS:  Assessions and Deassessions  Exhibit Planning OLD AND NEW BUSINESS:  Update on FIFA History event June 14 (SSS)  Participation in National 13 Bells on July 4 event & reading of Declaration of Independence  Wedding exhibit -- Thanks to Jan as well as Mary and John for making this happen.  Reappoint Phyllis Malcolm as the Commission's Represenative on the Community Preservation Committee \  R eview upcoming speakers and exhibits  Orphanage talk/roundtable/reunion S unday, Sept 13  Update on Tri-County Bell Stand  Updating veteran KIA displays -- Rowan's progress  Display Case at Municipal Building  Review proposed MOU for Open Mic night  D ean College Interns etc. Rethinking how the Commission and Museum organized and how we host  Volunteer Scheduler  N ew Volunteers  Discuss continuing updates to exhibits … status of timeline, etc  Ic4K, Status of KiASK  Other matters not otherwise enumerated COMMISSIONER COMMENTS: ADJOURN
Tue Jul 7, 2026

Pole Petition Hearing

Verizon solicita permiso para antena de celda pequeña en 606 Pond Street

El Concejo Municipal de Franklin llevará a cabo una audiencia pública sobre una petición de Cellco Partnership d/b/a Verizon Wireless para una Concesión de Ubicación para instalar una antena inalámbrica de celda pequeña y equipo en el poste de servicios públicos existente #63-84 en 606 Pond Street. La audiencia permite que los residentes comenten en persona o vía Zoom. No hay otros puntos en la agenda.

telecommunicationssmall-cellpole-petitionpublic-hearingfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION HEARING Small Cell Wireless Antenna AGENDA July 7, 2026 1:00 PM Hearing will be held at the Franklin Municipal Building 355 East Central Street - Town Council Chambers, 2nd Floor A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. Additionally, residents are also welcome to participate remotely via Zoom. ZOOM WEBINAR DETAILS: I D # 825 3427 4536 & Link: https://us02web.zoom.us/j/82534274536 Call-In Phone Number: 1-929-205-6099, enter Meeting ID then # ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Petition of Grant of Location to locate a small cell wireless antenna and necessary sustaining and protecting features on the following public way - Cellco Partnership d/b/a Verizon Wireless 606 POND STREET (Existing Utility Pole #63-84), FRANKLIN, MA 025038 Verizon Wireless has submitted a Petition for Grant of Right in a Public Way to install, operate and maintain a “Small Cell” wireless communication antenna and supporting equipment on the above referenced utility pole [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 7, 2026

Franklin's 250th Anniversary Celebration Committee

El comité discute el protocolo de comunicados de prensa y comunicaciones de crisis

El Subcomité de Comunicaciones del Comité de Celebración del 250 Aniversario de Franklin se reunirá vía Zoom para discutir actualizaciones sobre pedidos de mercancía, material de marketing y estrategias de sitio web y redes sociales. También considerarán un borrador del protocolo para la aprobación de comunicados de prensa y comunicaciones de crisis, y si se cancela la reunión de agosto.

250th-anniversarycommunicationsmerchandisemarketingwebsitesocial-mediamedia-relationspress-releases
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Communications Subcommittee Agenda July 7, 2026 6:00 PM Meeting will be held on Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend via Zoom. ZOOM DETAILS: ID # 963 4707 8248 & Link: https://zoom.us/j/96347078248 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Approval of minutes 05/12/26 Minutes 06/2/26 Minutes 3. Agenda items a. Update on Merchandise orders and next steps. b. Marketing Collateral updates, including volunteer banners, etc. c. Rob to provide Website strategy and plan moving forward. d. Rob to provide Social Media strategy and plan moving forward. e. Alan to provide update on Media Relations timeline and Press Releases f. Discuss Press Release Approval Process and protocol for committee members making press comments and a process crisis communications (i.e. negative social media feedback) RE: Draft Document g. Discuss canceling Communications Subcommittee meeting for August 4. Adjourn
Thu Jul 2, 2026

Conservation

Audiencia pública continuada para 110 Populatic Street

La Comisión de Conservación considerará una solicitud de prórroga de una audiencia pública para un Aviso de Intención en 110 Populatic Street hasta el 16 de julio. Otros asuntos incluyen la discusión de un proyecto de vivienda asequible Friendly 40B, actividades menores en la zona de amortiguamiento como la instalación de un poste de National Grid en East Central Street, y una presentación educativa sobre aguas pluviales/MS4. La reunión es principalmente procedimental y no se esperan decisiones importantes.

conservationpublic-hearingcontinuanceaffordable-housingstormwaternational-gridbuffer-zone
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission AGENDA JULY 2, 2026 REVISED JULY 1, 2026 7:00 PM This Conservation Commission Meeting is available to be attended in person and via the ZOOM platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click/copy and paste the link https://us02web.zoom.us/j/89788467620 or call on your phone at 929- 205-6099, meeting number is 897 8846 7620 . Attendees are muted until they use the ‘raise hand’ function to indicate that they wish to speak. If you are having trouble accessing through the link, please call on your phone and use *6 to toggle between mute/unmute and *9 to raise your hand. If you wish to attend in person, this meeting will be held in the Council Chambers, second floor of the Municipal Building. The Franklin Conservation Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Conservation Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal Building. If you receive a suspicious email or are unsure if a request is legitimate, please contact the Department at 508 [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 2, 2026

Franklin Commission on Disability

La Comisión de Discapacidad elegirá funcionarios, discutirá el presupuesto del FY27 y los fondos para estacionamiento de personas con discapacidad

La Comisión de Discapacidad de Franklin elegirá un Presidente, un Vicepresidente y un Secretario. La agenda incluye actualizaciones sobre las cartas de incumplimiento de AAB y el Grupo de Trabajo de Accesibilidad, una discusión sobre transporte y una revisión del evento Strawberry Stroll. La comisión también discutirá ideas para el presupuesto del FY27 y los fondos para estacionamiento de personas con discapacidad.

disabilitycommissionofficersbudgettransportationhandicap-parkingaccessibility
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Commission on Disability Agenda and Meeting Packet Date : July 2, 2026 Time : 4:00pm Meeting will be held at : Senior Center, 10 Daniel McCahill St, Franklin, MA, Computer Room A note to residents : All citizens are welcome to attend public meetings in person. Please note : we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance The Town of Franklin does not discriminate on the basis of disability and is committed to providing accessible programs, meetings, and events. To request reasonable modification to participate in this program, please contact Gus Brown, ADA Coordinator, at [email protected] or 508-553-4855. Requests for ASL interpreter or CART services made after June 29, 2026 will be considered but may not be possible to fill. 1. Voting of Officers a. Clerk b. Vice Chair c. Chair 2. Announcements from the Chair a. AAB Non-Compliance Letters b. Accessibility Working Group (AWG) Updates c. Resident requests 3. Citizen Comments a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Commission cannot engage in a dialogue or comment on a matter raised during Citizen Comments. 4. Member Comments 5. Approval of Minutes: 6/4/26 6. Memb [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 1, 2026

Benjamin Franklin Classical Charter Public School

La junta discutirá la replicación de la escuela chárter

La junta de Benjamin Franklin Classical Charter Public School discutirá y potencialmente avanzará los planes para la replicación de la escuela chárter, junto con asuntos rutinarios que incluyen una votación sobre el representante de la facultad para el próximo año académico y la aprobación de las actas de reuniones pasadas.

educationcharter-schoolreplicationgovernancefacultymeeting-minutes
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOLThursday, July 9, 2026; 7-10pmIn Person-BFCCPSGoogle Meet joining info Video call link: https://meet.google.com/nzd-uvgj-wmu?hs=224Or dial: ‪(US) +1 443-424-3771 PIN: ‪776247480===================================7:00Call to Order 7:05Open comment period7:10Review and vote on meeting minutes from 6/9 meeting and outstanding Executive Session minutes7:15 New Trustee onboarding7:20ED update7:40 Vote on Faculty Representative for AY26-277:45Faculty Rep update7:50Discussion on charter school replication8:15ED goals8:30Board goals9:15Committee discussion and chairs9:25Review and approve 2026-2027 BoT meeting calendar9:35Schedule BoT breakfasts and other BoT opportunities9:45 Task List10:00 AdjournmentThe scheduled times as listed are approximate.
Wed Jul 1, 2026

Board of Health

Junta discutirá la retirada del METACOMET y la variante de 324 Pleasant St

La Junta de Salud de Franklin discutirá retirarse del Acuerdo de Servicio Compartido METACOMET y considerará una aprobación de mejora local o una solicitud de variante para 324 Pleasant Street. La reunión también incluye comentarios de ciudadanos y la aprobación de las actas del 3 de junio de 2026.

healthboard-of-healthvariancesagreementsmetacometpublic-hearing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet July 1,2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room meet.google.com/esz-tahn-xgd Join by phone (US) +1 260-383-1305 PIN: 851 521 839# A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. ➢ Any part i cipants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _ ______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. June 3, 2026 NEW BUSINESS a. Withdrawing from the METACOMET Shared Service Agreement Discussion b. Local upgrade approval / V [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

School Committee

El Comité Escolar votará sobre la ratificación del contrato sindical

El Comité Escolar de Franklin se reunirá virtualmente para considerar la ratificación del Contrato del Sindicato de Profesionales de Apoyo Educativo. El único punto de acción sustantivo es una votación sobre el contrato según lo discutido en sesiones previas.

school-committeeunion-contractratificationeducational-support-professionals
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee June 29, 2026 Virtual Only 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair  Vision Statement  The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89129826401?pwd=HuvHow4i24lTe06ZM3JA3hlBNOOSRd.1 Passcode:774445 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 253 205 0468 US +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listin [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

School Committee

El Comité Escolar votará sobre el contrato del sindicato del personal de apoyo

El Comité Escolar de Franklin considerará la ratificación del Contrato del Sindicato de Profesionales del Apoyo Educativo. Este es el único punto de acción sustantivo en la agenda; el resto de la reunión consiste en asuntos procesales rutinarios.

educationschoolscontractunionlabor
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee June 29, 2026 Virtual Only 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair  Vision Statement  The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89129826401?pwd=HuvHow4i24lTe06ZM3JA3hlBNOOSRd.1 Passcode:774445 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 253 205 0468 US +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listin [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

School Committee

El Comité Escolar ratificará el contrato del sindicato del personal de apoyo

El Comité Escolar de Franklin considerará la ratificación del Contrato del Sindicato de Profesionales del Apoyo Educativo. Este es el único punto de acción sustantivo en la agenda. La reunión se llevará a cabo virtualmente a las 7:00 PM.

school-committeeunion-contracteducational-support-professionalsratificationfranklin-public-schools
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee June 29, 2026 Virtual Only 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair  Vision Statement  The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89129826401?pwd=HuvHow4i24lTe06ZM3JA3hlBNOOSRd.1 Passcode:774445 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 253 205 0468 US +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listin [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

Agricultural Commission

La Comisión Agrícola analiza metas futuras y próximos eventos del mercado de agricultores

La comisión revisará acciones y logros pasados mientras analiza metas futuras. La reunión también incluye un informe sobre el Evento del Día de Plantación de Semillas/Mercado de Agricultores del 18 de abril de 2026.

agriculturefarmers-marketcommunity-events
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 6/29/2026 7:00pm A NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded. ZOOM MEETING DETAILS: Topic: Ag Com Time: Jun 29, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/88308465960?pwd=o5e9xwUQOQ9Gbq220akfKxi2E12aeF.1 Meeting ID: 883 0846 5960 Passcode: 260560 One tap mobile +13017158592,,88308465960#,,,,*260560# US (Washington DC) +13052241968,,88308465960#,,,,*260560# US l. Approval of the minutes - from April 27, 2026 meeting. ll. Old Business: A. 4-18-26 Seed Planting Day/Farmers Market Event- Report III. New Business: A. Review the Agricultural Commission’s past actions and accomplishments and discuss future goals and actions. B. Upcoming Farmers Market Events: Zucchini Race & Pumpkin Festival Respectfully Submitted, Marian Szymanski
Mon Jun 29, 2026

Franklin's 250th Anniversary Celebration Committee

El Subcomité analiza video, historias orales y folleto para el 250 aniversario

El Subcomité de Significado Histórico del Comité de Celebración del 250 aniversario de Franklin se reunirá para analizar varios puntos de planificación. Los miembros explorarán el alcance y el costo de un proyecto de video, una iniciativa de historias orales y un folleto conmemorativo, entre otras ideas. No se esperan decisiones, solo discusión y orientación.

anniversaryhistoricalvideooral-historycommemorative-bookletpublic-history
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration CommitteeHistorical Significance SubcommitteeAgendaJune 29, 20267:30 PM Meeting will be held at the Franklin Historical Museum, 80 Wesst Central, and virtually via Zoom.A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom..ZOOM DETAILS: https://zoom.us/j/94989481869?pwd=LMBtQWc5jPaareD7SSS38TY6lUXhBd.1View meeting insights with Zoom AI Companionhttps://zoom.us/launch/edl?muid=af4f687b-13ec-458b-99e5-8353f9c71eb6Meeting ID: 949 8948 1869Passcode: 702060One tap mobile+13126266799,,94989481869#,,,,*702060# US (Chicago)+16465588656,,94989481869#,,,,*702060# US (New York)Join by SIP• [email protected] instructionshttps://zoom.us/meetings/94989481869/invitations?signature=uWrL9MdSJJ0T-KiR802zLfLhQtJvDiweYm7FGeE-j30Agenda1.Announcements from the chair2.Approval of minutesa.April 27, 2026 3.Agenda itemsa. Discuss (with guidance from Lee) what we can and should attempt in the video medium. Where can we start, what will it require/cost plus potential role of Dean, FHS, and Franklin TV.b.Discuss proposed Oral History project, possibly with multiple locations, ongoing dates, etc. First steps? When? Who? (A possible SpreadSheet to track people we would like to interview is here.) Can we start immediately?c.Discuss proposed program to collect and initiate existing personal and institutional histories, per suggestion of Lyn (See spreadsheet here)d.Beginning the work of assembling verbiage for a town com [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 25, 2026

Legal Notices

La Junta de Zonificación escuchará la apelación del permiso de piscina para 365 Prospect Street

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública el 25 de junio de 2026 para considerar una solicitud de permiso especial de Vinicius Almeida para una piscina enterrada en 365 Prospect Street. La piscina aumentaría el área impermeable del lote al 19.67%, excediendo el 15% permitido, razón por la cual el permiso de construcción fue denegado sin un permiso especial. La junta decidirá si otorga el permiso.

zoningspecial-permitpoolsimpervious-areapublic-hearingfranklin-mazoning-board-of-appeals
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on June 25 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 5 pm Applicant: Vinicius Almeida Address of Subject Property : 365 Prospect Street (Map 309 , Lot 019 ) Zoning District: RR I Petition Type: Special Permit Zoning B y-Law Sections: 185-40 D (I) (i) Reason for Denial : Applicant is seeking to install an inground pool that increases the impervious area of the lot to 19.67 % where 15% is allowed. The building permit is denied without a Special Permit from the ZBA. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu Jun 25, 2026

Zoning Board of Appeals

La ZBA considerará una varianza para un garaje y un permiso especial para una piscina

La Junta de Apelaciones de Zonificación de Franklin escuchará dos solicitudes: una petición de varianza para un garaje adjunto propuesto en 79 Oxford Drive que violaría el retroceso del patio lateral, y una solicitud de permiso especial para una piscina enterrada en 365 Prospect Street que excedería el área impermeable permitida. La junta también podría aprobar las actas de su reunión anterior y discutir asuntos generales.

zoningvariancespecial-permitfranklin-maboard-of-appeals
✓ Decidido: ZBA grants variance for attached garage at 79 Oxford Drive

The Zoning Board of Appeals approved a variance for a residential garage addition and continued a hearing for an inground pool request pending engineered drainage plans.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board of Appeals Agenda June 25, 2026, 7:30 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers and Zoom Platform A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID # 946 0494 8210 & Link: https://zoom.us/j/94604948210 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR 1. Chair to identify members participating remotely. 2. APPROVAL OF MINUTES May 14, 2026 3. TOPIC 1. 7:30pm: 79 Oxford Drive: Matthew Gagnon & Kelly MacBain; Applicant is seeking to construct a 30’ x 30.5’ attached garage with a room above that is 12.2’ from the right side yar [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 553-4856 Fax: (508) 520-4906 1 Town of F ranklin Zoning Board of Appeals Thursday, June 25 , 2026 Meeting Minutes Chair Ginelle Lang called the above-captioned meeting held in the Town Council Chambers, second floor of the Franklin Municipal Building, 355 E. Central Street, and online via the Zoom platfor m to order this date at 7:30 PM. Members in attendance : Ginelle Lang, Chair; Jennifer Williams, Vice Chair; Isabella Carter, Clerk; Joseph Halligan , Associate; Meghan Whitmore, Associate. Members absent: None. Also in attendance: Casey Thayer, Administrative Assistant; Gus Brown, Building Commissioner . The following was provided on the agenda and read aloud by Chair Lang . All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205- 6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ANNOUNCEMENTS FROM THE CHAIR: Chair Lang announced Ms. Carter is going to continue on the Zoning Board of Appeals for another three-year term starting on July 1, 2026, which was voted [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 25, 2026

Legal Notices

La ZBA escuchará una solicitud de varianza para un garaje en 79 Oxford Drive

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública el 25 de junio de 2026, para considerar una solicitud de varianza de Matthew Gagnon & Kelly MacBain para la propiedad en 79 Oxford Drive. Los solicitantes buscan construir un garaje adjunto de 30' x 30.5" con una habitación arriba que estaría a 12.2 pies del retroceso de patio lateral requerido de 20 pies. El permiso de construcción fue denegado sin una varianza, por lo que la junta decidirá si concede el alivio.

zoningvariancepublic-hearingzoning-board-of-appealsfranklin
Wed Jun 24, 2026

Ad Hoc Town Charter Review Committee

El Comité de Revisión de la Carta Municipal analiza posibles cambios en la estructura del gobierno municipal

El Comité Ad Hoc de Revisión de la Carta Municipal llevará a cabo su reunión inicial para analizar el proceso de enmienda de la Carta Municipal y revisar la historia de estudios anteriores de la carta (1984, 1995, 2010, 2013). El comité también examinará una lista preliminar de asuntos de la carta planteados durante la última década, incluyendo si varios cargos electos (Town Clerk, Constables, Board of Health, Board of Assessors) deberían pasar a ser designados, y si deberían alterarse la duración de los mandatos del Town Council, School Committee y Planning Board.

town-chartercharter-reviewgovernment-structureelected-officialsappointed-positionsterm-limitsmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town Charter Ad Hoc Committee Agenda & Meeting Packet June 24, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street -2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #849 2192 3523 & Link: https://us02web.zoom.us/j/84921923523 Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Call to Order 2. Town Charter Ad Hoc Committee Charge 3. Discussion on the process to amend a Town Charter a. Tow [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 24, 2026

Council on Aging

Políticas y procedimientos del Centro para Personas Mayores sujetos a revisión final

Esta es una reunión mensual rutinaria del Franklin Council on Aging. El elemento sustantivo principal es una revisión de las Políticas y Procedimientos finalizados del Centro para Personas Mayores. Otros asuntos incluyen un informe de comité sobre la actualización de la carpeta del COA y un reconocimiento a Collette Ferguson. La reunión también cubre elementos procesales estándar como las actas, el informe del director y las actualizaciones de los comités.

agingsenior-centerpoliciesprocedurescouncil-on-agingfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Council on Aging Meeting Agenda June 24, 2026 11:00 AM Meeting will be held at the Franklin Senior Center 10 Daniel McCahill Street, Franklin, MA 02038 1. Call to order; 11:00 AM 2. Minutes of last meeting 3. Citizen’s Comments 4. Correspondence 5. Director’s Report 6. Chairman’s Comments 7. FOFE Liaison Report 8. Old Business ● Collette Ferguson Appreciation 9. New Business 10. Committee Reports ● Budget Committee ● Bylaw Committee ○ Review finalized Senior Center Policies & Procedures ○ Updating COA Binder ● Expo Committee ● Housing Committee ● Nominating Committee ● Program Committee ● Supportive Day Committee 11. Comments 12. Agenda for Next Meeting 13. Adjournment Next Meeting: July 22, 2026 11:00AM
Wed Jun 24, 2026

Legal Notices

Audiencia pública sobre la antena de celda pequeña de Verizon en 606 Pond Street

El Administrador del Pueblo llevará a cabo una audiencia pública el 24 de junio de 2026, con respecto a la solicitud de Verizon Wireless para instalar una antena de celda pequeña y equipo de apoyo en un poste de servicios públicos existente en 606 Pond Street. La audiencia es requerida bajo las Leyes Generales de Massachusetts. Los ciudadanos pueden asistir en persona o vía Zoom.

public-hearingtelecommunicationssmall-cellverizonpond-street
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA PETITION OF GRANT OF LOCATION TO ATTACH A SMALL CELL ANTENNA AND SUPPORTING EQUIPMENT TO A UTILITY POLE Cellco Partnership d/b/a Verizon Wireless Verizon Wireless requests permission to locate a small cell wireless antenna and necessary sustaining and protecting features, on the following public way: 606 POND STREET (Existing Utility Pole #63-84), FRANKLIN, MA 02038 In conformity with the requirements of Sections 22 and 25A of Chapter 166 of the Massachusetts General Laws, Verizon Wireless has submitted a Petition for Grant of Right in a Public Way to install, operate and maintain a “Small Cell” wireless communication antenna and supporting equipment on the above referenced utility pole and depicted on the attached plans. You are hereby notified that a Public Hearing will be held in the Council Chambers on the second floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Wednesday, June 24, 2026 at 12:15 p.m. upon the petition by Cellco Partnership d/b/a Verizon Wireless regarding the attached petition. All citizens are welcome to attend public meetings in person. Additionally, citizens will also be able to participate remotely via Zoom. ● Zoom ID: 825 3427 4536 ● Link: https://us02web.zoom.us/j/82534274536 ● Call-In Phone Number: 1-929-205-6099, enter Meeting ID, [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 24, 2026

School Committee

El Comité Escolar votará sobre la ratificación del contrato del sindicato ESP

El Comité Escolar de Franklin votará sobre la ratificación del contrato del Sindicato de Profesionales de Apoyo Educativo. Se ha programado una sesión ejecutiva para discutir la estrategia de negociación colectiva. La reunión es únicamente virtual.

school-committeeunion-contractcollective-bargainingexecutive-session
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee June 24, 2026 Virtual Only 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair  Vision Statement  The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89129826401?pwd=HuvHow4i24lTe06ZM3JA3hlBNOOSRd.1 Passcode:774445 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 253 205 0468 US +1 253 215 8782 US (Tacoma) +1 346 248 7799 US (Houston) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listin [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 23, 2026

School Committee

El Comité Escolar ratificará los contratos sindicales de la cafetería, secretarias y conductores de camionetas

El Comité Escolar de Franklin votará sobre la ratificación de los contratos sindicales para los Trabajadores de Cafetería, Secretarias y Conductores de Camionetas. También considerarán una primera lectura de una política sobre restricción física y aislamiento, eliminarán una política obsoleta y aprobarán un manual de conducta de reuniones. La agenda de consentimiento incluye la aceptación de donaciones para diversos programas escolares.

school-committeeunion-contractspoliciesdonationsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee June 23, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/87160110414?pwd=Emid5HBpWnA63wsfjOa9w4YTuUKpnH.1 Passcode:181550 Join via audio: +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 689 278 1000 US +1 719 359 458 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 22, 2026

Library Board of Directors

La junta de la biblioteca discutirá el borrador de la planificación estratégica y actualizaciones de subvenciones

La Junta Directiva de la Franklin Public Library se reunirá para discutir un borrador de metas, acciones y resultados de la planificación estratégica, y recibir actualizaciones del director de la biblioteca sobre una subvención para la restauración de un mural y mejoras en las instalaciones. La junta también considerará el voluntariado para el Comité de Celebración del 250 aniversario del pueblo.

librarystrategic-planninggrantsfacilitiesanniversary
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors MeetingJune 22, 20267:00 PMMeeting RoomAgenda1.Call to Order2.Public CommentPatrons are welcome to express their views for up to three minutes on a matter that is not on the agenda but relates to library concerns. The Board will not engage in a dialogue or comment on a matter raised during public comments. The Library Board will give remarks appropriate consideration and may ask the Library Director to review the matter.3.Approval of Minutes4.Report of Board membersDiscussionoStrategic planningGoals, Actions and Outcomes/results - DraftoLibrary Board volunteer for the 250th Anniversary Celebration Committee.5.Library Director’s ReportMural Restoration Grant - UpdateFacilities improvement - Update6.Agenda items for next meeting. September 28, 20267.Adjourn
Mon Jun 22, 2026

Planning Board

La Junta de Planificación llevará a cabo audiencias sobre 900 Washington St y 555 King St

La Junta de Planificación de Franklin llevará a cabo audiencias públicas sobre el retiro de una modificación de subdivisión definitiva en 900 Washington Street y una modificación del plan del sitio en 555 King Street. La junta también considerará la liberación de una fianza para Tanglewood Estates, un Formulario H parcial para 230 East Central Street, un plan de aprobación no requerida (ANR) para Longhill Road y un convenio para Adin Estates. Todos los puntos están abiertos al comentario público.

planning-boardpublic-hearingssubdivisionsite-planbondsanrcovenantfranklin
✓ Decidido: Planning Board approves bond release and partial occupancy for East Central Street

The Board approved a $6,155.46 bond release for Tanglewood Estates (I) and granted a partial Form H for 230 East Central Street while withholding five units until completion. Additionally, the Board approved an ANR plan for Longhill Road, a covenant for Adin Estates, and a withdrawal for 900 Washington Street.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet June 22, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/81964750662 or call on your phone at 312- 626-6799, meeting #81964750662. PUBLIC HEARINGS 1. 900 Washington St (Olam Estates) – Definitive Subdivision Modification Withdrawal 2. 555 King Street – Site Plan Modification Site Plan Modification Correspondence GENERAL BUSINESS: A. Bond Release: Tanglewood Estates (I) B. Partial Form H: 230 East Central Street C. 81-P ANR: Longhill Road D. Covenant: Adin Estates This agenda is subject to change. The next meeting of the Planning Board is scheduled for July 13, 2026. Notice: The Franklin Planning Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Planning Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal Building. If you receive a suspicious email or are unsure if a request is legitimate, please contact the Department at 508-520-4907 to verify any [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board June 22, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, Council Chambers, 2nd Floor, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk (via Zoom); Mark Mucciarone (via Zoom); Eric Steltzer. Members absent: William Lee, associate member. Also present: Amy Love, Town Planner; Michael Maglio, Town Engineer (via Zoom); Matthew Crowleye, BETA Group (via Zoom). Note: Documents presented to the Planning Board are on file. GENERAL BUSINESS A. Bond Release: Tanglewood Estates (I) Ms. Love said this is the original Tanglewood Estates building in from approximately 2000. The Walpole Cooperative Bank reached out to inform me that there is remaining bond money in the form of a tri-partite agreement from Tanglewood Estates built several years ago. The amount of the bond is $6,155.46. The Board will need to vote to release the bond. She said the town used a lot of the money to finish the road. Chair Rondeau asked if all documents have been provided and recorded at the Registry of Deeds. Mr. Maglio said it was late 1990s/early 2000s that the original developer defaulted. The previous town [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 22, 2026

Library Board of Directors

La junta de la biblioteca analiza el plan estratégico y las actualizaciones de subvenciones

La Junta Directiva de la Biblioteca Pública de Franklin analizará los objetivos y acciones de la planificación estratégica, y recibirá actualizaciones sobre una subvención para la restauración de un mural y mejoras en las instalaciones. No hay votos vinculantes programados; la reunión consiste en informes y discusiones.

librarystrategic-planninggrantsfacilitiesanniversary
Thu Jun 18, 2026

Conservation

La Comisión de Conservación revisará la reparación de un culvert, un proyecto eléctrico y un plan de sitio

La Comisión de Conservación de Franklin considerará una revisión por pares de la reparación del culvert en Nicholas Drive y Prospect Street, revisará un proyecto de Mass Electric MBZA en Pleasant Street y examinará un plan de sitio revisado para 670 King Street. No se enumeran otros puntos en la agenda.

conservationinfrastructurewaterelectricityplanning
✓ Decidido: Conservation Commission approves $1M+ culvert repair on Nicholas/Prospect St (7-0)

The Conservation Commission approved a Notice of Intent for an emergency culvert repair at Nicholas Drive/Prospect Street, with conditions including dewatering plans and seed mix approval. The project is a temporary repair, with a full replacement estimated at $1 million to $1.5 million in the future. The vote was unanimous (7-0).

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Conservation Agenda Header Franklin Conservation Commission Meeting Agenda This Conservation Commission Meeting is available to be attended in person and via the ZOOM platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click/copy and paste the link HTTPS://US02WEB.ZOOM.US/J/85632917684 call on your phone at 929 - 205-6099, meeting number is 856 3291 7684. Attendees are muted until they use the ‘raise hand’ function to indicate that they wish to speak. If you are having trouble accessing through the link, please call on your phone and use *6 to toggle between mute/unmute and *9 to raise your hand. If you wish to attend in person, this meeting will be held in the Council Chambers, second floor of the Municipal Building. The Franklin Conservation Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Conservation Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal Building. If you receive a suspicious email or are unsure if a request is legitimate, please contact the Department at 508 -520-4929 to verify any outstanding fees related to your applicati [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 17, 2026

Town Council

El Concejo votará sobre las apropiaciones del FY26, transferencia de nieve y hielo, y aceptación de donaciones

El Concejo Municipal de Franklin votará sobre tres resoluciones: Apropiaciones, Transferencias y Ajustes de los Fondos Generales del FY26 (Resolución 26-36), una Transferencia de la Cuenta de Estabilización de Nieve y Hielo (Resolución 26-30), y la aceptación de una donación de $750 para Servicios de Veteranos. La reunión también incluye la toma de posesión de nuevo personal de seguridad pública y los nombramientos anuales de juntas y comités.

budgetappropriationspublic-safetypersonnelappointmentsveterans
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet June 17, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #864 9630 3883 & Link:https://us02web.zoom.us/j/86496303883 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting m [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 17, 2026

Franklin's 250th Anniversary Celebration Committee

El Comité del 250 Aniversario elegirá tesorero, revisará el presupuesto y los eventos

El Comité de Celebración del 250 Aniversario de Franklin se reunirá para elegir un tesorero, aprobar las actas del 28 de mayo y recibir informes de los subcomités sobre el presupuesto (ventas de mercancía, libro conmemorativo), eventos (lanzamiento, recaudaciones de fondos de otoño) y comunicaciones (sitio web, redes sociales, comunicado de prensa). La agenda se centra principalmente en la organización y la planificación.

celebrationcommitteeanniversarybudgeteventscommunicationsvolunteers
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda June 17, 2026 | 7:00 PM Meeting will be held at the Franklin Municipal Building Third Floor Training Room 80 W. Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. ZOOM DETAILS: Meeting ID: 932 0126 1566 | Passcode: 303716 https://zoom.us/j/93201261566?pwd=JIno5OLOAfav3AtqNh264LTCG4DY46.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair a. FY26 Earmark Budget b. Town Council presentation 2. Approval of minutes a. 5/28/26 3. Treasurer election 4. Volunteering signups (including FIFA) 5. Subcommittee reports a. Budget i. Merch 1. Sales from Stroll 2. New options ii. Commemorative book b. Events i. “3” Launch ii. Fall Fundraisers– “Donor Brunch” c. Communication i. Website ii. Social media iii. Press Release d. Historical Importance 6. Member comments & future agenda items 7. Adjourn
Tue Jun 16, 2026

Massachusetts Strategic Health Group

La Junta votará sobre el procedimiento de la orden de pago del año fiscal '27 y el requisito de pago ACH

La junta del Massachusetts Strategic Health Group se reunirá para revisar el estado del déficit, discutir una opinión del asesor legal del fideicomiso sobre la Ley de Reuniones Abiertas y decidir sobre la continuación de los servicios de SaveOn. Hay varias votaciones programadas, incluyendo el respaldo de un nuevo procedimiento de orden de pago para el año fiscal '27, la obligatoriedad de los pagos de los miembros vía ACH y un pago doble de la tasa de trabajo del empleador en julio que exonera a tres nuevos miembros que comiencen el 1 de julio de 2026.

health-groupboard-meetingbudgetfinanceopen-meeting-lawvotingpolicy
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
MASSACHUSETTS Strategic Health Group Abington Medway SEBRSD DCRSD MURSD Templeton Franklin Northbridge Valley Trust Grafton NRSD Webster Massachusetts Strategic Health Group Board Meeting Tuesday, June 16, 2026, at 1:00 PM Gladys E. Kelly Public Library 2 Lake Street, Webster MA Join the meeting now Meeting ID: 228 670 311 254 13 Passcode: dL6ns97d 1. A ttendance 2. Accept Minutes of May 26, 2026 3. Deficit Status Report – Kevin Paicos 4. Trust Counsel opinion regarding the Open Meeting Law status of Board Meetings. – Rick LaFond 5. ROI for SaveOn and decision to contiue services for July 1, 2026 – Eric Avrumson 6. Report on Withdrawing Member’s Deficits/Surpluses – Ken Lombardi 7. Volunteers for MSHG Agreement Review Committee – Steve Lamarche 8. Review of FY ‘27 Bill Warrant procedure and Board endorsement – Kevin Paicos a. Bo ard vote to endorse new Bill Warrant procedure b. B oard vote to require Member payments via ACH. c. B oard vote to require double July employer working rate payment exemp�ng 3 new 7/1/26 members. 9. Set next Mee�ng Date
Tue Jun 16, 2026

Design Review Commission

La Comisión de Revisión de Diseño revisará cinco proyectos comerciales

La Comisión de Revisión de Diseño llevará a cabo una reunión virtual para revisar las solicitudes de diseño de varias propiedades comerciales, incluyendo un hotel, un salón, un club de ventas al por mayor y otros. La comisión también aprobará las actas de la reunión anterior.

design-reviewcommercialhotelretailzoning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams, Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.520.4907 www.franklinma.gov Agenda June 16, 2026 Virtual Meeting 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: June 16, 2026 07:00 PM Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/85043715386 Phone one-tap: +16469313860,,85043715386# 1. New Business a. Ola Salon- 648 Old West Central Street b. Franklin Extended Stay Hotel- 835 Upper Union Street c. Plansee- 115 Constitution Boulevard d. BJ’s Wholesale- 100 Corporate Drive e. Intermission- 36 Main Street 2. Meeting Minutes a. May 19, 2026 3. New Business/Old Business
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4907 Fax: (508) 520-4906 1 Town of Franklin Design Review Commission Tuesday, June 16, 2026 Meeting Minutes Chair Sam Williams called the above-captioned meeting to order this date at 7:01 PM, as a remote access virtual Zoom meeting. This meeting was recorded. The following is stated on the agenda: Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided on the agenda. Members in attendance: Chair Sam Williams, Vice Chair Andrew Pratt, Derek Darvish, Associate Priya Natarajan. Members absent: Kyle Galvin, Associate James Bartro. Also present: Morena Zelaya, Director of Planning & Community Development. NEW BUSINESS: a. Ola Salon - 648 Old West Central Street Mr. Cam Afonso of Signs by Cam said this is a new owner of the salon with a new name. They are replacing the old channel letter set with a new channel letter set on the building and two new sign faces on the street. He said standard installation on the raceway. Motion: To Approve the sign package as submitted. Motioned by A. Pratt. Seconded by D. Darvish. Roll Call Vote: Pratt-YES; Darvish-YES; Natarajan-YES; Williams-YES. Voted 4-0 (4-Yes; 0-No). A representative for the next item listed on the agenda, Franklin Extended Stay Hotel - 835 Upper Union Street, was not present at this time, so the item was taken out [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 15, 2026

Housing Authority

La Junta discutirá la morosidad de Norfolk, el seguro de equipo nuevo y la actualización del CPC

La Junta de Comisionados de la Autoridad de Vivienda de Franklin llevará a cabo una reunión regular para aprobar las actas y las cuentas por pagar de mayo, recibir los informes del director y de las instalaciones, y revisar los estados operativos. Las discusiones notables incluyen una actualización sobre la morosidad de la Norfolk Housing Authority, un servicio de consulta de seguridad de la Worcester Housing Authority y créditos de medición neta de National Grid. La junta también considerará una nueva póliza de seguro para el equipo Bobcat y una reelección del Comité de Preservación Comunitaria.

housingfinanceinsurancesafetynet-meteringcommunity-preservation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing Authority1000 Central Park TerraceCommunity HallFranklin, MA 02038Regular Meeting of the Board of CommissionersJune 15, 20264:30 PMChairman requests all cell phones to be silencedRoll Call MinutesMinutes of the Regular Meeting of May 11, 2026Accounts PayableAccounts Payable for May 2026Capital One Charges for May 2026Director of Facilities ReportDirector Report Operating Statements – April 2026 Community Preservation Committee (CPC) Update – Commissioner Feeley Correspondence – Thank you NoteNorfolk HA Update – Managing AgencyNorfolk delinquencyOld BusinessCommissioner’s Training ReportSafety Consultation Services – provided by Worcester Housing AuthorityNational Grid – Net Metering CreditsNew BusinessNew Insurance Policy for Bobcat Skid Steer, Bobcat 4x4 and VentracChris Feeley – Community Preservation Committee re-election Adjournment
Fri Jun 12, 2026

School Committee

Discusión del Strawberry Stroll en la reunión del Comité Escolar de Franklin

El Comité Escolar de Franklin se reunirá el 12 de junio de 2026 para discutir asuntos comunitarios. La agenda señala que el Strawberry Stroll puede ser presentado para discusión. No se enumeran otros puntos específicos.

school-committeecommunity-relationsevents
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Community Relations Sub Committee June 12, 2026 4-8 PM Downtown Franklin A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." ● Strawberry Stroll
Thu Jun 11, 2026

Cultural District Committee

El Comité del Distrito Cultural escuchará actualizaciones sobre eventos y el 250 aniversario

El Comité del Distrito Cultural revisará las actas del 13 de mayo, recibirá actualizaciones de los subcomités sobre PorchFest, Windphone, Fence Gallery, Artsy Boxes, marcos de escaparates y Cultural Weekends, y escuchará al Director Cory Shea sobre Strawberry Stroll, un mural de Kayla Nisbet, World Cup Fan Zone y Restaurant Week. También se presentará una actualización sobre el 250 aniversario de Franklin. Los asuntos pendientes y nuevos podrían incluir votaciones.

cultural-districteventsartscommunityfranklin-250thpublic-artcommittees
✓ Decidido: Committee approved prior minutes; no new actions were decided

The Cultural District Committee approved the May 13, 2026 meeting minutes. No votes or formal actions were taken on any agenda items. The meeting consisted of updates on events, artwork installations, and upcoming plans.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee MeetingThursday, June 11, 2026, 7:00 pmFranklin Historical Museum, 80 West Central Street., Franklin AGENDAA.Review and Approval of the Meeting Minutes oMay 13, 2026, Cultural District Meeting B.Chair UpdateC.Sub-Committee Updates oPorchFest (John)oWindphone (Amy)oFence Gallery (John/Cory)oArtsy Boxes (John/Amy)oStorefront/Outdoor frames (Pete)oCultural Weekends (Pandora)D.Arts, Culture and the Creative Economy Updates – Cory Shea, DirectoroStrawberry Stroll and Cultural HuboMural by Kayla NisbetoWorld Cup & Fan ZoneoRestaurant WeekE.Franklin, MA 250th Anniversary update - Roberta Trahan, FCDC representative Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/FeedbackAdjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: June 4, 2026Posted: Sent to Town Clerk on June 5, 2026, for posting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Cultural District Committee Meeting Minutes | June 11, 2026 Meeting Name: Cultural District Committee Meeting Date: June 11, 2026 Time: 7:00 – 9:00 pm Location: Franklin Senior Center Chairperson: John LoPresti Secretary: Katherine Botelho 1. Call to Order ● Time: 7:01 p.m. ● Chairperson: John LoPresti ● Attendance: ○ Present Members: ■ John LoPresti ■ Peter Rochat ■ Roberta Trahan ■ Pandora Carlucci ■ Sue Cass ■ Absent Members: ■ Patrick Conlon ■ Katherine Botelho Guests/Other Attendees: Cory Shea, Director of Arts, Culture and the Creative Economy Margaret Munson, Franklin Art Association 2. Approval of Previous Meeting Minutes ● Minutes from May 13, 2026 ○ Approved: Yes ○ Amendments: No 3. Agenda Items from June 11 Meeting: a. Updates from the Chairperson ● Chairman LoPresti congratulated members Patrick Conlon, Sue Cass and Peter Rochat who have volunteered to serve another three- year term on the Committee. ● LoPresti reported on Porch Fest. Fifty bands participated on 30 porches. Estimated attendance was 1,500, with over 150 visitors to the information booths. Overall feedback was positive. Improvements planned for 2027 include better staggering of band times around the common. Porch Fest 2027 is scheduled for June 5,2027. ● LoPresti reported that the first Fence Gallery artwork is now up in two locations, the former Davis Thayer School and the MBTA fence across from the Rome Restaurant. A second gallery is being p [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 11, 2026

Municipal Affordable Housing Trust

Reunión municipal cancelada; no se consideraron puntos de la agenda

La reunión programada del Municipal Affordable Housing Trust para el 11 de junio de 2026 fue cancelada. Como resultado, no se llevaron a cabo decisiones ni discusiones. No se abordaron puntos de la agenda.

housingaffordable-housingmunicipal
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair TOWN of FRANKLIN MASSACHUSETTS 355 E. Central St. Franklin, MA 02038 P. 508.520.4907 www.franklinma.gov June 11, 2026 CANCELED
Thu Jun 11, 2026

Zoning Board of Appeals

Reunión de la Junta de Apelaciones de Zonificación de Franklin cancelada el 11 de junio de 2026

La reunión del 11 de junio de 2026 de la Junta de Apelaciones de Zonificación ha sido cancelada. La próxima reunión está programada para el 25 de junio de 2026. No se discutieron ni decidieron puntos.

cancellationzoning-board-of-appealsfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING June 11, 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR June 25, 2026
Thu Jun 11, 2026

School Committee

El Comité Escolar llevará a cabo una sesión ejecutiva para negociaciones de contratos

Se trata de una reunión a puerta cerrada donde el Comité Escolar discutirá la estrategia de negociación colectiva y llevará a cabo sesiones de negociación con cuatro unidades de empleados: Conductores de Van, Cafetería, ESP/LPN y Secretarios. No hay votos ni discusiones públicas programadas; toda la reunión se lleva a cabo en sesión ejecutiva bajo la ley estatal.

school-committeecollective-bargainingexecutive-sessionlabor-negotiationsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Contractual Negotiations May 28, 2026 - 551 Pond St. Training Room -CANCELED June 3, 2026 - Municipal Building Training Room 4:30-7:30 PM June 11, 2026 - Municipal Building Training Room 4:30-7:30 PM June 17, 2026 - 551 Pond St. Training Room A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1. Call to Order 2. Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. b. Pursuant to M.G.L. c. 30A, §21(a)(2) to conduct collective bargaining sessions with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units.
Wed Jun 10, 2026

Legal Notices

Votación final sobre la enmienda al reglamento que aumenta múltiples tarifas de servicios municipales

El Concejo Municipal de Franklin llevará a cabo una segunda lectura y votación final sobre la adopción de la Enmienda al Reglamento 26-952 para modificar el Programa de Tarifas de Servicios en el Capítulo 82 del Código Municipal. La enmienda propone aumentos en diversas tarifas, incluyendo servicios de ambulancia, permisos de inspección y cargos de obras públicas. Habrá una oportunidad para la participación pública durante la reunión del 10 de junio de 2026.

feestown-councilbylaw-amendmentambulancepermitspublic-workszoning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
LEGAL NOTICE FRANKLIN, MA The Franklin Town Council will hold a second reading and final vote on the adoption of Town Code Bylaw Amendment 26-952: A Bylaw to Amend the Code of the Town of Franklin at Chapter 82, §82-6, Schedule of Service Fees, which proposes to amend the fee schedule by making additions and deletions as follows: §82-6, Schedule of service fees A. Administration. Service Fee Rate Passport photo $12 $15 C. Assessors Service Fee Rate Certified List of Abutters $35 $40 F. Fire Service Fee Rate Ambulance Fees ALS Base Rate 1 $2,583 $2,701 ALS Base Rate 2 $3,684 $3,794 BLS Rate $1,769 $1,885 Commercial care facility without transport $935 Mileage $41 $43 H. Inspections Service Fee Rate Variance / Special permits - residential $200 Variance / Special permits - commercial $350 Comprehensive permits $100 per unit Electrical permits (new, remodeling, pools, solar panels) $100 up to five fixtures; $10 per fixture thereafter; $250 cap on all residential electrical, per residential unit, per application J. Planning Service Fee Rate Sign Approval $75 L. Public Works. Service Fee Rate Beaver Street Recycling Center (annual sticker fee) $35 $50 Curbside trash (annual) Overflow bag $3 $4 The second reading and final vote on adoption of this bylaw amendment will take place during the Town Council Public Meeting beginning at 7:00 pm on June 10, 2026; there will be an [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 10, 2026

Charles River Pollution Control District (CRPCD)

CRPCD votará sobre $1.73M en evaluaciones de alcantarillado del primer trimestre para el año fiscal 2027

La junta del Charles River Pollution Control District votará sobre la aprobación de las evaluaciones de proyectos de capital y O&M del primer trimestre del año fiscal 2027, que suman $1,726,660 de los pueblos miembros Bellingham, Franklin, Medway y Millis. La junta también discutirá y votará sobre un ajuste por costo de vida para el año fiscal 2027 y una transferencia de $31,200 al fondo fiduciario OPEB. Están programadas discusiones sobre actualizaciones del recurso de apelación del permiso NPDES, conexiones de alcantarillado y el rendimiento de la planta.

wastewatersewernpdes-permitbudgetassessmentsopebcola
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING JUNE 10, 2026 at 3:00 P.M. CONFERENCE ROOM AGENDA 1. Update on 2025 NPDES Permit Appeal 2. Discussion and Vote on the Cost of Living Adjustment for FY 2027 3. Vote to Transfer $31,200 to the OPEB Trust Fund as outlined in the FY 2026 Budget 4. Discussion and Vote to Transfer $XX,XXX from the General Stabilization Fund to the General Operating Account for XXX 5. Approval of First Quarter O & M and Capital Projects Assessments for FY 2027 Town O & M Capital Total Bellingham $97,700 $63,660 $161,360 Franklin $771,420 $227,180 $998,600 Medway $306,730 $44,140 $350,870 Millis $186,840 $28,990 $215,830 Totals $1,362,690 $363,970 $1,726,660 6. Approval of Warrant 26-12 a) O & M $ XXX,XXX b) Capital $ XXX,XXX 7. Engineer’s Report a) Submitted the Landfill Report to MassDEP b) Analysis on the Local Limits – Requirement with new NPDES Permit 8. Executive Director’s Report a) Sewer Connections (May 2026) Franklin 2 homes 880 gpd Millis 1 home 440 gpd b) NPDES Permit Compliance Report (May 2026) c) Update on Plant Performance d) Update on Copper Sampling in Mine Brook Interceptor (MBI) e) Update on Elevator f) Distribution of Employee List MONTHLY MEETING JUNE 10, 2026 at 3:00 PM Page 2 9. Public Comment 10. Approval of Minutes from the May 13, 2026 Monthly and Annual Meetings 11. Anticipat [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 10, 2026

Town Council

El Concejo Municipal adoptará el presupuesto del año fiscal 2027, escuchará la transferencia de una licencia de licor y considerará una ordenanza sobre la prohibición de estacionamiento

El Concejo Municipal de Franklin votará la adopción del presupuesto del FY2027 y varias resoluciones relacionadas, incluyendo enmiendas para el Council on Aging y transferencias para proyectos de capital y estabilización de camiones de bomberos. Se llevará a cabo una audiencia pública sobre la transferencia de una licencia de tienda de paquetes de vino y bebidas malteadas para DeVita's Market. El concejo también considerará una primera lectura de una enmienda a la ordenanza para regular las prohibiciones de estacionamiento nocturno durante tormentas invernales.

budgetliquor-licenseparkingbylawfinancial-transferscommunity-preservationcouncil-on-aging
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet June 10, 2026 7:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #860 1320 5721 & Link: https://us02web.zoom.us/j/86013205721 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 10, 2026

Legal Notices

Audiencia pública sobre la transferencia de la licencia de licores para DeVita's Market

El Concejo Municipal de Franklin llevará a cabo una audiencia pública sobre una solicitud para transferir una licencia de Tienda de Paquetes de Vino y Bebidas de Malta de la Sección 15 de DeVitas Market LLC a Om Devitas Market Inc., ambas operando como DeVita's Market en 198 East Central Street. La audiencia también cubre una prenda de la licencia y una prenda de inventario. La reunión comienza a las 7:00 PM el 10 de junio de 2026, en el Edificio Municipal y vía Zoom, con oportunidad de participación pública.

alcohol-licensepublic-hearingtown-councilfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA Transfer, Pledge of License & Pledge of Inventory of a Section 15 Wine and Malt Beverages Package Store License - Om Devitas Market Inc. d/b/a DeVita’s Market, Located at 198 East Central St., Franklin, MA 02038 The Franklin Town Council will hold a Public Hearing on an application by Om Devitas Market Inc. d/b/a DeVita’s Market for a transfer to it of a Section 15 Wine & Malt Beverages Package Store License, presently held by DeVitas Market LLC d/b/a DeVita’s Market, located at 198 East Central St., Franklin, to be exercised by it at the same location, as well as a Pledge of License and Pledge of Inventory. This hearing will take place during the Town Council’s public meeting beginning at 7:00 PM on Wednesday, June 10, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after June 5, 2026. Please call the Town Administrator’s Office at (508) 520-4949 if you require further information or [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 10, 2026

Historical Commission

La Comisión escuchará la propuesta de Micrófono Abierto de Poesía, discutirá exhibiciones y eventos

La Franklin Historical Commission discutirá un programa propuesto de Micrófono Abierto de Poesía, revisará múltiples planes de exhibición (incluyendo veteranos, policía/bomberos, el 50.º aniversario de la huelga de maestros y la Old South Meeting House), y recibirá actualizaciones sobre subcomités y eventos comunitarios. No se registran votos finales en la mayoría de los puntos, ya que muchos son temas de discusión o actualizaciones.

historical-commissionfranklinmassachusettsexhibitspoetry-open-micww2-memorialteacher-strikehabitat-for-humanity
✓ Decidido: Historical Commission approves poetry open mic program pending MOU

The commission voted unanimously to launch a free poetry open mic event at the Franklin Historical Museum, starting in September with Thursday evening sessions from 6 to 8 p.m., pending a final joint memorandum of understanding. Members also discussed planning a 2027 exhibit for the Teachers Strike anniversary and requested church participation for National 13 Bells on July 4. Several volunteer coordination updates and display assignments were distributed but require further scheduling or approval.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin MassachusettsHistorical CommissionAgenda, Weds., June 10, 2026, 6:00 pm Meeting at the Museum, 80 W. Central StAPPROVAL OF MINUTES – May 13, 2026CITIZENS COMMENTS: PRESENTATIONS: Jamele and Amy Adams on proposed Poetry "Open Mic" Program FFHM REPORT: SUBCOMMITTEE REPORTS: TREASURER/ARCHIVIST FINANCIAL REPORT: COMMUNITY PRESERVATION COMMITTEE: FRANKLIN 250 UPDATEFRANKLIN 250 Historical Sub CommitteeHORACE MANN LEGACY COMMITTEEARCHIVIST UPDATEREGULAR BUSINESS:Assessions and DeassessionsExhibit Planning -- Veterans exhibits and Police/FireOLD AND NEW BUSINESS:Habitat for Humanity (gift, upcoming presentation 6/25, future briefings of home owner) DCR Signage in State ForestMostly BaroqueLetter to SC requesting re-mounting of WW2 Memorial Plaque at the High School -- no response yetWrentham Declaration of Independence 6-5-26 5-7 pm Wrentham CommonHistoric Huddle in Plainviille -- a summary -- and plans for Huddle in Franklin later in the yearSept 2027 50th anniversary of teacher strike -- a possible exhibit and gathering. Seeking sense of commissionWedding exhibitHow or if to exhibit about Old South Meeting House this summerOrphanage Sept.?Update on Tri-County Bell StandParticipation in National 13 Bells on July 4 eventUpdating veteran KIA displays -- Rowan's progressDisplay Case at Municipal Building: Update on FIFA History event June 14 (SSS)Hosting Assignments for July and/or August (bring your calendar!)Duplication of effort/scheduling [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Minutes, Weds., June 10, 2026, 6:00 pm Meeting at the Museum, 80 W. Central St The Meeting was called to order at 6 PM by Chair Alan Earls. In attendance were Jan Prentice, Phyllis Malcolm, Randy LaRosa and Brandon Carrico a well as Associate Mary O'Leary and volunteer JoAnn Sanford. Scott Mason and Will Lee were not able to attend. The minutes for May 13, 2026 were approved unanimously The presentation by Jamele Adams on proposed Poetry "Open Mic" Program at the museum was moved to 6:45 pm due to travel problems. At that time, Jamele described how he and his wife, Amy, would like to relaunch a free (at least initiatlly), 'open mic' evening, probably on THursdays from 6-8 at the museum, starting in September. Jamele and Amy have experience with running such events and all we have to do is open the place. He also hope to engage high school students. This was received enthusiastically and there was a unanimous vote to move ahead, subject to completion of a joint MOU outlining the terms and conditions FFHM REPORT: SUBCOMMITTEE REPORTS:  There was an informal presentation by Phyllis estimating that there is probably a few hundred dol lars left in our account. Alan will review areas for potential investments.  Phyllis reported that the CPC met recently and will meet again on June 23 to finalize spending  Alan provided a brief updated on Franklin 250 -- which has been mostly focused on meeting a spending [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 9, 2026

Benjamin Franklin Classical Charter Public School

Reunión de la Junta de Fidecomisarios de Benjamin Franklin Classical Charter Public School

La Junta de Fidecomisarios se reunirá para revisar las actas anteriores y votar sobre los nuevos solicitantes para el año académico 2026-27. La reunión incluye la elección de los oficiales de la junta y una sesión ejecutiva sobre el acuerdo de trabajo del Director Ejecutivo.

educationgovernanceschool-boardcharter-school
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOL BOARD OF TRUSTEES MEETING Tuesday, June 9, 2026 7-10pm In Person–BFCCPS Google Meet joining info: meet.google.com/dpt-ypip-qrd Call In Information: +1 414-909-5071 PIN: 327 335 126# =================================== 7:00 Call to Order 7:05 Open Comment Period 7:10 Review and vote on meeting minutes from May 22nd meeting 7:15 ED Update 7:40 Faculty Rep Update 7:50 Introduction and vote on BoT Applicants AY 26-27 8:30 Election of BoT Officers for AY 26-27 9:00 Adjourn to Executive Session 9:15 ED Work Agreement 9:25 Recognition of outgoing board members 9:40 Committee Updates ● DEIB ● Facilities ● Finance ● Governance ● HR ● Mission 9:50 Task List 10:00: Adjournment The scheduled times as listed are approximate.
Tue Jun 9, 2026

School Committee

El Comité Escolar adoptará una política sobre perros de terapia

El Comité Escolar de Franklin llevará a cabo una reunión ordinaria con votaciones sobre una política que permite perros de terapia/apoyo emocional en las escuelas, el nombramiento del Superintendente Lucas Giguere en la Junta de ACCEPT y la aprobación del informe de evaluación del Superintendente. El comité también escuchará actualizaciones sobre operaciones/instalaciones y el comité de IA del distrito, y entrará en sesión ejecutiva para la negociación colectiva.

school-committeepolicytherapy-dogsappointmentsdonationscollective-bargainingexecutive-session
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee June 9, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89621203740?pwd=jhint5Ejw2ifBWNBfWp1FDlaf9foyH.1 Passcode:399476 Join via audio: +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 719 359 4580 US A G E N D A “T [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 9, 2026

School Committee

El subcomité de políticas votará sobre las políticas de perros de apoyo emocional y alquiler de instalaciones

El Subcomité de Políticas del Comité Escolar de Franklin se reunirá para revisar las actas y aprobar diversas políticas, incluyendo la señalización de reconocimiento de logros estudiantiles, las políticas de alquiler de instalaciones y una política de perros de apoyo emocional. También discutirán una política de perros de terapia/apoyo emocional y considerarán nuevos puntos de política sobre el uso intencional de la tecnología, excursiones escolares y actualizaciones de MASC.

school-committeepolicyemotional-support-dogsfacility-rentaltechnologyfield-tripsmasc-updates
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN SCHOOL COMMITTEE Policy Subcommittee Meeting DATE: 6/9/26 TIME: 6:00 PM Members of the public are now welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Meeting feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak will be able to raise their hand to be egies by the Chair. The meeting host will invite the attendee to unmute for comment. Location: Municipal Building 3rd floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/852 18280192? pwd=iKUU2Lgk3ATBK4HaFpMvXTpGZK2pHn.1 Passcode:921535 Join via audio: +71 309 205 3325 US +1312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US AGENDA “The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law.” |. Attendance - ll. Review of Minutes lll. Approved Policies A, JRE -Student Achievement Recognition Signage B. Facility Rental Policies (KE, KF-E1, KF-E2, KF-E3, KF-E4, KF-E5) C. [ID - Emotional Support Dog IV. Discussion of Policies sent to School Committee A. IMGB - Therapy/Emotional Support Dogs V. Discussion & Revisions on Polici [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 8, 2026

School Committee

El subcomité de Horace Mann discute informes y actualizaciones de eventos

El Sub Comité del Legado de Horace Mann se reúne para escuchar los informes del equipo sobre narración educativa, alcance público y diseño del campus, y para recibir actualizaciones sobre los próximos eventos, incluyendo el Strawberry Stroll, la World Cup Fan Zone y el Farmers Market. No hay votos ni decisiones programadas.

franklin-public-schoolsschool-committeesubcommitteehorace-manneventseducation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee June 8, 2026 7:00 PM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89801600806?pwd=0odMy9V0zrEY096CRjxttEeGxYN6E1.1 Passcode:118973 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Team Report Out ○ Education & Storytelling ○ Public Outreach ○ Campus Design ● Upcoming Event Updates ○ Strawberry Stroll ○ World Cup Fan Zone ○ Farmers Market
Mon Jun 8, 2026

Franklin's 250th Anniversary Celebration Committee

El Comité votará sobre la asignación de fondos FY26 para mercancía y diseño web

El Comité de la Celebración del 250 Aniversario de Franklin se reunirá virtualmente para escuchar anuncios del presidente sobre la guía MOTT. El punto principal es una votación sobre la asignación de fondos FY26, que incluye segundas cifras de mercancía, un pedido de Amazon y una revisión del proveedor de diseño web.

250th-anniversarycelebration-committeebudgetearmarkmerchandiseweb-designvirtual-meeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda June 8, 2026 8:00 PM Meeting will be virtual only A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97513480997?pwd=k4bn4LFsYP5qVqBmuox4kEZKZ0Zn7J.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair a. MOTT guidance 2. FY26 Earmark Vote a. Second Merch #s b. Amazon order c. Web design vendor review 3. Adjourn
Thu Jun 4, 2026

Franklin Commission on Disability

La Comisión de Discapacidad planificará el Strawberry Stroll, revisará el presupuesto e incorporará nuevos miembros

La Comisión de Discapacidad de Franklin discutirá anuncios que incluyen las Cartas de Incumplimiento de AAB y actualizaciones del Grupo de Trabajo de Accesibilidad. La agenda incluye la planificación del evento Strawberry Stroll, la incorporación de los nuevos miembros Steve Papsis, John Lynch y Julie McCann, y la revisión del informe presupuestario de finales del FY26. La comisión también nominará oficiales para una votación en julio y considerará temas futuros como documentos accesibles y opciones de reuniones virtuales.

disabilityaccessibilitycommissionbudgeteventsonboardingfranklin-ma
✓ Decidido: Commission approves May minutes, sets Strawberry Stroll plan

The commission approved the May 7, 2026 minutes. Members discussed the upcoming Strawberry Stroll event, deciding on a fragrance-free, simple setup at the corner of Emmons and Main Street. Officer voting was postponed to the July 2 meeting. The budget is exhausted until a $1,000 replenishment in July.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Commission on Disability Agenda and Meeting Packet Date : June 4, 2026 Time : 4:00pm Meeting will be held at : Senior Center, 10 Daniel McCahill St, Franklin, MA, Computer Room A note to residents : All citizens are welcome to attend public meetings in person. Please note : we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance The Town of Franklin does not discriminate on the basis of disability and is committed to providing accessible programs, meetings, and events. To request reasonable modification to participate in this program, please contact Gus Brown, ADA Coordinator, at [email protected] or 508-553-4855. Requests for ASL interpreter or CART services made after April 30, 2026 will be considered but may not be possible to fill. 6/4/26 1. Announcements from the Chair a. AAB Non-Compliance Letters b. Accessibility Working Group (AWG) Updates 2. Citizen Comments a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Commission cannot engage in a dialogue or comment on a matter raised during Citizen Comments. 3. Member Comments 4. Approval of Minutes: 5/7/26 5. New member onboarding : Steve Papsis, John Lynch, Julie McCann 6. Educat [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 4, 2026

Economic Development Subcommittee

El Subcomité discutirá el plan de trabajo 2026-27 y la propuesta de impuesto hotelero

El Subcomité de Desarrollo Económico de Franklin discutirá el plan de trabajo 2026-2027, que abarca la revitalización del centro, mejoras en los permisos y oportunidades de parques industriales. También considerarán una propuesta de legislación de impuesto hotelero de autonomía local (home rule) para añadir un 2% a las estancias hoteleras locales. Las discusiones adicionales incluyen estrategias de marketing y próximos eventos comunitarios.

economic-developmenthotel-taxdowntown-revitalizationzoningpermittingmarketingmaster-plancommunity-events
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Economic Development Subcommittee Agenda & Meeting Packet June 4, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street -3rd Floor, Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #892 2221 5968 & Link: https://us02web.zoom.us/j/89222215968 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Call to Order 2. Upcoming events: a. Restaurant Week: May 31 - June 6 b. Porchfest: June 6 c. Franklin Downto [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 4, 2026

Conservation

La Comisión de Conservación revisará solicitudes de zona de amortiguamiento, alteración de sitio y cumplimiento

La Comisión de Conservación de Franklin discutirá actividades menores de la zona de amortiguamiento en 10 Symphony Drive, modificaciones de permisos para la alteración del sitio en King Street y una solicitud de certificado de cumplimiento para 37 Hancock Road. No se especifican votos ni decisiones; estos son temas para discusión.

conservationbuffer-zonepermitscompliancefranklin
✓ Decidido: Adopted electronic signatures policy for document execution (6-0)

The Conservation Commission continued two public hearings (Nicholas Drive/Prospect Street culvert repair and 110 Populatic Street) to June 18, 2026. It approved a Minor Buffer Zone Activity at 10 Symphony Drive with conditions, a permit modification at 555 King Street, a certificate of compliance for 37 Hancock Road, and extended a violation enforcement at 8 Bogastow Brook Lane for 90 days. The commission also adopted the use of electronic signatures under M.G.L. c.110G, reappointed Richard Johnson to the Community Preservation Commission, and approved $850 for a forest stewardship plan at Riverbend Conservation Area.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Conservation Agenda Revised 6-04-2026 REVISED AGENDA CONSERVATION.PDF Minor Buffer Zone Activities 10 SYMPHONY DRIVE MBZA PLANS AND LETTER.PDF Permit Modifications KING STREET - SITE ALTERATION LETTER.PDF KING STREET - SITE ALTERATION EXHIBIT.PDF Certificates Of Compliance 2026-05 COC REQUEST 37 HANCOCK ROAD SE159-878.PDF 2006 AS-BUILT PLAN 37 HANCOCK ROAD.PDF 1. 7:00 P.M. Documents: 2. Documents: 3. Documents: 4. Documents:
Wed Jun 3, 2026

School Committee

El Comité Escolar entrará en sesión ejecutiva para la negociación sindical

Esta reunión es principalmente una sesión ejecutiva para discutir la estrategia de negociación colectiva y llevar a cabo sesiones con las unidades de Conductores de Van, Cafetería, ESP/LPN y Secretarios. La sesión abierta consistirá únicamente en un llamado al orden antes de entrar en la sesión cerrada.

school-committeecollective-bargainingexecutive-sessionlabor-negotiationsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Contractual Negotiations May 28, 2026 - 551 Pond St. Training Room -CANCELED June 3, 2026 - Municipal Building Training Room 4:30-7:30 PM June 11, 2026 - Municipal Building Training Room 4:30-7:30 PM June 17, 2026 - 551 Pond St. Training Room A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1. Call to Order 2. Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. b. Pursuant to M.G.L. c. 30A, §21(a)(2) to conduct collective bargaining sessions with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units.
Wed Jun 3, 2026

Board of Health

La Junta discutirá la prohibición de establecimientos de Bodyworks

La Junta de Salud discutirá varios temas nuevos de negocios, incluyendo una posible prohibición de establecimientos de Bodyworks, actualizaciones sobre refugios de calefacción y enfriamiento, la página de Facebook del departamento de salud y la Expo de Salud de la Mujer. También recibirán informes de la Metacomet Shared Service Grant para el agente de salud y la enfermera de salud pública. La agenda incluye la aprobación de las actas del 6 de mayo de 2026 y comentarios de los ciudadanos.

healthpublic-healthbodyworksshelterssocial-mediagrantswomen-health
✓ Decidido: Board of Health approves May meeting minutes and discusses shelter updates

The Board approved the May 6, 2026, meeting minutes with a spelling amendment. Discussion included warming and cooling shelter availability at local churches and an update on the Women’s Health Expo. A proposal to ban bodywork establishments was deferred for further research.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet June 3,2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room meet.google.com/mbv-rhvg-pcj Join by phone (US) +1 401-594-2558 PIN: 536 196 038# A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. ➢ Any part i cipants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _ ______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. May 6, 2026 NEW BUSINESS a. Update on warming and cooling shelters discussion b. Health department Facebook page discussion [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
BOH MEETING MINUTES June 3, 2026 In attendance: Chair, Kim Mu-Chow; Vice Chair, Jeff Harris; Member, Diane Daddario; Cathleen Liberty, Director; Ginny McNeil, Health Agent; Alisha Sullivan; Public Health Nurse, Kerry MacKay, Health Agent Guests: In person: Steve Sherlock, Tess Bower Via Google Meet: CALL TO ORDER: ► Chair Mu-Chow called the meeting to order at 5:02 pm. CITIZENS COMMENTS: ►Steve Sherlock noted that Franklin Matters will also share items that the health department is posting on FaceBook and provide insight. APPROVAL OF MINUTES: ►May 6, 2026 ►MOTION to Approve the May 6, 2026 meeting minutes with amendment to fix the spelling of mitragynine. Harris. SECOND by Daddario. No discussion. ►ROLL CALL VOTE: Mu-Chow-YES; Daddario-YES►Jeff Harris-YES VOTE: Yes-3, No-0-Abstain 0 NEW BUSINESS Update on warming and cooling shelters in Franklin discussion Director Liberty noted that New England Chapel and Franklin United Methodist Church have agreed to be the warming and cooling shelter on Sundays from 8:30-4:30. Chair Mu-Chow noted that the police and fire should be notified of this too. Health Department Facebook page discussion Director Liberty discussed that our new Marketing person set us up on Facebook so we could showcase all the good work the health department is doing. Women’s Health Expo update discussion Alisha noted that the expo was a success and that there were 21 vendors at the expo and 17 women were signed up fo [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 3, 2026

Finance Committee

El Comité votará sobre el presupuesto operativo municipal revisado para el año fiscal 2027 y transferencias de fondos

El Comité de Finanzas considerará un presupuesto operativo revisado del Administrador Municipal para el año fiscal 2027 de aproximadamente $152.5 millones, junto con varias resoluciones para transferencias de fondos y proyectos de capital. La agenda incluye una transferencia del fondo de estabilización de MECC, financiamiento de la ronda 2 de capital para equipo de DPW y una asignación para la compra de una ambulancia. El comité también revisará las asignaciones anuales de la Ley de Preservación Comunitaria y las actualizaciones de fin de año para los fondos de tormentas y nieve y hielo del año fiscal 2026.

budgetfinancecapital-improvementscommunity-preservation-actpublic-safetyrevenuestabilization-fund
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Wednesday, June 3, 2026 Meeting will be held at the Municipal Building 2nd Floor Council Chambers 355 East Central Street 6:00 PM A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details: ID #817 7063 7337 & (https://us02web.zoom.us/j/81770637337 ) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 2, 2026

Franklin's 250th Anniversary Celebration Committee

Subcomité seleccionará proveedores para libro infantil y sitio web

El Subcomité de Comunicaciones del Comité de la Celebración del 250 Aniversario de Franklin discutirá pedidos de mercancía, aprobará un volante para próximos eventos y seleccionará proveedores para un libro infantil y un sitio web. También se programaron actualizaciones sobre los puntos de discusión para el alcance comunitario y el cronograma de relaciones con los medios.

anniversarycommunicationeventsmerchandisevendor-selectionoutreachmedia
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Communications Subcommittee Agenda June 2, 2026 6:00 PM Meeting will be held on Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend via Zoom. ZOOM DETAILS: ID # 963 4707 8248 & Link: https://zoom.us/j/96347078248 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Approval of minutes 05-12-16 Minutes 3. Agenda items a. Update on Strawberry Stroll/Farmer’s Market Merchandise order. b. Update from Budget Committee on profitable pricing for Merchandise. c. Review and approve Flyer for upcoming events to be printed on June 4th for in-hand date of June 11. d. Website account update. e. Website Landing page update. f. Review vendor submissions for Children’s Book and select vendor. g. Review vendor submission for Websites and select vendor. h. Alan to provide update on Community Outreach talking points. i. Alan to provide update on Media Relations timeline with first press release scheduled for week of June 8. j. Volunteer Sign Ups for Strawberry Stroll 4. Adjourn
Mon Jun 1, 2026

Legal Notices

La Junta de Planificación escuchará la modificación del plan del sitio para convertir el almacén de 555 King St en pavimento

La Junta de Planificación de Franklin llevará a cabo una audiencia pública el 1 de junio de 2026 para una modificación del plan del sitio en 555 King Street. El solicitante, MCP III 555 King Street LLC, propone eliminar aproximadamente 20,000 pies cuadrados de espacio de construcción y convertirlo en pavimento. La propiedad se encuentra en el Distrito de Zonificación Comercial.

planning-boardpublic-hearingsite-plan-modificationzoningbusiness-districtking-streetwarehouse-conversion
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, June 1 , 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Site Plan Modification titled “MP King St. Development Warehouse Building” prepared by RKB Architects, Inc., Braintree, MA, and submitted to the Department of Planning & Community Development on May 11, 2026, by MCP III 555 King Street LLC, Boston, MA. The property is located in the Business Zoning District (Assessors Map 313 Lots 053; 054; 055; 007; and 008 ) at 555 King Street . The applicant is proposing to remove approximately 20,000 square feet of building for conversion to pavement. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Copies of the plan and supporting documentation may be reviewed in the Department of Planning & Community Development during regular office hours as well as on the Frankli [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 1, 2026

Planning Board

Audiencia pública sobre una subdivisión privada en 70 Daniels Street (Grillo Estates)

La Junta de Planificación de Franklin llevará a cabo audiencias públicas sobre dos propuestas de desarrollo: una subdivisión definitiva privada en 70 Daniels Street (Grillo Estates) y una modificación del plan del sitio en 555 King Street. En la sección de asuntos generales, la junta considerará un convenio para 900 Washington Street, un respaldo para Tanglewood Estates II en Symphony Drive y un nombramiento de la CPC. Estos puntos están programados para su discusión en la reunión del 1 de junio.

zoningdevelopmentpublic-hearingscovenantendorsementplanning-board
✓ Decidido: Planning Board accepted covenant for 900 Washington Street

The Board voted 4‑0 to accept the road covenant for the four‑lot subdivision at 900 Washington Street. It also endorsed the Tanglewood Estates II development and re‑appointed Jay Mello to the CPC. The public hearing for 70 Daniels Street was closed and all listed conditions and waivers were approved. The hearing on the 555 King Street site plan modification was continued to June 22, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet June 1, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM REVISED All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/84986806774 or call on your phone at 312-626- 6799, meeting #84986806774. PUBLIC HEARINGS 1. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision Subdivision Plans Correspondence 2. 555 King Street – Site Plan Modification Site Plans Correspondence GENERAL BUSINESS: A. Covenant: 900 Washington Street B. Endorsement: Tanglewood Estates II Symphony Drive C. CPC Appointment This agenda is subject to change. The next meeting of the Planning Board is scheduled for June 22, 2026. Notice: The Franklin Planning Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Planning Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal Building. If you receive a suspicious email or are unsure if a request is legitimate, please contact the Department at 508-520-4907 to verify any outstanding fees r [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board June 1, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, Council Chambers, 2nd Floor, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Mark Mucciarone; Eric Steltzer (via Zoom). Members absent: Christopher Stickney, Clerk; William Lee, associate member. Also present: Amy Love, Town Planner; Michael Maglio, Town Engineer (via Zoom); Steven Lee, BETA Group (via Zoom). Note: Documents presented to the Planning Board are on file. GENERAL BUSINESS A. Covenant: 900 Washington Street Ms. Love said this is a four-lot subdivision on Washington Street. Construction has started, and a public road covenant needs to be in place while they hold the lots until they come back to have them released once some of the partial infrastructure is in. She said Town Attorney Mark Cerel reviewed the covenant, and it is to his satisfaction. Chair Rondeau asked about item #9 on the Statutory Covenant document provided in the online meeting packet regarding the final completion. Ms. Love said it is fine. Mr. Mello asked if they take performance bonds. Ms. Love said we will. She reviewed the process that once they want to have t [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 1, 2026

Recreation Advisory Board

La Junta Asesora de Recreación discutirá campos, parques infantiles, programas y el Fletcher Fund

La Junta Asesora de Recreación se reunirá para una sesión ordinaria con puntos de agenda estándar. La junta considerará la aprobación de las actas del 2 de marzo de 2026 y escuchará comentarios del público. Los temas de discusión incluyen campos y parques infantiles, programas de recreación y el Fletcher Fund. No se enumeran decisiones ni propuestas específicas en la agenda.

recreationfieldsplaygroundsrecreation-programsfletcher-fundfranklin
✓ Decidido: Recreation Advisory Board approved $20K for high school achievement sign

The board voted 3-0 to contribute $20,000 from the Fletcher Fund toward a student achievement signage board at Franklin High School. They also voted 3-0 to request the Department of Public Works handle trash and recycling at fields, with the town covering the expense. The board heard updates on spring sports, summer programs, and the Fletcher Fund balance. No decision was made on field user fees; the Recreation Department will propose keeping the current policy for youth groups while increasing fees for non-residents and for-profit organizations.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
RECREATION ADVISORY BOARD MONDAY JUNE 1, 2026---7 PM RECREATION DEPARTMENT. 235 WACHUSETT STREET AGENDA: 1) CALL TO ORDER 2) ACCEPTANCE OF MINUTES FROM MARCH 2, 2026 3) PUBLIC COMMENTS 4) FIELDS AND PLAYGROUNDS 5) RECREATION PROGRAMS 6) FLETCHER FUND 7) NEW BUSINESS 8) OLD BUSINESS 9) DISCUSSION 10) NEXT MEETING 11) ADJOURN WAYNE SIMARRIAN, CHAIRMAN
Fri May 29, 2026

School Committee

El subcomité escolar analiza actualizaciones del proyecto de legado

El Subcomité de Legado Horace Mann del Comité Escolar de Franklin se reúne virtualmente para recibir actualizaciones del equipo sobre Educación y Narrativa, Difusión Pública y Diseño del Campus. No se enumeran votos ni decisiones; la reunión es informativa y procedimental.

school-committeesubcommitteelegacyupdatesfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee May 29, 2026 12:30:00 PM Virtual Only Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/87090986494?pwd=KK7uObvl98zOhpF857iZn78G1Zyt7g.1 Passcode:658235 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Team Updates ○ Education & Storytelling ○ Public Outreach ○ Campus Design
Thu May 28, 2026

Zoning Board of Appeals

Reunión de la Junta de Apelaciones de Zonificación cancelada para el 28 de mayo

La reunión del 28 de mayo de 2026 de la Franklin Zoning Board of Appeals está cancelada. La próxima reunión programada es el 11 de junio de 2026.

cancellationzoningboard-of-appealsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING May 28, 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR June 11, 2026
Thu May 28, 2026

Franklin's 250th Anniversary Celebration Committee

Comité votará sobre la subvención estatal de FY26 y la enmienda de asignación específica

El Comité de la Celebración del 250.º Aniversario de Franklin se reunirá para discutir y votar sobre varios temas, incluida una subvención estatal de FY26, una enmienda de asignación específica al presupuesto y la selección de un Gran Mariscal. La reunión también cubrirá informes de subcomités y registros de voluntariado.

anniversarycelebrationcommitteebudgetgranthistoricaleventsvolunteering
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda May 28, 2026 | 7:00 PM Meeting will be held at the Franklin Historical Museum 80 W. Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. ZOOM DETAILS: Meeting ID: 974 0008 8938 | Passcode: 352554 https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair a. Burnout b. Overlapping Timelines 2. Approval of minutes a. 4/23/2026 3. FY26 State Grant 4. Volunteering signups (including FIFA) 5. Subcommittee reports a. Budget i. FY26 Earmark Amendment Vote b. Events i. Grand Marshall Vote c. Communication i. Press Release Vote d. Historical Importance 6. Member comments & future agenda items 7. Adjourn
Thu May 28, 2026

Communications Subcommittee

El Subcomité de Comunicaciones discutirá el alcance del departamento y la descripción del puesto de director

El subcomité escuchará resúmenes de los departamentos municipales sobre sus esfuerzos actuales de comunicación. Darán seguimiento a los horarios de atención del Concejo Municipal y discutirán un plan de trabajo 2026-2027 y la descripción del puesto para un Director de Comunicaciones y Compromiso Comunitario. No hay votos ni decisiones vinculantes programadas.

communicationssubcommitteefranklin-townmunicipal-departmentsdirector-of-communicationswork-plantown-council-office-hours
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Communications Subcommittee Agenda & Meeting Packet May 28, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #830 6701 6031 & Link: https://us02web.zoom.us/j/83067016031 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Current municipal department communications efforts a. Municipal departments will provide an overview of current [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 27, 2026

Council on Aging

El Consejo sobre el Envejecimiento elegirá oficiales y revisará políticas finalizadas

El Consejo sobre el Envejecimiento de Franklin llevará a cabo elecciones de oficiales para Presidente, Vicepresidente y Secretario, y revisará las Políticas y Procedimientos del Centro de Mayores finalizados. La agenda también incluye un voto de agradecimiento para Collette Ferguson y el reconocimiento de los vencimientos de mandatos próximos para tres miembros. Los informes de los comités y otros asuntos rutinarios completan la reunión.

council-on-agingelectionspoliciessenior-centerappointmentscommitteesfranklin-ma
✓ Decidido: Council on Aging approves officer elections and April meeting minutes

The Council on Aging approved the April 22, 2026, meeting minutes and elected Lyn O’Brien as Chair, Phyllis Malcolm as Vice Chair, and Faith Flaherty as Secretary. The board received reports on pending grant applications for facility modernization and nutrition services.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Council on Aging Meeting Agenda May 27, 2026 11:00 AM Meeting will be held at the Franklin Senior Center 10 Daniel McCahill Street, Franklin, MA 02038 1. Call to order; 11:00 AM 2. Minutes of last meeting 3. Citizen’s Comments 4. Correspondence 5. Director’s Report 6. Chairman’s Comments 7. FOFE Liaison Report 8. Old Business 9. New Business ● Collette Ferguson Appreciation (tabled from April Mtg) ● Officer Elections: Chair, Vice-Chair, Secretary 10. Committee Reports ● Budget Committee ● Bylaw Committee ○ Review finalized Senior Center Policies & Procedures ○ Updating COA Binder ● Expo Committee ● Housing Committee ● Nominating Committee ○ Term Expirations June 30, 2026: Lyn O’Brien, Elizabeth Sawyer, Kim Mu-Chow ● Program Committee ● Supportive Day Committee 11. Comments 12. Agenda for Next Meeting 13. Adjournment Next Meeting: June 24, 2026 11:00AM
Wed May 27, 2026

Cultural Council

El Consejo decidirá los temas para el evento A-Wreath-of-Franklin

El Franklin Cultural Council aprobará las actas, revisará las finanzas y discutirá actualizaciones sobre varios eventos comunitarios. Una decisión clave es la selección de los temas para el evento A-Wreath-of-Franklin. El consejo también considerará el proceso para seleccionar a un nuevo miembro.

cultural-councileventsthemesfranklincommunitymeeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Cultural Council Meeting Agenda Date: Wednesday, May 27, 2026 Time: 7:00 PM Location:Franklin Municipal Building Third Floor Training Room 1. Welcome/Check In 2. Approval of April 2026 Meeting Minutes 3. Financial Report 4. Cory’s Cultural Happenings Update 5. A-Wreath-of-Franklin Updates • Themes Decision 6. Strawberry Stroll 7. Harvest Festival Ideas 8. Lady Bugs at Sculpture Park Event 9. Farmers’ Market, Franklin Pride and Fourth of July (maybe SAFE Coalition) 10. New Council Member Selection Process Adjourn
Tue May 26, 2026

Franklin's 250th Anniversary Celebration Committee

El subcomité de presupuesto discutirá la subvención estatal del FY26 para el 250 aniversario

El Subcomité de Presupuesto del Comité de Celebración del 250 Aniversario de Franklin se reunirá virtualmente para considerar la subvención estatal del FY26 como punto del orden del día. No se enumeran otros puntos sustantivos; la reunión también incluye anuncios del presidente y el cierre de la sesión.

budgetgrantsanniversarycelebrationfranklinmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Budget Subcommittee Agenda May 26, 2026 8:00 PM Meeting will be held virtually A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Agenda items a. FY26 State grant 3. Adjourn
Tue May 26, 2026

Massachusetts Strategic Health Group

El Grupo de Salud discutirá el déficit y la transición de las reclamaciones de HPHC

La junta del Massachusetts Strategic Health Group revisará los estados financieros hasta abril, incluyendo un informe sobre el estado del déficit. Los miembros podrían votar para instruir a HPHC a cambiar las fechas de corte del recuento de inscritos como parte de la transición para alejarse de PPI en los pagos de reclamaciones. Otras discusiones incluyen la renovación del seguro stop-loss, la continuación de los servicios de Impax y los servicios de Abacus para julio de 2026.

massachusetts-strategic-health-groupboard-meetingfinancedeficitclaimsstop-lossinsurancefranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
MASSACHUSETTS Strategic Health Group Abington Medway SEBRSD DCRSD MURSD Templeton Franklin Northbridge Valley Trust Grafton NRSD Webster Massachusetts Strategic Health Group Board Meeting Tuesday, May 26, 2026, at 1:00 PM Gladys E. Kelly Public Library 2 Lake Street, Webster, MA 01570 Join the meeting now Meeting ID: 228 670 311 254 13 Passcode: dL6ns97d 1. Attendance 2. Accept Minutes of April 28, 2026 3. Financials through April, 2026 4. Deficit Status Report – Kevin Paicos 5. Status report regarding 1-month payment of Employer Working Rates – Ken Lombardi 6. Financial Goals Status Report – Ken Lombard and Kevin Paicos 7. Discussion re. Member CMA Invoices – Ken Lombardi 8. Discussion re. Abacus services for July 1, 2026 and payment of invoices – Steve Lamarche 9. ROI for Impax and decision to contiue services for July 1, 2026 – Eric Avrumson 10. Status of Stop-Loss insurance renewal – Eric Avrumson 11. Discussion re. HPHC claims payments, new Bill Warrant procedure & transition away from PPI – Kevin Paicos (May require a vote to instruct HPHC to issue enrollment headcounts with a monthky cut-off date of the 15th of each month). 12. Report on mtg. with Mass. DOR re. reporting of deficits and IBNR – Kevin Paicos 13. Set next Mtg. Date
Tue May 26, 2026

School Committee

El Comité Escolar revisará la evidencia de la evaluación del superintendente

El Comité Escolar de Franklin escuchará la presentación de evidencia para la evaluación del superintendente, considerará una primera lectura de una política sobre perros de terapia/apoyo emocional y nombrará a un representante para la junta de BICO. La agenda también incluye asuntos rutinarios, informes financieros y la aceptación de un regalo de $1,000 para el enriquecimiento de FHS.

school-committeesuperintendent-evaluationpolicytherapy-dogsbudget
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee May 26, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/84348824423?pwd=Hl4KwbbakhXQbSRVwEbAgPyBt1p9ZC.1 Passcode:402724 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 507 473 4847 US +1 564 217 2000 [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 21, 2026

Conservation

La comisión de conservación considerará trabajos menores en la zona de amortiguamiento en 110 East Central St

La Comisión de Conservación de Franklin se reunirá para discutir y posiblemente decidir sobre una actividad menor en la zona de amortiguamiento en la ubicación de Pine Tree, 110 East Central Street. La agenda incluye únicamente este punto y los documentos asociados, lo que indica una discusión o decisión enfocada en la actividad propuesta. No se enumeran otros puntos sustantivos.

conservationbuffer-zoneminor-activitiesfranklin
✓ Decidido: Conservation Commission approves tree removal in buffer zone at 110 East Central Street

The Commission unanimously approved a minor buffer zone activity for tree removal at 110 East Central Street. Two public hearings were continued to June 4: the Nicholas Drive/Prospect Street culvert repair and a project at 110 Populatic Street. The Commission also discussed a potential violation at 10 Symphony Drive but took no enforcement action pending a site visit.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Revised Conservation Agenda 5-21-2026 REVISED CONSERVATION AGENDA.PDF Minor Buffer Zone Activities PINE TREE LOCATION - 110 EAST CENTRAL ST.PDF 100-110 SITE PLANS - APPROVED - ENDORSED.PDF 1. Documents: 2. Documents:
Thu May 21, 2026

Legal Notices

El Concejo Municipal celebra audiencias públicas sobre el presupuesto propuesto para el año fiscal 2027 de $171.6M

El Concejo Municipal de Franklin celebrará dos audiencias públicas el 20 y 21 de mayo de 2026 para recibir comentarios sobre el presupuesto propuesto para el año fiscal 2027. El presupuesto total propuesto es de $171,574,811, un aumento respecto al total del año fiscal 2026 de $163,737,405. Los cambios clave incluyen una disminución en el financiamiento de educación de $81.4M a $75.5M y un aumento en los beneficios para empleados de $16.5M a $26.8M.

budgetpublic-hearingfiscal-year-2027franklin-town-councilgeneral-fundeducationpublic-safetyemployee-benefits
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARINGS FY27 PROPOSED BUDGET The Franklin Town Council will hold Public Hearings on Wednesday, May 20, 2026 and Thursday, May 21, 2026 at 6:00 p.m. on the proposed Fiscal Year 2027 budget. These annual public hearings are required by Franklin Home Rule Charter and will provide an opportunity for public input. The hearings will be held in the Council Chambers, 2nd floor, Franklin Municipal Building, 355 East Central St., Franklin, and also remotely via the “ZOOM” platform. A detailed budget document is available on the Town’s official website budget page (https://www.franklinma.gov/Archive.aspx?ADID=577). A printed copy of the budget is also available for inspection in the Office of the Town Clerk located in the Franklin Municipal Building. Residents can visit the Town website (Franklinma.gov) calendar on and after May 15, 2026 for updated meeting information. Please call the Town Administration Office at (508) 520-4949 if you require further information or to make arrangements for translation services. A general summary of the budget follows: Category FY2026 Budget FY2027 Administration Recommendations General Government $13,701,371 $14,466,361 Public Safety $17,076,804 $18,267,981 Education $81,362,442 $75,476,988 DPW $5,707,348 $6,085,983 Hu [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 21, 2026

Legal Notices

Audiencia pública sobre la instalación de postes de National Grid/Verizon en Panther Way

El Administrador del Pueblo llevará a cabo una audiencia pública sobre una petición de postes de National Grid y Verizon New England. La propuesta consiste en reemplazar un poste existente e instalar un nuevo poste compartido en Panther Way. Los residentes pueden asistir en persona o a través de Zoom.

pole-petitionpublic-hearingnational-gridverizonutilitiesfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION PUBLIC HEARING May 21, 2026, 1:00pm Pole Petition Plan # 31257166: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. PANTHER WAY National Grid proposes to install 2 JO Poles on Panther Way. Proposal is to replace P0-50 with a 40ft Class 1 Pole and install a new 45ft Class H1 Pole, labeled P0-75, 45ft North of P0-50. In conformity with the requirements of Section 22 of Chapter 166 of the General Laws (Ter. Ed.) you are hereby notified that a Public Hearing will be held in the Town Council Chambers on the second floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Thursday, May 21, 2026 at 1:00 p.m. upon the petition by Massachusetts Electric Company d/b/a National Grid regarding the Pole Petition described above. All citizens are welcome to attend public meetings in person. Additionally, in an effort to maximize citizen engagement opportunities, citizens will also be able to participate remotely via Zoom using the following login information: Zoom ID: 836 4546 8784 Link: https://us02web.zoom.us/j/83645468784 Call-In Phone Number: 1-929-205-6099, enter Meeting ID # 836 4546 8784, then press # For additional information call the Town Administrator’s Office at 508-520-4949. Respectfully Submitted by, Julie McCann
Thu May 21, 2026

Town Council

Audiencia pública sobre el presupuesto municipal del año fiscal 2027 y primera lectura de la enmienda de tarifas

El Concejo Municipal llevará a cabo una audiencia pública sobre el presupuesto operativo propuesto para el año fiscal 2027, incluyendo apéndices detallados. También considerará una primera lectura de la Enmienda al Reglamento 26-952 para modificar el programa de tarifas de servicios en el Capítulo 82. Adicionalmente, se ha programado una votación sobre una licencia de agricultor-bodega para La Cantina Winery para vender vino embotellado en el Franklin Farmers Market.

budgetpublic-hearinglicensingbylaw-amendmentfeesfarmers-market
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet May 21, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #815 4448 0170 & Link: https://us02web.zoom.us/j/81544480170 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting m [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 21, 2026

Benjamin Franklin Classical Charter Public School

La junta de la escuela chárter revisa el desempeño del Director Ejecutivo y un viaje nocturno

Esta es una reunión regular de la junta de fiduciarios para una escuela pública chárter. La junta revisará y votará sobre las actas de las reuniones, escuchará actualizaciones del Director Ejecutivo y del Director de la Escuela, discutirá un viaje escolar nocturno y llevará a cabo la revisión del desempeño del Director Ejecutivo. También están programadas actualizaciones de los comités y un informe de la Benjamin Franklin Educational Foundation.

educationcharter-schoolboard-of-trusteesschoolvirtual-meetingperformance-reviewfield-trip
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOLMay 21st BOARD OF TRUSTEES MEETING Thursday, May 21, 2026 7-10pmVirtual MeetingGoogle Meet joining infoVideo call link: meet.google.com/dpt-ypip-qrd Or dial: ‪(US) US‬)‪+1 413-276-7715PIN: 960522951===================================7:00Call to Order 7:05Open Comment Period7:10Review and vote on meeting minutes from 5/7 meeting 7:15Review and vote on past Executive Session minutes7:20 ED Update7:40HOS Update7:45Overnight Field Trip7:55ED Performance Review8:30July Retreat8:35Committee Updates-DEIB-Facilities-Finance-Governance-HR-Mission9:00 BFEF Update9:05Task List9:05Adjourn to Executive Session 10:00 Executive Session AdjournmentThe scheduled times as listed are approximate.
Thu May 21, 2026

Pole Petition Hearing

Audiencia pública sobre la instalación de postes de National Grid en Panther Way

El Administrador del Pueblo llevará a cabo una audiencia pública sobre una petición de Massachusetts Electric Company (National Grid) y Verizon para instalar postes de servicios públicos en Panther Way. National Grid propone reemplazar un poste existente e instalar un poste nuevo. La audiencia es requerida bajo la ley de Massachusetts.

polesutilitiespublic-hearinginfrastructurefranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE TO ABUTTERS POLE PETITION PUBLIC HEARING Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. Pole Petition Plan # 31257166 Panther Way. National Grid proposes to install 2 JO Poles on Panther Way. National Grid is proposing to replace P0-50 with a 40ft Class 1 Pole and install a new 45ft Class H1 Pole, labeled P0-75, 45ft North of P0-50. Location approximately as shown on the plan attached. In conformity with the requirements of Section 22 of Chapter 166 of the General Laws (Ter. Ed.) you are hereby notified that a Public Hearing will be held in the Town Council Chambers on the third floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Thursday, May 21, 2026 at 1:00 p.m. upon the petition by Massachusetts Electric Company d/b/a National Grid regarding the attached Pole Petition. All citizens are welcome to attend public meetings in person. Additionally, citizens will also be able to participate remotely via Zoom. The Zoom meeting information can be found below: Zoom ID: 836 4546 8784 Link: https://us02web.zoom.us/j/83645468784 Call-In Phone Number: 1-929-205-6099, enter Meeting ID # 836 4546 8784 , then press # Additional information can be found on our town website, Franklinma.gov or by calling the Town Administrator’s Office at 508-520-4949. TOWN ADMINISTRATOR’S OFFICE cc: Massachusetts Electric Co.
Wed May 20, 2026

Town Council

El Concejo municipal celebra audiencia pública sobre el presupuesto operativo del año fiscal 2027

El Concejo Municipal de Franklin se reúne para una sesión ordinaria que incluye dos audiencias públicas: una para adoptar el presupuesto operativo anual del año fiscal 2027, y otra para aprobar modificaciones a la licencia de todas las bebidas alcohólicas para Franklin Shed LLC en 340 East Central Street. La agenda también incluye informes de subcomités y anuncios.

town-councilbudgetalcohol-licensepublic-hearingfinancial
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet May 20, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #837 3088 5535 & Link: https://us02web.zoom.us/j/83730885535 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting m [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 20, 2026

Legal Notices

Audiencia pública sobre modificaciones de la licencia de alcohol de Franklin Shed

El Concejo Municipal de Franklin llevará a cabo una audiencia pública el 20 de mayo de 2026 para considerar múltiples modificaciones a la Licencia de Bebidas Alcohólicas para Restaurantes de la Sección 12 mantenida por Franklin SHED LLC (d/b/a Franklin Shed) en 340 East Central St. Los cambios propuestos incluyen un cambio de gerentes de la LLC, miembros de la LLC y un cambio en la prenda de la licencia. Se aceptarán comentarios del público durante la reunión.

alcohol-licensespublic-hearingrestaurantsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARING FRANKLIN, MA Modification of a Section 12 Restaurant All Alcoholic Beverages License: Change of Officers/Directors/LLC Managers, Change of Ownership Interest & Change of Pledge of License, Stock or Inventory - Franklin SHED LLC d/b/a Franklin Shed, Located at 340 East Central St., Franklin, MA The Franklin Town Council will hold a Public Hearing on an application by Franklin SHED LLC d/b/a Franklin Shed, located at 340 East Central St., Franklin, for multiple modifications of their Section 12 Restaurant All Alcoholic Beverages License to include a Change of LLC Managers, Change of LLC Members & Change of Pledge of License. This public hearing will take place during the Town Council Public Meeting beginning at 6:00 pm on Wednesday, May 20, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 2nd floor Council Chambers, 355 E. Central Street, Franklin, and also via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) town calendar to review the agenda and for up to date meeting information, on and after May 15, 2026. Please call the Town Administrator’s Office at (508) 520-4949 if you require further information or to make arrangements [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 20, 2026

Legal Notices

El Concejo Municipal de Franklin celebra audiencias públicas sobre el presupuesto propuesto para el año fiscal 2027 de $171.6M

El Concejo Municipal de Franklin celebrará audiencias públicas el 20 y 21 de mayo de 2026 para recibir comentarios sobre el presupuesto propuesto para el año fiscal 2027 de $171,574,811, un aumento de aproximadamente $7.8 millones respecto al año actual. Los cambios notables incluyen un aumento significativo en los beneficios para empleados y una disminución en el financiamiento de la educación. Las audiencias son requeridas por la Home Rule Charter.

budgetpublic-hearingsfinanceproposed-budgeteducationpublic-safetyemployee-benefits
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NOTICE OF PUBLIC HEARINGS FY27 PROPOSED BUDGET The Franklin Town Council will hold Public Hearings on Wednesday, May 20, 2026 and Thursday, May 21, 2026 at 6:00 p.m. on the proposed Fiscal Year 2027 budget. These annual public hearings are required by Franklin Home Rule Charter and will provide an opportunity for public input. The hearings will be held in the Council Chambers, 2nd floor, Franklin Municipal Building, 355 East Central St., Franklin, and also remotely via the “ZOOM” platform. A detailed budget document is available on the Town’s official website budget page (https://www.franklinma.gov/Archive.aspx?ADID=577). A printed copy of the budget is also available for inspection in the Office of the Town Clerk located in the Franklin Municipal Building. Residents can visit the Town website (Franklinma.gov) calendar on and after May 15, 2026 for updated meeting information. Please call the Town Administration Office at (508) 520-4949 if you require further information or to make arrangements for translation services. A general summary of the budget follows: Category FY2026 Budget FY2027 Administration Recommendations General Government $13,701,371 $14,466,361 Public Safety $17,076,804 $18,267,981 Education $81,362,442 $75,476,988 DPW $5,707,348 $6,085,983 Hu [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026

Franklin's 250th Anniversary Celebration Committee

El Subcomité analiza los eventos del 250 aniversario, incluyendo el Strawberry Stroll, el desfile y el lanzamiento

El Subcomité de Eventos escuchará informes de los miembros, planificará el Strawberry Stroll el 12 de junio de 2026 y coordinará con el organizador del evento del 4 de julio. También analizarán el evento de Apertura (Opening Launch), posibles Marshalls del Desfile y el Calendario de Eventos Distintivos que abarca desde 2026 hasta 2028, incluyendo un desfile, un torneo de golf, un picnic familiar y una gala de clausura.

250th-anniversaryeventsparadestrawberry-strolljuly-4thcommunity-launchfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Events Subcommittee Agenda May 19, 2026 7:30 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97743314781?pwd=z5IAQUQs0JilNVIyloAWw4VpvskoT4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair a. Welcome 2. Approval of minutes a. April 15, 2026 3. Agenda items a. Discussion of events/reports from Sub Committee members b. Strawberry Stroll June 12, 2026 4 to 8 pm; booth with merchandise; need sign ups c. 4th Of July; Debbie Pellegri to contact event coordinator Carmingnani and obtain days/ hours of the event d. Discussion of Opening Launch ? Dean College Guidrey Center or Main Stage with Patio Date/Timeline ? Thursday evening for Business organizations ? Sept/Oct/Nov luncheon launch for 25-35 donors March 2027 Community Launch; presentation aligned with 249th Anniversary e. Discussion of Parade Marshalls f. Develop Signature Event Calendar: Anniversary Bell Ringing Interfaith Gath [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026

School Committee

El Comité Escolar negociará con conductores de furgonetas, cafetería, ESP/LPN y secretarios

El Comité Escolar de Franklin llevará a cabo reuniones el 5 y 19 de mayo de 2026 para entrar en sesión ejecutiva para la negociación colectiva con las unidades de Van Drivers, Cafeteria, ESP/LPN y Secretaries. La sesión ejecutiva discutirá la estrategia y llevará a cabo sesiones de negociación bajo la ley estatal.

school-committeecollective-bargainingexecutive-sessioncontract-negotiationsvan-driverscafeteriaesp-lpnsecretaries
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Contractual Negotiations May 5 & 19, 2026 4:30-7:30 PM Municipal Building 3rd Floor Training Room A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1. Call to Order 2. Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. b. Pursuant to M.G.L. c. 30A, §21(a)(2) to conduct collective bargaining sessions with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units.
Tue May 19, 2026

Design Review Commission

La Comisión de Revisión de Diseño revisará tres proyectos comerciales

La Comisión de Revisión de Diseño llevará a cabo una reunión virtual el 19 de mayo de 2026 para discutir y potencialmente decidir sobre las solicitudes de revisión de diseño de tres negocios: Franklin Lighting Center en 317 Union Street, CVS Pharmacy en 272 East Central Street y C4 Garage Doors en 247 East Central Street. La comisión también considerará la aprobación de las actas de la reunión del 21 de abril de 2026.

design-reviewcommercialzoningfranklinmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams , Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.5 20.4907 www.franklinma.gov Agenda May 19 2026 Virtual Meeting 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: May 19, 2026 07:00 PM Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/85043715386 Phone one-tap: +16469313860,,85043715386# 1. New Business a. Franklin Lighting Center- 317 Union Street b. CVS Pharmacy- 272 East Central Street c. C4 Garage Doors- 247 East Central Street 2. Meeting Minutes a. April 21, 2026 3. New Business/Old Business
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4907 Fax: (508) 520-4906 1 Town of Franklin Design Review Commission Tuesday, May 19, 2026 Meeting Minutes Chair Sam Williams called the above-captioned meeting to order this date at 7:03 PM, as a remote access virtual Zoom meeting. This meeting was recorded. The following is stated on the agenda: Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided on the agenda. Members in attendance: Chair Sam Williams, Derek Darvish, Kyle Galvin. Members absent: Vice Chair Andrew Pratt, Associate Priya Natarajan, Associate James Bartro. Also present: Morena Zelaya, Director of Planning & Community Development. NEW BUSINESS: a. Franklin Lighting Center - 317 Union Street Mr. Cam Afonso of Signs by Cam said the Franklin Lighting Center is moving into the building. They are going to use the existing frame; they are putting in new aluminum panels. It has no exterior lighting. Motion: To Approve the sign package as submitted. Motioned by D. Darvish. Seconded by K. Galvin. Roll Call Vote: Darvish-YES; Galvin-YES; Williams-YES. Voted 3-0 (3-Yes; 0-No). b. CVS Pharmacy - 272 East Central Street Mr. Gary McCoy of Poyant Signs reviewed that CVS has been updating their logo to include a heroic heart with the brand. When doing that, the sign size stays the same or is slightly smaller w [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 18, 2026

School Committee

Reunión del Subcomité de Relaciones Comunitarias del Comité Escolar

El subcomité se reunirá virtualmente para discutir asuntos de relaciones comunitarias. Los temas de discusión incluyen el uso del sitio web, la planificación de eventos y el próximo boletín informativo.

educationcommunity-relationsevents
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Community Relations Sub Committee May 18, 2026 6:30 PM Virtual Only Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/82961785555?pwd=T883vxRcrazUExc9tEtOMR7VDwWvWT.1 Passcode:964632 Join via audio: +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 253 205 0468 US +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters is those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Website Usage Review ● Strawberry Stroll Planning ● June Newsletter
Mon May 18, 2026

Community Preservation Committee

El CPC de Franklin llevará a cabo una audiencia pública y propondrá un presupuesto de $2M para el año fiscal 2027

El Comité de Preservación Comunitaria de Franklin llevará a cabo su audiencia pública anual para recibir sugerencias de proyectos de la CPA. Posteriormente, el comité considerará el presupuesto propuesto para el año fiscal 2027, que asciende a un total de $2,006,700, con asignaciones obligatorias del 10% para preservación histórica, vivienda comunitaria, y espacios abiertos y recreación. El comité también revisará la lista de proyectos propuestos para el año fiscal 2027 y fijará una fecha para una reunión en octubre de 2026.

community-preservationbudgetpublic-hearinghistoric-preservationopen-spacecommunity-housing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Community Preservation Committee Meeting Agenda & Meeting Packet May 18, 2026 6:00 PM Meeting will be held at the Municipal Building 2nd Floor, Council Chambers 355 East Central Street A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. Meetings are also archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29 for those who miss the live meeting. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. This will not permit participation in the meeting. To participate in the meeting remotely citizens are able to join a Zoom Webinar using the information provided below. ➢ Zoom Webinar ID # 851 0725 6582 ➢ Zoom Webinar Link HERE (https://us02web.zoom.us/j/85107256582) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All sp [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 18, 2026

Library Board of Directors

La Junta de la Biblioteca discutirá el plan estratégico y la propuesta de subvención para la restauración de murales

La Junta de la Biblioteca discutirá un borrador del plan estratégico centrado en metas, acciones y resultados. También escucharán un informe del director sobre una propuesta de subvención para la restauración de murales y los planes para una lectura comunitaria de 'American Rambler' de Isaac Fitzgerald. El comentario público está abierto para asuntos de la biblioteca que no estén en la agenda.

librarystrategic-planninggrantsmural-restorationcommunity-readpublic-comment
Mon May 18, 2026

Legal Notices

El CPC de Franklin celebra audiencia pública anual sobre las necesidades de preservación comunitaria

El Comité de Preservación Comunitaria llevará a cabo una audiencia pública el 18 de mayo de 2026, a las 6:00 PM. La audiencia es requerida por estatuto y recopilará la opinión pública sobre las necesidades, posibilidades y recursos de preservación comunitaria del pueblo, así como el uso de los fondos de la Ley de Preservación Comunitaria (CPA). La reunión se llevará a cabo en persona y a través de Zoom.

community-preservationcpapublic-hearingfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
LEGAL NOTICE OF PUBLIC HEARING FRANKLIN, MA Community Preservation Committee (CPC) The Franklin Community Preservation Committee will hold a public hearing on Monday, May 18, 2026 at 6:00 PM. This annual public hearing is required by statute, will provide an opportunity for public input, and will involve a discussion of Franklin’s needs, possibilities and resources regarding community preservation and the use of Community Preservation Act (CPA) funds to address these issues, as permitted by the CPA. This hearing will be held in person in the Municipal Building, 2nd floor Council Chambers, 355 E. Central St., Franklin and will also be available via the “ZOOM” platform. Residents can visit the Town website (Franklinma.gov) calendar on and after May 14, 2026 for updated information. Please call the Finance Department at (508) 553-5502 if you require further information or to make arrangements for translation services. Respectfully Submitted by, Kerri Bertone
Thu May 14, 2026

Legal Notices

La ZBA escuchará el permiso especial para la adición de 680 Pleasant Street

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública sobre una solicitud de permiso especial para una adición adjunta de 8'x8' en 680 Pleasant Street. La adición propuesta aumenta la naturaleza no conforme del edificio, y el permiso de construcción fue denegado sin un permiso especial. La junta decidirá si otorga el permiso especial.

zoningspecial-permitpublic-hearingadditionnon-conformingfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on May 14 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:40 pm Applicant: Jessi Fanuele & Paula Carney Address of Subject Property : 680 Pleasant Street (Map 245 , Lot 106 ) Zoning District: RRI Petition Type: Special Permit Zoning B y-Law Sections: 185 -18A.(2), 185-2, 185-45(D)(2)(A) Reason for Denial : Applicant is seeking to construct a 8 ’ x 8 ’ attached addition. The proposed addition increases the non-conforming nature of the building. The building permit is denied without a Special Permit from the ZBA. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu May 14, 2026

Municipal Affordable Housing Trust

Trust discutirá modelos de Somerville y Medford y ley estatal

El Franklin Municipal Affordable Housing Trust discutirá modelos de los trusts de vivienda asequible de Somerville y Medford y la Ley Estatal MGL Chapter 40Y, recibirá una actualización financiera y aprobará las actas de la reunión anterior. No se listan votos sobre proyectos o gastos específicos.

affordable-housingtrustfinancediscussion
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.520.4907 www.franklinma.gov Agenda May 14, 2026 Virtual 2pm To all residents- In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. When: May 14, 2026 02:00 PM Topic: Franklin Municipal Affordable Housing Trust Fund Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/84621670837 Phone one-tap: +19292056099,,84621670837# 1. Discussion a. Somerville & Medford Affordable Housing Trusts b. MGL Chapter 40Y 2. Trust Finance Update 3. Meeting Minutes a. April 9, 2026 4. New Business/Old Business
Thu May 14, 2026

Bi-County Collaborative

La Junta de Bi-County votará sobre subvenciones y la transición del Director Ejecutivo

La Junta Directiva de Bi-County Collaborative votará sobre varias subvenciones, incluyendo FC 0213, PRISM III y Literacy Launch, así como una donación de libreros. La junta también recibirá una actualización sobre la transición del director ejecutivo, las tendencias de inscripción y los nombramientos de empleados. La aprobación rutinaria de la nómina y las órdenes de pago también están en la agenda.

grantsexecutive-directorenrollmentboard-meetingbudgeteducation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
wy ¢ f @,\ Jeanne Sullivan M. Ed., Executive Director Bi-County Collaborative Making It Possible 111 Robbins Road, Walpole, MA 02081 Tel: 508.520.1998 « Fax: 508.520-1445 www. bicounty.org BOARD OF DIRECTORS MEETING May 14, 2026 9:00-10:30 | Agenda | | | | 1. Approval of Minutes - Mrs. Jeanne Sullivan, Executive Director a. Board of Directors Meeting, April 9, 2026 (Vote Required) 2. Votes required From April 9, 2026 Meeting - Mrs. Jeanne Sullivan, Executive Director a. Acceptance of Bookcase Donation (Vote Required) b. Grants: i, FC 0213 Support Implementing Time Out Practices (Vote Required) PRISM III Continuation Grant (Vote Required) Literacy Launch - Winter/ Spring 2026 Round 2 Early Literacy High-Dosage Tutoring (Vote Required) 3. Executive Director Update - Mrs. Jeanne Sullivan, Executive Director a. Employee Appointments/ Resignations/ LOA (Vote Required) b. Enrollment - Mrs, Julie O’Connor, Director of Student Services Mrs. Laurie Cunningham, Director of Clinical Services i. Current Enrollment / Referrals | ii. Referral / Acceptance Data & Trends - Next Steps | —¢.-- Collaborative Program Accomplishments = Year in Review = BICO Program Directors d.___Executive Director Transition 4. Business Office Updates - Ms. Holly Buttrick, Director of Finance & Operations ii. iii. a. Financial Overview - = pa i. FY26 Budget m = as 5. Board Member Recognitions © =~ so | 6. Other m N = - a. 2026-2027 Board Appointment = > in | 7. Routine Matters oO mr a | id = a. App [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 14, 2026

Zoning Board of Appeals

La ZBA escuchará tres apelaciones: cerca de piscina, pérgola solar, ampliación

La Junta de Apelaciones de Zonificación de Franklin escuchará tres solicitudes: una varianza para eliminar una cerca requerida alrededor de una piscina en 137 Mastro Drive, una apelación por la denegación de un permiso de construcción para una pérgola de paneles solares en 54 Conlyn Avenue, y un permiso especial para una ampliación de 8x8 pies que aumenta la no conformidad en 680 Pleasant Street. La junta también llevará a cabo asuntos administrativos, incluyendo anuncios de la presidencia y la aprobación de actas.

zoningvariancesspecial-permitsappealsswimming-poolssolar-panelsadditions
✓ Decidido: Zoning Board hears variance and appeal requests

The Zoning Board of Appeals met to hear a variance request for a pool fence and an appeal regarding a solar pergola permit. The board also received a special permit application for a property addition.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board of Appeals Agenda May 14, 2026, 7:30 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers and Zoom Platform A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID # 933 5785 8559 & Link: https://zoom.us/j/93357858559 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR 1. Chair to identify members participating remotely. 2. APPROVAL OF MINUTES none 3. TOPIC 1. 7:30pm: 137 Mastro Drive; Benjamin and Mona Kilbanoff: Applicant is seeking a Variance to eliminate a fence that is required to completely surround a swimming pool.  137 Mastro Drive [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 14, 2026

Legal Notices

Audiencia de apelación sobre el permiso denegado para una pérgola solar en 54 Conlyn Ave

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública el 14 de mayo de 2026, para escuchar una apelación de John P. Cambareri con respecto a la denegación de un permiso de construcción para una pérgola para albergar paneles solares en 54 Conlyn Ave. La apelación cita secciones específicas de los estatutos de zonificación y el MGL Capítulo 40A.

zoningappealsolarbuilding-permitpublic-hearing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on May 14 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 5 pm Applicant: John P. Cambareri 62 Conlyn Ave Address of Subject Property : 54 Conlyn Ave (Map 252 , Lot 060 ) Zoning District: SFR IV Petition Type: Appeal Zoning B y-Law Sections: 185 Attachment 19 & 19 (E), The entire content of 185-19, 185 45(D) MGL c40A Subsection 7 and 8 Reason for Denial : Applicant is seeking to appeal the Franklin Zoning Code pertaining to the issuance of a building permit for the construction of a pergola to house solar panels. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu May 14, 2026

Legal Notices

La ZBA escuchará solicitud de varianza para eliminar cerca de piscina

La Junta de Apelaciones de Zonificación de Franklin llevará a cabo una audiencia pública el 14 de mayo de 2026, para considerar una varianza solicitada por Benjamin y Mona Kilbanoff. La varianza busca eliminar una cerca requerida para rodear completamente una piscina en 137 Mastro Drive. La junta decidirá sobre la solicitud después de escuchar los comentarios públicos.

zoning-board-of-appealsvariancepublic-hearingpool-safetyzoningfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on May 14 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 0 pm Applicant: Benjamin and Mona Kilbanoff Address of Subject Property : 137 Mastro Drive (Map 220 , Lot 055 ) Zoning District: RRI Petition Type: Variance Zoning B y-Law Sections: 185 -33 A.B.C. Reason for Denial : Applicant is seeking a Variance to eliminate a fence that is required to completely surround a swimming pool. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu May 14, 2026

Economic Development Subcommittee

UMASS Boston propone estudio de planificación para Franklin

El Subcomité de Desarrollo Económico escuchará una presentación del profesor de UMASS Boston, Jack Wiggins, sobre un propuesto Franklin Planning Studio, seguida de una discusión general sobre los siguientes pasos, prioridades y el plan de trabajo 2026-27. No hay votos ni decisiones vinculantes programadas.

economic-developmentplanninguniversity-partnershipfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Economic Development Subcommittee Agenda & Meeting Packet May 14, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street -3rd Floor, Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #895 5088 8796 & Link: https://us02web.zoom.us/j/89550888796 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Call to Order 2. UMASS Boston Presentation & Scope of Work - Professor Jack Wiggins a. Proposed Franklin Plan [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 13, 2026

Charles River Pollution Control District (CRPCD)

El CRPCD discutirá la apelación del permiso NPDES y las conexiones de alcantarillado de abril

El Charles River Pollution Control District se reunirá para aprobar órdenes de pago (montos redactados), recibir actualizaciones sobre la apelación del permiso NPDES 2025 y escuchar los informes del ingeniero y del director ejecutivo. La agenda también incluye informes sobre conexiones de alcantarillado (Franklin y Millis), muestreo de cobre y una actualización sobre el elevador. Los temas previstos para la reunión de junio incluyen una votación sobre el ajuste por costo de vida y actualizaciones del manual del empleado.

watersewerpollutionpermitsnpdesinfrastructureboard-meeting
✓ Decidido: Approved $496,774 in warrants for O&M and capital projects

The District unanimously approved Warrant #26-11 totaling $496,774.30 for operations and capital. The executive director reported a total phosphorus violation for April (0.11 mg/L vs. 0.10 mg/L permit limit), with staff implementing process changes. Previous month's minutes were also approved unanimously.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING MAY 13, 2026 at 3:30 P.M. CONFERENCE ROOM AGENDA 1. Approval of Warrant 26-11 a) O & M $ XXX,XXX b) Capital $ XXX,XXX 2. Update on 2025 NPDES Permit Appeal 3. Engineer’s Report a) Conducted SIU Inspections b) Landfill Groundwater Monitoring Sampling was Conducted c) Submitted Garelick Farms Report 4. Executive Director’s Report a) Sewer Connections (April 2026) Franklin 1 home 330 gpd Millis 4 homes / 1 multi-unit 2,200 gpd b) NPDES Permit Compliance Report (April 2026) c) Update on Copper Sampling in Mine Brook Interceptor (MBI) d) Update on Elevator 5. Public Comment 6. Approval of Minutes from the April 9, 2026 Monthly Meeting 7. Anticipated Topics for the Wednesday, June 10, 2026 Monthly Board Meeting at 3:00 pm a) Discussion and Vote on Cost of Living Adjustment b) Updates to Employee Handbook
Wed May 13, 2026

Cultural District Committee

El Comité del Distrito Cultural discutirá el 250 aniversario y proyectos de subcomités

El Comité del Distrito Cultural revisará las actas de la reunión, recibirá actualizaciones de los subcomités sobre PorchFest, Fence Gallery, Artsy Boxes, Storefront frames, Cultural Weekends y Wind Phone, y escuchará una actualización sobre el 250 aniversario de Roberta Trahan. Cory Shea presentará sobre artes, cultura y economía creativa. No se enumeran votos específicos ni decisiones financieras; la reunión consiste principalmente en actualizaciones y discusiones.

cultural-districtcommunity-eventsartsanniversariesfranklin-ma
✓ Decidido: Cultural District Committee hears Porch Fest, fence gallery updates; no votes taken

The Franklin Cultural District Committee met on May 13, 2026, and approved the previous meeting's minutes. No votes or substantive decisions were made; the meeting consisted entirely of reports and updates on upcoming cultural events, including Porch Fest, a fence gallery, and a wind phone installation.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee MeetingWednesday, May 13, 2026, 7:00 pmFranklin Senior Center, 10 Daniel McCahill St., Franklin AGENDAA.Review and Approval of the Meeting Minutes oApril 9, 2026, Cultural District Meeting B.Sub-Committee Updates oPorchFest (John)oFence Gallery (John)oArtsy Boxes (John)oStorefront frames (Pete)oCultural Weekends (Pandora)oWind Phone (John)C.Arts, Culture and the Creative Economy Updates – Cory Shea, DirectorD.Franklin, MA 250th Anniversary update - Roberta Trahan, FCDC representative Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/FeedbackAdjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: May 5, 2026Posted: Sent to Town Clerk on May 6, 2026, for posting
Wed May 13, 2026

Historical Commission

La Comisión discutirá la residencia de artistas, la exhibición de Old South y la placa de la Segunda Guerra Mundial

La Franklin Historical Commission revisará propuestas, incluyendo un programa de artista en residencia, discutirá cómo exhibir la Old South Meeting House y considerará una carta que solicita que una placa conmemorativa de la Segunda Guerra Mundial sea reinstalada en la escuela secundaria. La agenda también incluye actualizaciones sobre próximos eventos comunitarios, trabajo de archivo y planificación de exhibiciones.

historical-commissionexhibitsmemorialscommunity-eventsarchivalpreservationfranklin-massachusetts
✓ Decidido: Historical Commission approves minutes, discusses museum acquisitions

The Historical Commission unanimously approved the minutes from April 8 and May 7. The Commission discussed acquiring items from the Federated Church archive and a draft timeline of Franklin's history. The group generally agreed that a proposed $3,000 IC4K project cost may be too prohibitive and will discuss it further.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin MassachusettsHistorical CommissionAgenda, Weds., May 13, 2026, 6:00 pm Meeting at the Museum, 80 W. Central StAPPROVAL OF MINUTES – Apr 8, 2026, May 7, 2026CITIZENS COMMENTS: PRESENTATIONS: FFHM REPORT (10 minute limit): SUBCOMMITTEE REPORTS: TREASURER/ARCHIVIST FINANCIAL REPORT: COMMUNITY PRESERVATION COMMITTEE: FRANKLIN 250 UPDATEFRANKLIN 250 Historical Sub CommitteeFPS HORACE MANN COMMITTEE (and Horace Mann BirthdayWeekend)ARCHIVIST UPDATEREGULAR BUSINESS:Assession and DeassessionsExhibit Planning -- Veterans exhibits and Police/FireOLD AND NEW BUSINESS:Cory Shea 'Artist in Residency' proposalHow or if to exhibit about Old South Meeting House this summerWedding exhibitOrphanage and/or poor farm in Aug-Sept.?Update on Tri-County Bell StandUpdating veteran KIA displays -- what and howUpdate on FIFA History event June 14 (SSS)Review and discuss Dean Intern ProgramLetter to SC requesting re-mounting of WW2 Memorial Plaque at the High School where it belongs.Wrentham Declaration of Independence 6-5-26 5-7 pm Wrentham CommonHistoric Huddle in Plainville 6-6 1 pm, Plainville Town Hall, 190 South St , contact Kristine [email protected]Hosting for later in the day of Porchfest (Jan and Alan have commitments latler in the day.)Discuss continuing updates to exhibits…status of timeline, etcIc4K Proposal, Status of KiASKStrawberry Stroll musuem and booth hostingReview Johnston Appraisal event...Report on Meeting with Sr. Center including [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 13, 2026

Town Council

El Concejo votará sobre enmiendas a los estatutos de zonificación y actualización de OPEB

El Concejo Municipal llevará a cabo segundas lecturas y votaciones sobre cuatro enmiendas a los estatutos de zonificación que afectan las regulaciones de uso, el área del lote y los requisitos de patio, las cuales requieren una mayoría de dos tercios. También están programadas segundas lecturas de enmiendas a los estatutos de los mapas del sistema de alcantarillado y agua, una resolución para modificar el calendario de reuniones de 2026 y la aceptación de un regalo de $500 para los Servicios para Veteranos. El concejo escuchará una presentación sobre la actualización actuarial de OPEB y ratificará tres nombramientos para la Comisión sobre Discapacidad.

zoningbylaw-amendmentsopebappointmentsveteranssewerwater
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet May 13, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #826 8792 9129 & Link: https://us02web.zoom.us/j/82687929129 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting m [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 13, 2026

Charles River Pollution Control District (CRPCD)

CRPCD votará sobre excedente de $119,861 y elegirá funcionarios

Esta es la reunión anual del Charles River Pollution Control District. La junta elegirá funcionarios (Presidente, Vicepresidente, Secretario) y designará al Director Ejecutivo, Secretario Ejecutivo y Tesorero. Discutirán las finanzas del distrito, incluyendo saldos de estabilización que superan los $4.5 millones, y votarán sobre si asignar $119,861 en fondos excedentes del año fiscal 2025.

meetingelectionsappointmentsbudgetfinancesewerinfrastructure
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 ANNUAL MEETING MAY 13, 2026 (following the Monthly Meeting) CONFERENCE ROOM AGENDA 1. Election of Officers a) Chairman b) Vice Chairman c) Clerk 2. Appointments a) Executive Director b) Executive Secretary c) Treasurer 3. Discussion of District Finances a) Stabilization Balances as of March 31, 2026 i) General Stabilization Balance: $3,460,444 ii) Infiltration and Inflow Stabilization Balance: $680,393 iii) OPEB Trust Fund Balance: $432,800 b) Discussion and Vote on Surplus Monies from FY 2025 in the Amount of $119,861
Wed May 13, 2026

Legal Notices

Votación final sobre las enmiendas a los estatutos de alcantarillado y agua para la subdivisión de Union Street

El Concejo Municipal de Franklin llevará a cabo una segunda lectura y votación final sobre dos enmiendas a los estatutos para extender las redes de alcantarillado y tuberías de agua para servir a una subdivisión propuesta de cinco lotes en la parcela 304-016-000 en Union Street. La enmienda de alcantarillado (26-950) añadiría una red principal de alcantarillado de PVC de 500 pies; la enmienda de agua (26-951) añadiría una red principal de agua de hierro dúctil de 550 pies. La reunión comienza a las 6:00 PM el 13 de mayo de 2026, con una oportunidad para la participación pública.

sewerwatersubdivisionpublic-hearingbylaw-amendmentstown-councilfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
LEGAL NOTICE FRANKLIN, MA Second Reading and Final Vote of Bylaw Amendments 26-950 & 26-951 The Franklin Town Council will hold a second reading and final vote on the adoption of two Town Code Bylaw Amendments summarized as follows: 26-950: A Bylaw to Amend the Code of the Town of Franklin at Chapter 139, §139-14, Sewer System Map - Amends Chapter 139, §139-14, Sewer System Map, Exhibit A (Map) by adding as an eligible location the following: §139-14. Sewer System Map Exhibit A: Extending sewer system to provide Town sewer service to a five lot subdivision proposed for future construction on parcel 304-016-000 on Union Street. The proposed extension will extend the existing sewer main by approximately five hundred (500) feet of a new eight (8) inch PVC sewer main and associated new sewer manholes. 26-951: A Bylaw to Amend the Code of the Town of Franklin at Chapter 179, §179-9.1, Water System Map - Amends Chapter 179, §179-9.1, Water System Map, Exhibit A (Map) by adding as an eligible location the following: § 179-9.1 Water System Map. Exhibit A: Extending water main to provide Town water service to a five lot subdivision proposed for future construction on parcel 304-016-000 on Union Street. The proposed extension will require installation of approximately five hundred fifty (550) [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 13, 2026

Legal Notices

Votación final sobre la extensión de alcantarillado y agua para la subdivisión de Union Street

El Concejo Municipal de Franklin llevará a cabo segundas lecturas y votaciones finales sobre dos enmiendas a los estatutos para extender el servicio de alcantarillado y agua a una subdivisión propuesta de cinco lotes en la parcela 304-016-000 en Union Street. Las enmiendas actualizan el Mapa del Sistema de Alcantarillado (26-950) y el Mapa del Sistema de Agua (26-951) para agregar la ubicación como elegible para el servicio. Se aceptarán comentarios del público durante la reunión.

sewerwaterinfrastructuresubdivisionbylaw-amendmentpublic-hearing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
LEGAL NOTICE FRANKLIN, MA Second Reading and Final Vote of Bylaw Amendments 26-950 & 26-951 The Franklin Town Council will hold a second reading and final vote on the adoption of two Town Code Bylaw Amendments summarized as follows: 26-950: A Bylaw to Amend the Code of the Town of Franklin at Chapter 139, §139-14, Sewer System Map - Amends Chapter 139, §139-14, Sewer System Map, Exhibit A (Map) by adding as an eligible location the following: §139-14. Sewer System Map Exhibit A: Extending sewer system to provide Town sewer service to a five lot subdivision proposed for future construction on parcel 304-016-000 on Union Street. The proposed extension will extend the existing sewer main by approximately five hundred (500) feet of a new eight (8) inch PVC sewer main and associated new sewer manholes. 26-951: A Bylaw to Amend the Code of the Town of Franklin at Chapter 179, §179-9.1, Water System Map - Amends Chapter 179, §179-9.1, Water System Map, Exhibit A (Map) by adding as an eligible location the following: § 179-9.1 Water System Map. Exhibit A: Extending water main to provide Town water service to a five lot subdivision proposed for future construction on parcel 304-016-000 on Union Street. The proposed extension will require installation of approximately five hundred fifty (550) [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 12, 2026

Communications Subcommittee

El Subcomité votará sobre el proveedor de mercancía para el Strawberry Stroll

El Subcomité de Comunicaciones del Comité de Celebración del 250 Aniversario revisará los precios y el tiempo de entrega de los proveedores preseleccionados para la mercancía relacionada con el evento Strawberry Stroll, y luego votará para seleccionar un proveedor final. La reunión está abierta al público a través de Zoom.

250th-anniversarycommitteevendor-selectionstrawberry-strollmerchandisefranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Communications Subcommittee Agenda May 12, 2026 6:00 PM Meeting will be held on Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend via Zoom. ZOOM DETAILS: ID # 916 4199 4223 & Link: https://zoom.us/j/91641994223 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Approval of minutes 3. Agenda items a. Review short listed vendor submissions pricing and turnaround time for Merchandise/Strawberry Stroll b. Vote to select final vendor for production. 4. Adjourn
Tue May 12, 2026

Norfolk County Regional Emergency Planning Committee (NC-REPC)

El Comité recibirá una actualización sobre la solicitud de subvención MEMA 2026 y nombrará funcionarios

El Comité de Planificación de Emergencias Regionales del Condado de Norfolk considerará nombrar al Administrador Municipal de Medway, Michael E. Boynton, como Coordinador Gubernamental y al Jefe de Bomberos de Easton, Justin Alexander, como Vicepresidente. El comité también recibirá una actualización sobre el estado de la solicitud de subvención MEMA 2026 y discutirá un nuevo procedimiento de solicitud de subvenciones. Está programada una presentación de John G. Wood III del Departamento de Servicios de Incendios de Massachusetts.

emergencyplanninggrantsfire-servicesregional-committeemassachusettsappointments
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
NORFOLK COUNTY REGIONAL EMERGENCY PLANNING COMMITTEE (NC REPC) MEETING NOTICE AVON, BELLINGHAM, CANTON, DEDHAM, DOVER, EASTON (Bristol County), FRANKLIN, MEDFIELD, - MEDWAY, MILLIS, NEEDHAM, NORFOLK, NORWOOD, SHARON, WALPOLE, WESTWOOD. MEETING DATE: MAY 12, 2026 Tuesday MEETING TIME:____-1030am_to Noon. MEETING LOCATION: TOWN OF WALPOLE POLICE DEPT. HEADQUARTERS, 50 South Street, Walpole. AGENDA: Norfolk County Regional Emergency Planning Committee: 1.) APPOINTMENT: MEDWAY TOWN MANAGER MICHAEL E. BOYNTON ~ Government Coordinator 2.) APPOINTMENT: EASTON FIRE CHIEF JUSTIN ALEXANDER - Deputy Chairman. 3.) MEMA 2026 Grant Application Status | 4.) New Grant Application Procedure. 5.) Presentation : JOHN G WOOD lil. MASSACHUSETTS DEPARTMENT OF FIRE SERVICES. 6.) New Business not reasonably anticipated by the Chair. ATTN: TOWN CLERKS OFFICES. Please post and forward a stamped copy to J.S. Trust, NC REPC Secretary at [email protected]. Thank you. PLEASE INCLUDE YOUR TOWN NAME AND TOWN STAMP.
Tue May 12, 2026

Franklin's 250th Anniversary Celebration Committee

El comité votará sobre el proveedor de mercancía para el 250 aniversario

El Subcomité de Comunicaciones del Comité de Celebración del 250 aniversario de Franklin revisará las propuestas de los proveedores para la mercancía y el Strawberry Stroll, y luego votará para seleccionar un proveedor de producción final. Otros asuntos incluyen anuncios y la aprobación de las actas de la reunión anterior.

anniversarycommitteevendor-selectionmerchandisestrawberry-strollfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Communications Subcommittee Agenda May 12, 2026 6:00 PM Meeting will be held on Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend via Zoom. ZOOM DETAILS: ID # 916 4199 4223 & Link: https://zoom.us/j/91641994223 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Approval of minutes 3. Agenda items a. Review short listed vendor submissions pricing and turnaround time for Merchandise/Strawberry Stroll b. Vote to select final vendor for production. 4. Adjourn
Tue May 12, 2026

School Committee

Propuesta del Plan Estratégico Conjunto del Comité Escolar y el Concejo Municipal

El Comité Escolar escuchará y discutirá una propuesta de plan estratégico conjunto con el Concejo Municipal. También votarán sobre la adopción de políticas sobre señalización de campeonatos estatales, uso comunitario de las instalaciones escolares y tarifas de alquiler de instalaciones. La agenda de consentimiento incluye la aceptación de donaciones que superan los $14,000 para diversas escuelas y programas.

school-committeestrategic-planpoliciesgiftscommunity-usescholarshipsmusic-department
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee May 12, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/86518786414?pwd=UmNtUyzlGDaXujaIuN78L2vCbEDOll.1 Passcode:723532 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 564 217 2000 US +1 669 444 9171 [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 12, 2026

School Committee

El Subcomité del Comité Escolar discutirá múltiples actualizaciones de políticas

El Subcomité de Políticas del Comité Escolar de Franklin se reunirá el 12 de mayo de 2026 para discutir una serie de temas de política. Los temas incluyen la señalización de reconocimiento de logros estudiantiles, las políticas de alquiler de instalaciones y una política sobre perros de apoyo emocional. El comité también revisará nuevos temas de discusión como el uso intencional de la tecnología, informes administrativos, el informe anual del distrito, normas y procedimientos, excursiones escolares y políticas actualizadas de MASC. No se anotan decisiones formales en la agenda.

educationschool-committeepolicystudent-achievementfacility-rentaltechnologyfield-trips
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN SCHOOL COMMITTEE Policy Subcommittee Meeting DATE: 5/12/26 TIME: 6:00 PM Members of the public are now welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Meeting feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak will be able to raise their hand to be recognized by the Chair. The meeting host will invite the attendee to unmute for comment. Location: Municipal Building 3rd floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/87547196009?pwd=cZQaqLxDEkhYjDfcz3OfwpGGam1Yyl.1 Passcode:900915 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 346 248 7799 US (Houston) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law.” I. Attendance - II. Review of Minutes III. Approved Policies A. none IV. Discussion of Policies sent to School Committ [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 12, 2026

Town Council

El Concejo Municipal y el Comité Escolar seleccionarán licitadores para el plan estratégico

Esta reunión conjunta del Concejo Municipal de Franklin y el Comité Escolar escuchará presentaciones de tres firmas (Raftelis, Capital Strategic Solutions y BME Strategies) que responden a una Solicitud de Declaraciones de Interés para desarrollar un plan estratégico. El organismo podrá seleccionar licitadores para emitir una Solicitud de Cotizaciones Escritas, con un contrato previsto para principios de junio de 2026. El plan estratégico tiene como objetivo guiar las prioridades del municipio y la escuela ante un déficit presupuestario estructural y la disminución de la matrícula.

strategic-plantown-councilschool-committeejoint-meetingpresentationsbudgetcommunity-priorities
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet May 12, 2026 7:00 PM This is a joint meeting of the Franklin Town Council and Franklin School Committee. Meeting will take place at the Franklin Municipal Building: 355 East Central Street - 2nd Floor, Council Chambers Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/86518786414?pwd=UmNtUyzlGDaXujaIuN78L2vCbEDOll.1 Passcode:723532 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US 1. PRESENTATIONS / DISCUSSION a. Discussion and potential selection of bidders from the Request for Statements of Interest issued by the Franklin Town Council and School Committee for a strategic plan. i. Request for Statement of Interest for Development of a Strategic Plan ii. Presentations (via Zoom) 7:00 - 7:30: Raftelis 7:35 - 8:05: Capital Strategic Solutions 8:10 - 8:40: BME Strategies 2. ADJOURN Note: Two-Thirds Vote: requires 6 votes Majority Vote: requires majority of members present and voting Franklin Town Council and Franklin School Committee Request for Statements of Interest for Development of a Strategic Plan Due: Friday, April 17, 2026 at 12:00 PM DEADLINE EXTENSION: Wednesday, April 22, 2026 at 5:00 PM The Franklin Town Council and the Franklin School Committee are requesting [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 12, 2026

Charles River Pollution Control District (CRPCD)

Reunión anual de CRPCD para votar sobre excedente de $119,861 y elegir funcionarios

La reunión mensual incluye la aprobación de la Orden 26-11, una actualización sobre la apelación del permiso NPDES 2025, informes de conexión de alcantarillado y el informe del ingeniero. La reunión anual cubrirá la elección de funcionarios, nombramientos y una votación sobre $119,861 en fondos excedentes del año fiscal 2025.

pollution-controlwastewaternpdessewerbudgetelectionsfranklinmedway
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin - 1973 : Medway MONTHLY MEETING MAY 13, 2026 at 3:30 P.M. CONFERENCE ROOM AGENDA 3 2 > = 1. Approval of Warrant 26-11 8) all a a) O&M S XXX,XXX gi = zo b) Capital S XXX,XXX QO , Say m © a —_ ma 2. Update on 2025 NPDES Permit Appeal <a Vv ZF m™m™ 19 S 3. Engineer’s Report o z a) Conducted SIU Inspections b) Landfill Groundwater Monitoring Sampling was Conducted c) Submitted Garelick Farms Report 4. Executive Director’s Report a) Sewer Connections (April 2026) Franklin 1 home 330 gpd Millis 4 homes / 1 multi-unit 2,200 gpd b) NPDES Permit Compliance Report (April 2026) c) Update on Copper Sampling in Mine Brook Interceptor (MBI) d) Update on Elevator 5. Public Comment 6. Approval of Minutes from the April 9, 2026 Monthly Meeting 7. Anticipated Topics for the Wednesday, June 10, 2026 Monthly Board Meeting at 3:00 pm a) Discussion and Vote on Cost of Living Adjustment b) Updates to Employee Handbook 66 Village Street - Medway - Massachusetts - 02053 Charles River Pollution Control District Franklin : 1973 - Medway ANNUAL MEETING MAY 13, 2026 (following the Monthly Meeting) CONFERENCE ROOM AGENDA 1. Election of Officers a) Chairman | b) Vice Chairman Fes ail c) Clerk Oo = im ' << vr" ow] 2. Appointments a) Executive Director b) Executive Secretary c) Treasurer © > 2 £ 3. Discussion of District Finances a) Stabilization Balances as of March 31, 2026 i) General Stabilization Balance: $3,460,444 ii) Infiltration [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026

Housing Authority

La Junta revisará la morosidad de Norfolk HA y el crédito de medición neta

La Junta de Comisionados de la Autoridad de Vivienda de Franklin llevará a cabo una reunión ordinaria para discutir asuntos rutinarios, incluyendo actas, cuentas por pagar de abril de 2026 y estados operativos. Los puntos notables incluyen una actualización sobre la morosidad y la inspección/auditoría de PMR de la Norfolk Housing Authority, así como una propuesta para el crédito de medición neta de National Grid. La junta también considerará la certificación de los estados financieros y el TAR, y revisará una consulta de seguridad de la Worcester Housing Authority.

housingfinanceauditutilitiessafety
✓ Decidido: Housing Authority approves $161,582 in April bills

The Franklin Housing Authority Board unanimously approved Accounts Payable totaling $161,582.26 for April 2026, accepted the Director of Facilities and Executive Director reports, and certified its Top 5 Report for 2026. The board also voted to enter executive session to discuss litigation strategy.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing Authority 1000 Central Park Terrace Community Hall Franklin, MA 02038 Regular Meeting of the Board of Commissioners May 11, 2026 4:30 PM UPDATED AGENDA ❑ Chairman requests all cell phones to be silenced ❑ Roll Call ❑ Matt Keras, Insurance • Insurance Policies ❑ Minutes • Minutes of the Regular Meeting of April 21, 2026 ❑ Accounts Payable • Accounts Payable for April 2026 • Capital One Charges for April 2026 ❑ Director of Facilities Report ❑ Director Report ❑ Operating Statements – FYE March 2026 – Certify to Financial Statements and TAR ❑ Community Preservation Committee (CPC) Update – Commissioner Feeley ❑ Correspondence – Thank you Note ❑ Norfolk HA Update – Managing Agency • PMR Inspection/Audit • Norfolk delinquency ❑ Old Business • Commissioner’s Training Report • Safety Consultation Services – provided by Worcester Housing Authority ❑ New Business • National Grid – Net Metering Credit • Certification of Top 5 Report ❑ Executive Session ❑ Adjournment
Mon May 11, 2026

Legal Notices

La Junta de Planificación escuchará la modificación de la subdivisión de Cranberry Meadows para 28 unidades asequibles

La Junta de Planificación de Franklin llevará a cabo una audiencia pública sobre una Modificación de Subdivisión Definitiva para el desarrollo de Cranberry Meadows. La modificación añadiría 35 pies de pavimento para conectar Sunken Meadow Road con el límite municipal de Bellingham, proporcionando acceso a un proyecto de viviendas asequibles unifamiliares de 28 unidades aprobado bajo el Capítulo 40B. La audiencia surge de una remisión del Tribunal de Tierras para enmendar el certificado de votación del 25 de agosto de 2025.

planning-boardpublic-hearingsubdivisionaffordable-housingchapter-40bzoning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By-Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, May 11, 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Definitive Subdivision Modification titled “Cranberry Meadows Definitive Subdivision Modification Plan Franklin Massachusetts ” prepared by Guerriere & Halnon, Inc., Franklin, MA and remanded by the Land Court to amend the approved Certificate of Vote issued on August 25, 2025. The property is located in the Rural Residential I Zoning District (Assessors Map 223 Lots 37, 38 and 39) at the end of Sunken Meadow Road. The applicant is proposing to add approximately 35 feet of pavement to connect the road to the Bellingham Town Line, in order to provide access to a twenty eight unit single family affordable residential development previously approved by the Bellingham ZBA pursutant to GL Chapter 40B. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026

Planning Board

Audiencias públicas sobre cuatro propuestas de subdivisión definitiva

El Franklin Planning Board celebrará audiencias públicas sobre modificaciones de subdivisión definitiva para Sunken Meadows Rd (Cranberry Meadows), 70 Daniels Street (Grillo Estates), 47 Partridge Street (Donovan Estates) y 900 Washington Street (Olam Estates). El consejo también considerará asuntos generales, incluyendo el ítem 81-P ANR: Panther Way, una recomendación para Panther Way Senior Village, y aprobará las actas de las reuniones del 6 y 27 de abril de 2026. La reunión está programada para el 11 de mayo de 2026 a las 7:00 PM en el Municipal Building, Council Chambers.

zoningsubdivisionsplanningpublic-hearingsdevelopment
✓ Decidido: Board approves Panther Way ANR, senior village endorsement, and meeting minutes

The Planning Board approved the 81-P amendment and re‑zoning (ANR) for Panther Way and endorsed the Panther Way Senior Village site plan, each with a 4‑yes, 0‑no, 1‑absent vote. The Board also approved the April 6 and April 27, 2026 meeting minutes and waived the reading on the Sunken Meadows Road subdivision modification, all by the same vote tally.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet May 11, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/84552444313 or call on your phone at 312- 626-6799, meeting #84552444313. PUBLIC HEARINGS 1. Sunken Meadows Rd (Cranberry Meadows) - Definitive Subdivision Modification Subdivision Plans Correspondence 2. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision Subdivision Plans Correspondence 3. 47 Partridge Street (Donovan Estates) – Definitive Subdivision Subdivision Plans Correspondence 4. 900 Washington St (Olam Estates) – Definitive Subdivision Modification TO BE CONTINUED GENERAL BUSINESS: A. 81-P ANR: Panther Way B. Endorsement: Panther Way Senior Village C. Meeting Minutes: April 6 & 27, 2026 This agenda is subject to change. The next meeting of the Planning Board is scheduled for June 1, 2026. Notice: The Franklin Planning Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Planning Department will never request payment by wire transfer. All applicant fees must [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board May 11, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, Council Chambers, 2nd Floor, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk; Mark Mucciarone; William Lee, associate member. Members absent: Eric Steltzer. Also present: Amy Love, Town Planner; Michael Maglio, Town Engineer; Mark Cerel, Town Attorney; Matthew Crowley, BETA Group (via Zoom). Note: Documents presented to the Planning Board are on file. GENERAL BUSINESS A. 81-P ANR: Panther Way Ms. Love reviewed the applicant submitted a Form A application for 81-P plan review to accompany the plan titled “Plan of Land” dated April 30, 2026, and submitted to DPCD on May 5, 2026. There are three existing lots on the plan. The purpose of the plan is to combine two lots and split off Lot 1 to become its own lot. Motion to Approve the 81-P ANR for Panther Way. Rondeau. Second: Mello. Vote: 4-0-1 (4-Yes; 0-No; 1- Absent). Chair Rondeau noted Mr. Steltzer will not be attending tonight. B. Endorsement: Panther Way Senior Village Ms. Love reviewed the Planning Board approved a Site Plan for Panther Way on September 22, 202 [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 7, 2026

Franklin Commission on Disability

✓ Decidido: Commission on Disability approves April meeting minutes

The Commission approved the minutes from the April 2nd, 2026 meeting. Members discussed event planning for the Strawberry Stroll and noted that two new members will be ratified at the May town council meeting.

Thu May 7, 2026

Legal Notices

Audiencia pública sobre la propuesta de unidad de vivienda accesoria en la zona de amortiguamiento de humedales en 110 Populatic Street

La Comisión de Conservación de Franklin llevará a cabo una audiencia pública híbrida el 7 de mayo de 2026, para considerar un Aviso de Intención presentado por Norse Environmental Services para Michael & Mary Diehl. El proyecto propone remover una terraza existente, una escalera y un árbol, y construir una unidad de vivienda accesoria con terraza, patio, muro de contención y nivelación asociada en 110 Populatic Street (Mapa 216, Lote 27). Aproximadamente 1,325 pies cuadrados de trabajo se encuentran dentro de la zona de amortiguamiento de 100 pies de Humedales Vegetados Colindantes, incluyendo áreas en las zonas de amortiguamiento de no perturbación y restringidas.

conservation-commissionwetlandsaccessory-dwelling-unitpublic-hearingbuffer-zonezoningfranklin-massachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, May 7, 2026 at 7:04 PM on a Notice of Intent filed by Maureen Herald of Norse Environmental Services, Inc., Dracut, MA on behalf of Michael & Mary Diehl, Franklin, MA. The applicant is proposing to remove an existing deck and staircase along with a tree, and construct an accessory dwelling unit along with a deck, patio, retaining wall, and associated grading, landscaping and utilities. Approximately 1,325 Square Feet (SF) of proposed work is within the 100-foot Buffer Zone to Bordering Vegetated Wetlands (BVW), of which approximately 195 SF is within the 0- to 25-foot “No Disturbance” Zone, 583 SF is within the 25- to 50-foot Buffer Zone to BVW and 547 SF is within the 50- to 100-foot Buffer Zone to BVW. The Project is located at the end of 110 Populatic Street, Map 216, Lot 27 within the Rural Residential I Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to acces [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 7, 2026

Benjamin Franklin Classical Charter Public School

La junta revisa la encuesta anual y las actualizaciones del plan estratégico

La junta votará sobre las actas de la reunión anterior y escuchará actualizaciones del Director Ejecutivo y del Director de la Escuela. Las discusiones incluyen la encuesta anual de la comunidad, el progreso del plan estratégico y los datos de desempeño ejecutivo. También se cubrirán los informes de los comités y la revisión de una lista de tareas.

educationcharter-schoolboard-meetingstrategic-plancommunity-survey
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOL May 7th BOARD OF TRUSTEES MEETING Thursday, May 7, 2026; 7-10pmIn Person-BFCCPSGoogle Meet joining info Video call link: meet.google.com/dpt-ypip-qrdOr dial: ‪(US) 1 414-909-5071 PIN: 327 335 126#===================================7:00Call to Order 7:05Open Comment Period7:10Review and vote on meeting minutes from 4/9 meeting 7:15 ED Update7:35Prospective Council Presentations8:05HOS Updates8:20Faculty Rep Updates8:30Annual Community Survey Review8:50Strategic Plan Updates9:10ED Performance Review-Ancillary Data9:25ED BOT Review9:30 Committee Updates-DEIB-Facilities-Finance-Governance-HR-Mission9:50Task List10:00AdjournThe scheduled times as listed are approximate.
Thu May 7, 2026

Franklin's 250th Anniversary Celebration Committee

La Comisión discutirá el uso del fondo de estacionamiento para personas con discapacidad y el cumplimiento de la accesibilidad

Esta reunión de la Comisión de Discapacidad de Franklin incluye actualizaciones sobre las cartas de incumplimiento y el Grupo de Trabajo de Accesibilidad, un plan para el evento Strawberry Stroll y una discusión sobre cómo utilizar los fondos de estacionamiento para personas con discapacidad. La comisión también considerará temas futuros para la agenda sobre documentos accesibles y opciones de reuniones virtuales.

disabilityaccessibilitypublic-meetingfranklinmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Commission on Disability Agenda and Meeting Packet Date : May 7, 2026 Time : 4:00pm Meeting will be held at : Senior Center, 10 Daniel McCahill St, Franklin, MA, Computer Room A note to residents: All citizens are welcome to attend public meetings in person. Please note: we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance The Town of Franklin does not discriminate on the basis of disability and is committed to providing accessible programs, meetings, and events. To request reasonable modification to participate in this program, please contact Gus Brown, ADA Coordinator, at [email protected] or 508-553-4855. Requests for ASL interpreter or CART services made after April 30, 2026 will be considered but may not be possible to fill. 1. Announcements from the Chair a. AAB Non-Compliance Letters b. Accessibility Working Group Updates 2. Citizen Comments a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Commission cannot engage in a dialogue or comment on a matter raised during Citizen Comments. 3. Member Comments 4. Approval of Minutes : 4/2/26 5. [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 7, 2026

Conservation

La Comisión de Conservación revisará el proyecto de alcantarillado en Prospect Street/Nicholas Drive

La Comisión de Conservación de Franklin discutirá y potencialmente actuará sobre múltiples Avisos de Intención para trabajos de propiedad en cuatro ubicaciones: Prospect Street/Nicholas Drive (alcantarillado), 47 Partridge Street (Donovan Estates), 110 Populatic Street (ampliación) y 603 Old West Central Street. Cada artículo incluye documentos de respaldo como dibujos de permisos y planos.

conservationnotices-of-intentfranklin-maculvertpartridge-streetpopulatic-streetold-west-central-streetpermitting
✓ Decidido: Conservation Commission continues culvert repair hearing to May 21

The Conservation Commission voted 7-0 to continue the public hearing for the Nicholas Drive/Prospect Street culvert repair NOI to May 21, 2026, to allow further review by BETA. The hearing addressed retroactive approval for emergency repairs and proposed corrective actions. A second hearing for 47 Partridge Street was discussed but the minutes are truncated, so no final decision is recorded.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Revised Conservation Agenda 5-7-2026 REVISED CONSERVATION AGENDA.PDF Prospect Street/Nicholas Drive ATT2_EXISTING CONDITIONS SURVEY PLAN.PDF ATT3_PERMIT DRAWINGS_STAMPED.PDF 20260430_PROSPECTSTCULVERT_RESPONSETOCOMMLETTER 1.PDF 47 Partridge Street DONOVAN_ESTATES_CONSERVATION-COVER_LETTER.PDF DONOVAN_ESTATES_REVISION-4-EMAIL.PDF 110 Populatic Street PLAN SHOWING PROPOSED ADDITION.PDF NOTICE OF INTENT LETTER.PDF 110 POPULATIC STREET - PERMIT DRAWINGS 2026 0209.PDF 110 POPULATIC STREET - PERMIT DRAWINGS - UPDATE FOR CONSERVATION A32 SITE SECTION.PDF CERTIFIED PLOT PLAN.PDF NOI 110 POPULATIC STREET.PDF 603 Old West Central Street BP_FRANKLIN_MA_CP-6_04-23-26.PDF 1. Documents: 2. Documents: 3. Documents: 4. Documents: 5. Documents:
Thu May 7, 2026

Historical Commission

La Comisión discutirá el cambio de paisajismo de Old Colony Habitat para la Old South Meeting house

La Franklin Historical Commission discutirá y potencialmente aprobará una solicitud de cambio de paisajismo de Old Colony Habitat for Humanity para el proyecto de la Old South Meeting house. Esta es una reunión especial realizada a través de Zoom, sin otros asuntos enumerados.

historical-commissionhabitat-for-humanitylandscapingold-south-meeting-housefranklin
✓ Decidido: Approved landscaping change for Old South Meeting house project

The Franklin Historical Commission approved a landscaping change request from Old Colony Habitat for Humanity for the 'Old South' Meeting house project. The motion passed unanimously by roll call vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
joel d joecd Town of Franklin Massachusetts Special Meeting of Historical Commission Agenda, »May 7, 2026, 6:00 pm Meeting via Zoom Join Zoom Meeting https://us0Sweb.zoom.us/j/88636457740? pwd=ADqnimp3WRDqIXsAhIDyzEEyv¥2VMy,.1 Meeting ID: 886 3645 7740 Passcode: N9Kp55 Join instructions https://us0Sweb.zoom.us/meetings/88636457740/invitations?signature=3RWh7D7qUAItWX5Q0Co2T WKSjL9Ghdc50dnmQGX27E Call to Order: REGULAR BUSINESS: ® Discuss and approve Old Colony Habitat for Humanity landscaping change request for 'Old South' Meeting house project. ADJOURN
Wed May 6, 2026

Board of Health

Audiencia pública sobre la prohibición de cannabinoides sintéticos, kratom e intoxicantes no regulados

La Junta de Salud llevará a cabo una audiencia pública sobre una propuesta de regulación para prohibir la fabricación, venta y distribución de cannabinoides derivados sintéticamente, kratom derivado sintéticamente y productos intoxicantes novedosos no regulados. La junta también discutirá una pasantía para estudiantes universitarios y las operaciones de refugios de calefacción/refrigeración. Están programados informes sobre la subvención Metacomet Shared Service Grant para el Agente de Salud y la Enfermera de Salud Pública.

board-of-healthpublic-hearingcannabinoidskratompublic-healthsheltersinternshipsgrants
✓ Decidido: Board expands Kratom sales ban to all products, effective May 20

The Board of Health approved the minutes from the April 1, 2026 meeting. It voted to expand the town's sales regulation to cover all kratom products and remove existing exemptions, with the new rule taking effect on May 20, 2026. The meeting was then adjourned.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet May 6, 2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room meet.google.com/vzj-itiu-pef tel:+1-484-800-1951 A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _ ______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. April 1, 2026 PUBLIC HEARING a. Regulation of the Town of Franklin Board of Health Prohibiting the Manufacturing, Sale, and Distribution of Synthetically Derived [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 6, 2026

Legal Notices

La Junta de Salud votará sobre la prohibición de cannabinoides sintéticos, kratom e intoxicantes novedosos

La Junta de Salud de Franklin llevará a cabo una audiencia pública el 6 de mayo de 2026 a las 5:00 pm para considerar nuevas regulaciones que prohibirían la fabricación, venta y distribución de cannabinoides derivados sintéticamente, kratom derivado sintéticamente y productos intoxicantes novedosos no regulados. La reunión incluirá lecturas de las enmiendas propuestas al Capítulo 248: Ventas del código municipal y una votación final sobre la adopción de las regulaciones. La audiencia se llevará a cabo en el Municipal Building, 3rd Floor Training Room, 355 E. Central Street, y también a través de Google Meet, con una oportunidad para la participación del público.

healthpublic-safetyregulationssubstance-controltown-code
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
LEGAL NOTICE FRANKLIN, MA The Franklin Board of Health will hold a public hearing on implementing new Regulations Prohibiting the Manufacturing, Sale, and Distribution of Synthetically Derived Cannabinoids, Synthetically Derived Kratom and unregulated Novel Intoxicating Products. The readings and final votes on adoption of the Regulations will take place during the Board of Health meeting beginning at 5:00 pm on May 6, 2026; there will be an opportunity for public input during the process. Location: Municipal Building, 3rd Floor Training Room, 355 E. Central Street, Franklin, and also via the Googlemeet platform. § 248: Sales Add to the Code of the Town of Franklin Chapter 248: Sales. The Regulations are to add new language to the new Regulations prohibiting the manufacturing, sale, and distribution of synthetically derived cannabinoids, synthetically derived Kratom and unregulated Novel Intoxicating Products. Residents can visit the Town website ( Franklinma.gov ) town calendar to review the agenda including full text of proposed amendments, and for up to date meeting information on and after April 8, 2026. Please call the Health Department at (508) 520-4905 if you require further information. Respectfully submitted by, Cathleen Liberty
Tue May 5, 2026

School Committee

El Comité Escolar celebra una sesión ejecutiva sobre la estrategia de negociación colectiva

El Comité Escolar de Franklin se reunirá en una sesión ejecutiva para discutir la estrategia de negociación colectiva con las unidades de Van Drivers, Cafeteria, ESP/LPN y Secretaries. La sesión también abarca la realización de sesiones de negociación colectiva con dichos grupos de empleados. La reunión se convoca bajo la ley de Massachusetts para mantener la confidencialidad de las discusiones de negociación.

educationlaborcollective-bargainingexecutive-session
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Contractual Negotiations May 5 & 19, 2026 4:30-7:30 PM Municipal Building 3rd Floor Training Room A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1. Call to Order 2. Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. b. Pursuant to M.G.L. c. 30A, §21(a)(2) to conduct collective bargaining sessions with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units.
Tue May 5, 2026

Franklin's 250th Anniversary Celebration Committee

El comité analiza los proveedores de mercancía y los planes de divulgación para el 250 aniversario

El Subcomité de Comunicaciones se reúne para revisar las actualizaciones de marca y aprobar las actas anteriores. El comité votará sobre un proveedor para la mercancía y el Strawberry Stroll, y analizará los procesos para seleccionar un autor de libros infantiles.

anniversarycommunicationsmerchandisecommunity-outreach
✓ Decidido: Committee hears state anniversary organization presentation

The committee approved prior meeting minutes and heard a presentation from Sheila Green of MA 250 regarding resources for the town's 250th anniversary celebration.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Communications Subcommittee Agenda May 5, 2026 6:00 PM Meeting will be held at on Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. ZOOM DETAILS: ID # 963 4707 8248 & Link: https://zoom.us/j/96347078248 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair a. Updates on Logo and Brand Guidelines 2. Approval of minutes a. April, 7, 2026 3. Agenda items a. Review all meeting minutes are up-to-date and go over new process b. Vote to select vendor for Merchandise/Strawberry Stroll and purchase items c. Review language for open call to Website vendors d. Children’s Book Author - Discussion on how to go about choosing and start reaching out to authors and illustrators e. Alan to present Community Outreach Plan f. Alan to present Media Relations Plan 4. Adjourn
Sun May 3, 2026

Franklin's 250th Anniversary Celebration Committee

Subcomité de presupuesto finalizará los niveles de patrocinio para la celebración del 250 aniversario

El Subcomité de Presupuesto del Comité de Celebración del 250 Aniversario se reúne virtualmente el 3 de mayo de 2026. Aprobarán las actas del 12 de abril, discutirán la mercancía para el Strawberry Stroll y crearán un borrador final de los niveles de patrocinio.

anniversarybudgetsponsorshipmerchandisestrawberry-strollfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Budget Subcommittee Agenda May 3, 2026 7:30 PM Meeting will be held virtually A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair a. Town business list b. Procedures for expenses 2. Approval of minutes a. April 12, 2026 3. Agenda items a. Merchandise for Strawberry Stroll b. Create final draft of sponsorship levels 4. Adjourn
Thu Apr 30, 2026

Zoning Board of Appeals

No habrá reunión de la Junta de Zonificación el 30 de abril; la próxima reunión se programó para el 14 de mayo

La Junta de Apelaciones de Zonificación no se reunirá el 30 de abril de 2026. No se programaron puntos en la agenda para esa fecha. La próxima reunión de la Junta está programada para el 14 de mayo de 2026. No hay decisiones ni discusiones planeadas para la reunión cancelada.

zoningboard-of-appealsmeetingschedule
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING April 30 , 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR May 14 , 2026
Wed Apr 29, 2026

Cultural Council

Consejo Cultural de Franklin seleccionará nuevo miembro, actualizará evento de corona

El Consejo Cultural de Franklin discutirá la aprobación de las actas de la reunión de marzo, un informe financiero y una actualización sobre acontecimientos culturales. Los asuntos principales incluyen actualizaciones sobre el evento A-Wreath-of-Franklin (concurso de temas, fecha) y el proceso para seleccionar un nuevo miembro del consejo. Esta es una reunión de procedimiento rutinario sin decisiones presupuestarias o de política más allá de la gobernanza interna.

cultural-councileventsmembershipmeeting-minutesgovernment-procedure
✓ Decidido: Cultural Council discusses World Cup party, grants; only votes on minutes

The Franklin Cultural Council approved the March meeting minutes unanimously. The meeting primarily covered updates on the World Cup watch party (rescheduled to June 24-25 due to public safety, with a $120,000 grant from the Massachusetts Office of Travel and Tourism shared between Franklin and Marlboro), financial reports (including a $18,100 deposit, reimbursement for Empty Bowls Club, and a grace period for Franklin Pride's missed deadline), and upcoming events like Strawberry Stroll and the A-Wreath-of-Franklin theme contest. No other formal votes were taken; most agenda items were informational or discussion-based.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Cultural Council Meeting Agenda Date: Wednesday, April 29, 2026 Time: 7:00PM Location:Franklin Municipal BuildingThird Floor Training Room 1. Welcome/Check In 2. Approval of March Meeting Minutes 3. Financial Report 4. Cory’s Cultural Happenings Update 5. A-Wreath-of-Franklin Updates • Theme Contest • Date • Other 6. New Council Member Selection Process Adjourn
Tue Apr 28, 2026

Massachusetts Strategic Health Group

La junta revisará el estado del déficit y el plan de jubilados de Aetna

La junta del Massachusetts Strategic Health Group se reunirá para aceptar las actas, revisar los estados financieros hasta marzo de 2026 y escuchar un informe sobre el estado del déficit. Las discusiones también incluyen las tasas de trabajo del empleador, las metas financieras y el plan de jubilados de Aetna. La reunión es principalmente procedimental con actualizaciones financieras.

healthstrategyfinanceretireeboard-meetingmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
MASSACHUSETTS Strategic Health Group Abington Medway SEBRSD DCRSD MURSD Templeton Franklin Northbridge Valley Trust Grafton NRSD Webster Massachusetts Strategic Health Group Board Meeting Tuesday, April 28, 2026, at 1:00 PM Gladys E. Kelly Public Library 2 Lake Street, Webster MA 01570 Join the meeting now Meeting ID: 228 670 311 254 13 Passcode: dL6ns97d 1. Attendance 2. Accept Minutes of March 31, 2026 and April 14, 2026 3. Financials through March, 2026 4. Deficit Status Report – Kevin Paicos 5. Status report regarding 1-month payment of Employer Working Rates – Ken Lombardi 6. Financial Goals Status Report – Ken Lombard and Kevin Paicos 7. Introduc�on of new Accountant – Rick Lafond/Steve Lamarche 8. Aetna retiree plan discussions 9. Set next Mee�ng Date
Tue Apr 28, 2026

School Committee

El Comité Escolar llevará a cabo negociaciones a puerta cerrada con cuatro unidades de empleados

Esta es una reunión de negociaciones contractuales del Comité Escolar de Franklin. La agenda consiste únicamente en sesiones ejecutivas para discutir la estrategia y llevar a cabo la negociación colectiva con las unidades de Van Drivers, Cafeteria, ESP/LPN y Secretaries. No se llevará a cabo ningún asunto público.

school-committeecollective-bargainingexecutive-sessionemployee-units
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Contractual Negotiations April 13 & 28, 2026 4:30-7:30 PM Municipal Building 3rd Floor Training Room A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1. Call to Order 2. Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. b. Pursuant to M.G.L. c. 30A, §21(a)(2) to conduct collective bargaining sessions with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units.
Mon Apr 27, 2026

Planning Board

Audiencias públicas sobre tres planes de subdivisión, una continuada

La Junta de Planificación de Franklin llevará a cabo audiencias públicas sobre tres propuestas de subdivisión definitiva: 70 Daniels Street (Grillo Estates, continuada), 47 Partridge Street (Donovan Estates) y Symphony Drive (Tanglewood Estates II). La junta también considerará un respaldo para Adin Estates, una extensión para 124-126 Grove Street y aprobará las actas de reuniones de sesiones anteriores.

planning-boardsubdivisionspublic-hearingszoningfranklin-ma
✓ Decidido: Planning Board approves subdivision for Tanglewood Estates II

The Planning Board approved a definitive subdivision for Tanglewood Estates II and approved an extension for a Grove Street warehouse project. Two other subdivision items were continued to May 11, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet April 27, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/87070415887 or call on your phone at 312-626-6799, meeting #87070415887 . PUBLIC HEARINGS 1. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision TO BE CONTINUED 2. 47 Partridge Street (Donovan Estates) – Definitive Subdivision 3. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision Correspondence Subdivision Plans GENERAL BUSINESS: A. Endorsement: Adin Estates B. Extension : 124-126 Grove St. C. Meeting Minutes: February 9, March 9 & March 23, 2026 This agenda is subject to change. The next meeting of the Planning Board is scheduled for May 11, 2026. Notice: The Franklin Planning Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Planning Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026

Franklin's 250th Anniversary Celebration Committee

El comité escuchará la presentación de MA250 el 27 de abril

El Subcomité de Importancia Histórica se reunirá para aprobar las actas del 3 de marzo de 2023 y escuchar una presentación de Sheila Green de MA250. No hay otras decisiones ni votaciones programadas.

250th-anniversarycelebration-committeehistorical-museumma250public-meeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Historical Importance Subcommittee Agenda April 27 , 2026 7:30 PM Meeting will be held in person at the Franklin Historical Museum 80 West Cenetral Street, and on Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. Join Zoom Meeting https://zoom.us/j/94989481869?pwd=LMBtQWc5jPaareD7SSS38TY6lUXhBd.1 View meeting insights with Zoom AI Companion https://zoom.us/launch/edl?muid=af4f687b-13ec-458b-99e5-8353f9c71eb6 Meeting ID: 949 8948 1869 Passcode: 702060 Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar.  All speakers will be required to state their full name and street address before commenting Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Approval of minute s for Mar 3, 2023 3. Agenda items ◦ Presentation by Sheila Green from MA250 ◦ Questions & Discussion 3. Member comments and updates 4. Adjourn
Mon Apr 27, 2026

School Committee

El subcomité planea la celebración del cumpleaños de Horace Mann y eventos de otoño

Esta es una reunión del subcomité de legado de Horace Mann del Franklin School Committee. Los miembros discutirán los planes para una celebración del cumpleaños de Horace Mann y coordinarán futuros eventos significativos, incluyendo un Strawberry Stroll en junio, un Farmer's Market en agosto y un Harvest Festival en el otoño.

school-committeehorace-manncommunity-eventsplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee April 27, 2026 7:00 PM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/84661707449?pwd=S7CJC9dcqR4FjaMH6itaBNsWbWQvnX.1 Passcode:753802 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 253 205 0468 US +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Call to Order ● Discussion of Horace Mann Birthday Celebration ● Future Milestone Events ○ Strawberry Stroll (June) ○ Farmer’s Market (August) ○ Harvest Festival (Fall)
Mon Apr 27, 2026

Communications Subcommittee

El Subcomité de Comunicaciones celebra su primera reunión y presenta al nuevo director

El Subcomité de Comunicaciones del Franklin Town Council se reúne por primera vez. Los miembros se presentarán y darán la bienvenida a Liz Kalaijian como la nueva Directora de Comunicaciones y Compromiso Comunitario. La agenda incluye una discusión general sobre los objetivos del comité, sin votos ni decisiones concretas programadas.

communicationssubcommitteetown-councilorganizational
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Communications Subcommittee Agenda & Meeting Packet April 27, 2026 12:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID # 889 8251 9099 & Link: https://us02web.zoom.us/j/88982519099 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Introduction of Committee members 2. Introduction of Liz Kalaijian, Director of Communications & Community Engagement 3. General discussion [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026

Agricultural Commission

La Comisión Agrícola revisará acciones pasadas y establecerá metas futuras

La Comisión Agrícola de Franklin se reunirá en línea para aprobar las actas de marzo y recibir actualizaciones de estado sobre el evento del Día de la Tierra, el mapa narrativo y el folleto, y las entrevistas a agricultores. La comisión también revisará sus logros pasados y discutirá metas futuras. Esta es una reunión de negocios rutinaria sin votaciones sobre ordenanzas o financiamiento.

agriculturecommissionfranklin-mameetingroutine
✓ Decidido: Commission approved three summer market activities

The committee unanimously accepted the March 30 minutes. It agreed to reach out to local farmers, MDAR, and other agricultural commissions for future projects. It also approved three events for the summer farmers market: Seed Sowing on June 5, Zucchini Races on July 24, and a Pumpkin Celebration on October 2.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 4/27/2026 7:00pm A NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded. ZOOM MEETING DETAILS: Topic: Ag Com Time: Apr 27, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/88031764728?pwd=IH4prI1XbKgxpkmEDZWGZr06daTpIb.1 Meeting ID: 880 3176 4728 Passcode: 334739 One tap mobile +13017158592,,88031764728#,,,,*334739# US (Washington DC) +13052241968,,88031764728#,,,,*334739# US Join instructions https://us02web.zoom.us/meetings/88031764728/invitations?signature=5IiKc9Lq1Vdz3lj0eEpS BI69m1Mup0iExeFxQ85UQj0 l. Approval of the minutes - from March 30, 2026 meeting. ll. Old Business: A. 4-18-26 Earth Day Event- Report B. Ag Commission Story Map & Brochure Status- Update C. Franklin Farmer Interviews- Updates. III. New Business: A. Review the Agricultural Commission’s past actions and accomplishments and discuss future goals and actions. Respectfully Submitted, Marian Szymanski
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Agricultural Committee Meeting April Minutes - April 27, 2026 In Attendance: Marian Szymanski, CJ Koshivas, Benjamin Rousseau, and Jen Anderson Sweeney Call to Order: The Meeting was called to order at 7:03 PM by Marian Szymanski Acceptance of the Minutes: The Minutes from our March 30, 2026 Meeting were unanimously accepted. Old Business: A. Earth Day April 18th 2026 Report: The Agricultural Commission partnered with Fairmount Farm and the Conservation Commission to create an Earth Day event. The Con Com gifted residents with native trees and shrubs, offered an information table and held tours of local conservation land. Over 15 farms and local makers took part in an Earth Day Farmer’s Market. Local children and their families created bee hotels, bird feeders, and planted an assortment of flowers and vegetables. B. Ag Commission Story Map & Brochure Status Update: The Town’s GIS department created a wonderful brochure, and a fantastic digital story map featuring all of the farms in Franklin. Members of the Ag Commission will review these products and will send their comments to Marian S. When all of the comments have been addressed, the town will display the brochure and the map on the town’ s website and Facebook page. C. Franklin Farmer Interviews: The Commission continues to conduct interviews with the farmers in Franklin. New Business: A. Next steps: The Agricultural Commission reviewed our past actions and accomplishments and our future goals. Reco [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026

Library Board of Directors

La Junta de la Biblioteca discutirá la planificación estratégica y los resultados de la encuesta

La Junta Directiva de la Biblioteca Pública de Franklin llevará a cabo una reunión ordinaria el 27 de abril de 2026. El tema principal de discusión es la planificación estratégica, que incluye la revisión de los resultados de la encuesta de satisfacción de los usuarios y los borradores de las declaraciones de visión y valores. El orden del día también incluye comentarios públicos, aprobación de actas, informes de los miembros de la junta y el informe del director de la biblioteca.

librarystrategic-planningpublic-comment
✓ Decidido: Library Board approves vision statement and entrance signage

The Board approved the March 30th meeting minutes and agreed that a vision statement is sufficient for the library's needs. Members selected a specific poster design to improve the greeting at the side entrance. No other formal votes were recorded.

Thu Apr 23, 2026

Franklin's 250th Anniversary Celebration Committee

El Comité aprobará el logotipo, los gastos de mercancía y los documentos operativos

El Comité de Celebración del 250 Aniversario de Franklin votará sobre un logotipo, gastos de mercancía, un documento de normas y valores, y una política de tiempo. Los subcomités también informarán sobre actualizaciones presupuestarias, eventos de recaudación de fondos y un avance del plan de comunicación.

250th-anniversarycelebrationlogomerchandisebudgeteventsmunicipal-committee
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda April 23, 2026 | 7:00 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. ZOOM DETAILS: Meeting ID: 974 0008 8938 | Passcode: 352554 https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair (7) a. Social b. Action c. Using shared drive 2. Approval of minutes (3) a. 3/26/2026 3. Approval of logo (10) 4. Approval of merchandise expenditures (5) 5. Approval of norms & values document (12) 6. Approval of time policy (8) 7. Subcommittee reports a. Budget (10) i. Tiered giving ii. Overall budget document iii. Business list b. Events (10) i. Fundraising events ii. Overall calendar c. Communication (10) i. Communication plan preview d. Historical Importance (5) 8. Member comments & future agenda items (10) 9. Adjourn
Thu Apr 23, 2026

Gatra Regional Public Meeting

GATRA busca comentarios del público sobre los servicios de tránsito y planes futuros

La Greater Attleboro Taunton Regional Transit Authority (GATRA) llevará a cabo una reunión pública regional para recopilar comentarios de los pasajeros y miembros de la comunidad sobre sus servicios y las necesidades comunitarias. La reunión incluirá actualizaciones sobre comentarios pasados y planes futuros, así como comentarios públicos abiertos. No hay decisiones ni votaciones programadas.

transitpublic-meetingfeedbackcommunity-engagementregional-transit
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
SERVICE FEEDBACK FORUM THURSDAY, APRIL 23, 2026 2:30PM - 3:30PM 8 0 0 - 4 8 3 - 2 5 0 0 W W W . G A T R A . O R G REGIONAL P A R T I C I P A T E V I A A L I V E S T R E A M A T T H E F O L L O W I N G L O C A T I O N S : A T T L E B O R O C O U N C I L O N A G I N G 2 5 S M A I N S T A T T L E B O R O , M A C E N T E R F O R A C T I V E L I V I N G 4 4 N O O K R O A D P L Y M O U T H , M A G A T R A B U S T E R M I N A L F I R S T F L O O R C O N F E R E N C E R O O M 1 0 O A K S T , T A U N T O N , M A C A N ' T A T T E N D T H E M E E T I N G ? F E E D B A C K A B O U T G A T R A S E R V I C E S C A N B E G I V E N I N T H E F O L L O W I N G W A Y S : C A L L 8 0 0 - 4 8 3 - 2 5 0 0 E M A I L I N F O @ G A T R A . O R G M E S S A G E U S O N F A C E B O O K O R I N S T A G R A M @ G A T R A T R A N S I T A G E N D A I T E M S W I L L I N C L U D E : UPDATE ON FEEDBACK FROM PAST MEETINGS UPDATE ON ANY FUTURE PLANS OTHER TOPICS AS NEEDED COMMENTS ACCEPTED FROM THE PUBLIC ABOUT GATRA’S SERVICES F R A N K L I N S E N I O R C E N T E R 1 0 D A N I E L M C C A H I L L S T F R A N K L I N , M A M A R S H F I E L D C O U N C I L O N A G I N G 2 3 0 W E B S T E R S T M A R S H F I E L D , M A WAREHAM COUNCIL ON AGING 48 MARION RD WAREHAM, MA R E M O V E A F T E R 4 / 2 3 / 2 6 MEETING TO GET FEEDBACK FROM RIDERS AND COMMUNITY MEMBERS ON GATRA SERVICES AND COMMUNITY NEEDS I f y o u n e e d a t r a n s l a t i o n o f a n y t h i n g y o u s e e h e r e o r y o u n e e d i n f o r [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 23, 2026

Conservation

La Comisión de Conservación revisará la varianza de Symphony Drive/Tanglewood Estates II y 47 Partridge Street

La Comisión de Conservación de Franklin se reunirá para discutir varios puntos, incluyendo la correspondencia sobre un Aviso de Intención para Symphony Drive/Tanglewood Estates II, una solicitud de varianza para 47 Partridge Street, y actividades menores en la zona de amortiguamiento en 10 Elizabeth Avenue y el derecho de vía de MECO Prospect Street. La agenda no indica ninguna decisión; todos los puntos están enumerados para discusión o posible acción.

conservationwetlandsbuffer-zonevariancenotices-of-intentfranklin-macommission-meeting
✓ Decidido: Conservation Commission approves Tanglewood Estates II with conditions (6-0)

The commission approved a Notice of Intent for the Symphony Drive/Tanglewood Estates II project with special conditions, including a requirement to cut back a drainage pipe and notify the neighbor by certified mail. It also continued the hearing for the Nicholas Drive/Prospect Street culvert repair to May 7, 2026. A third hearing on a project at 47 Partridge Street was discussed but no decision was reached.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Conservation Agenda 4-23-2026 CONSERVATION AGENDA.PDF Symphony Drive/Tanglewood Estates II 25-0108 NOI CORRESPONDENCE V2 20260416.PDF 25-0108C 20260415.PDF 47 Partridge Street RESPONSE TO BETA COMMENTS.PDF VARIANCE REQUEST.PDF DONOVAN_ESTATES_REVISION3-EMAIL.PDF Minor Buffer Zone Activities 10 ELIZABETH AVENUE MBZA PLAN AND PHOTOS.PDF MBZA MECO PROSPECT STREET ROW.PDF 1. Documents: 2. Documents: 3. Documents: 4. Documents:
Wed Apr 22, 2026

Council on Aging

El Consejo revisará las políticas del Centro para Personas Mayores y escuchará a la Autoridad de Vivienda

El Consejo de Envejecimiento de Franklin discutirá asuntos rutinarios, incluyendo un informe del director, correspondencia y actualizaciones de comités. Los puntos notables incluyen una presentación de la Directora Ejecutiva de la Autoridad de Vivienda de Franklin, un reconocimiento a Collette Ferguson y una revisión de las Políticas y Procedimientos finalizados del Centro para Personas Mayores. El Consejo también se prepara para las elecciones de oficiales en junio y aborda varios informes de comités.

council-on-agingsenior-serviceshousing-authoritypolicieselectionsbudgetcommittees
✓ Decidido: Council approves April 2026 minutes and sets budget vote for June 10

The Council approved the April 22, 2026 minutes and discussed FY27 budget hearings scheduled for May 28 and June 3. The Council also noted the upcoming Town Council budget vote on June 10, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Council on Aging Meeting Agenda April 22, 2026 11:00 AM Meeting will be held at the Franklin Senior Center 10 Daniel McCahill Street, Franklin, MA 02038 1. Call to order; 11:00 AM 2. Minutes of last meeting 3. Citizen’s Comments 4. Correspondence 5. Director’s Report 6. Chairman’s Comments 7. FOFE Liaison Report 8. Old Business 9. New Business ● Franklin Housing Authority Executive Director, Nayda Sanchez DeJesus ● Collette Ferguson Appreciation 10. Committee Reports ● Budget Committee ● Bylaw Committee ○ Review finalized Senior Center Policies & Procedures ○ Updating COA Binder ● Expo Committee ● Housing Committee ● Nominating Committee ○ Officer Elections: June ○ Term Expirations June 30, 2026: Lyn O’Brien, Elizabeth Sawyer, Kim Mu-Chow ● Program Committee ● Supportive Day Committee 11. Comments 12. Agenda for Next Meeting 13. Adjournment Next Meeting: May 27, 2026 11:00AM
Tue Apr 21, 2026

Design Review Commission

Siete nuevas revisiones de diseño comercial en Central Street y Franklin Village Drive

La Comisión de Revisión de Diseño llevará a cabo una reunión virtual para revisar las solicitudes de diseño de siete propiedades comerciales, incluyendo Orange Theory, CVS Pharmacy, Five Guys y otros en East Central Street y Franklin Village Drive. La junta también considerará la aprobación de las actas de las reuniones del 17 y 31 de marzo de 2026.

design-reviewvirtual-meetingcommercial-propertiesfranklin-maretailplanning
✓ Decidido: Design Review Commission approved several business sign packages

The Commission approved multiple signage applications for local businesses including Orange Theory, Mavi Zunto Beauty Studio, Five Guys, Mathnasium, Citgo, and Shell. The CVS Pharmacy application was tabled due to the applicant's absence. The Commission also approved previous meeting minutes from March 17 and March 31.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams , Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.5 20.4907 www.franklinma.gov Agenda April 21 2026 Virtual Meeting 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: Apr 21, 2026 07:00 PM Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/85043715386 Phone one-tap: +16469313860,,85043715386# US 1. New Business a. Orange Theory- 277 East Central Street b. Mavi Zunto Beauty Studio- 7 Main Street c. CVS Pharmacy- 272 East Central Street d. Five Guys- 268 B Franklin Village Drive e. Mathnasium- 427 Franklin Village Drive f. Citgo- 465 Lincoln Street g. Shell- 140 East Central Street 2. Meeting Minutes a. March 17, 2026 b. March 31, 2026 3. New Business/Old Business
Tue Apr 21, 2026

Board of Assessors

La Junta de Tasadores discutirá reducciones y exenciones rutinarias

Esta es una reunión de negocios estándar de la Junta de Tasadores de Franklin. La junta considerará denegaciones de reducciones del impuesto sobre vehículos motorizados, reducciones y exenciones de bienes personales e inmuebles, y asuntos de impuestos sobre embarcaciones. Se ha planificado una sesión ejecutiva para discutir casos confidenciales de reducciones y exenciones. No hay cambios de política importantes ni partidas de importes elevados en la agenda.

assessorsmotor-vehicle-excisepersonal-propertyreal-estateboat-exciseabatementsexemptionsexecutive-session
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF ASSESSORS MEETING AT FRANKLIN MUNICIPAL BUILDING, ROOM 106, 355 EAST CENTRAL STREET, FRANKLIN, MASSACHUSETTS TUESDAY, APRIL 21, 2026 AT 8:30 AM AGENDA The following is a list of matters reasonably anticipated by the Chair that may be discussed. Not all items may be discussed and other related items not listed may be raised for discussion to the extent permitted under Massachusetts General Law. A. APPROVAL OF MINUTES: Regular & Executive Sessions B. ADMINISTRATION, OLD BUSINESS AND NEW BUSINESS (any matters not otherwise in a specific category below). C. MOTOR VEHICLE EXCISE 1. MV Excise Tax Abatement Denials. 2. MV Monthly Letters. D. PERSONAL PROPERTY 1. PP abatements. Ss 2. PP Monthly Letters. oO S&S 2 & © => 7 — E. BOAT EXCISE a qa 1) ee Co NS F. REAL ESTATE 1. RE Abatements, Exemptions & ATB Appeals. 2. RE Monthly Letters. G. EXECUTIVE SESSION 1. I move that the Board vote to go into Executive Session under Purpose 7 to discuss and vote on matters that are confidential in accordance with law, such as, but not limited to abatements and exemptions (MGL Ch. 59, Sec. 60), or property income & expense disclosures (MGL Ch. 59, Sec 52B). Following Executive Session, the Board will return to Open Session.
Tue Apr 21, 2026

Housing Authority

La Junta aprobará el presupuesto para el año fiscal que termina en 2027 y las certificaciones financieras

La Junta de Comisionados de la Franklin Housing Authority llevará a cabo su reunión anual para revisar y aprobar el presupuesto del año fiscal que termina el 31 de marzo de 2027, junto con los estados operativos, la certificación de concordancia salarial y la certificación de las cinco remuneraciones más altas. Otros asuntos incluyen la aprobación de las cuentas por pagar de marzo de 2026, actualizaciones sobre el proyecto de lavandería/oficina de Norfolk HA (ahora completado) y una propuesta de servicios de consultoría de seguridad de la Worcester Housing Authority. La reunión también cubre las actas, los informes de instalaciones y del director, y una actualización del Comité de Preservación Comunitaria.

housingbudgetfinancial-certificationslead-paintaccounts-payablesafetynorfolk
✓ Decidido: Franklin Housing Authority approves March accounts payable totaling $166,994.01

The Board approved the FYE 03/31/2027 budget review, February and January 2026 operating statements, and March 2026 accounts payable. Members also approved lead paint law certifications and rescheduled the June board meeting to June 15, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing Authority 1000 Central Park Terrace Community Hall Franklin, MA 02038 Annual Meeting of the Board of Commissioners April 21, 2026 4:30 PM AGENDA  Chairman requests all cell phones to be silenced  Roll Call  Richard Shaw, Fee Accountant  FYE 03/31/2027 Budget Review  Operating Statements – February 2026  Wage Match Certification  Certification of Top 5 Compensation & Certification of Year End Financial Statements and Tenants Accounts Receivables  Certification of Federal and State Lead Paint Law  Approval of FYE 03/31/2027 Budget  Minutes  Minutes of the Regular Meeting of March 16, 2026  Accounts Payable  Accounts Payable for March 2026  Capital One Charges for March 2026  Director of Facilities Report  Director Report  Community Preservation Committee (CPC) Update – Commissioner Feeley  Correspondence - None  Norfolk HA Update – Managing Agency  Laundry Room/Office Project construction, laundry room 100% complete. Office complete, just a few push list items.  Norfolk delinquency  Old Business  Commissioner’s Training Report  New Business  Safety Consultation Services – provided by Worcester Housing Authority  Adjournment
Fri Apr 17, 2026

School Committee

Subcomité escolar revisará metas del equipo

Esta es una reunión procedimental del Subcomité del Legado de Horace Mann del Comité Escolar de Franklin. La agenda solo incluye una convocatoria al orden y una revisión de las metas del equipo, sin decisiones específicas ni audiencias públicas enumeradas.

school-committeesubcommitteeproceduralfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee April 17, 2026 12:30-2:00 PM Virtual Only Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/82924490270?pwd=wSGqJToP9dIhJ7Z2csNQPkQIyVaoLo.1 Passcode:150900 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Call to Order ● Review of Team Goals
Thu Apr 16, 2026

Zoning Board of Appeals

Reunión de la Junta de Apelaciones de Zonificación cancelada para el 16 de abril

La Junta de Apelaciones de Zonificación de Franklin ha cancelado su reunión programada para el 16 de abril de 2026. No se discutirá ni decidirá ningún punto. La próxima reunión está programada para el 30 de abril de 2026.

zoning-board-of-appealsmeeting-cancellationfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING April 16 , 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR April 30 , 2026
Thu Apr 16, 2026

Joint Budget Subcommittee

El Subcomité Conjunto de Presupuesto revisará la orientación del presupuesto para el año fiscal 2027

Esta es una reunión procedimental del Subcomité Conjunto de Presupuesto para recibir una orientación general sobre la Presentación del Presupuesto del Administrador Municipal para el año fiscal 2027. Los miembros discutirán las metas y el marco de trabajo del comité y revisarán los apéndices del presupuesto, incluyendo ingresos, costos fijos, ayuda local y efectivo libre. No hay votos ni decisiones programadas.

budgetjoint-budget-subcommitteefiscal-year-2027town-administratorfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Joint Budget Subcommittee Meeting (Members of the Town Council, School Committee, and Finance Committee) April 16, 2026 6:00 PM Amended 2nd Floor, Council Chambers Franklin Municipal Building 355 East Central Street A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #852 5734 9954 & Link: https://us02web.zoom.us/j/85257349954 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda 1. Call the Meeting to Order 2. Introduction of Members 3. Joint Budget Subcommittee Committee Charge and Website [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 15, 2026

Franklin's 250th Anniversary Celebration Committee

Planificación de los eventos del 250 aniversario de Franklin, incluyendo el desfile y galas

El subcomité discutirá y planificará múltiples eventos del aniversario, incluyendo una gala de apertura, un desfile (programado para el 16 de septiembre de 2028), un torneo de golf (junio de 2028), un día de diversión familiar y una gala de clausura (4 de noviembre de 2028). Los miembros también recibirán una presentación sobre el desfile y discutirán la contratación de voluntarios comunitarios para dirigir o asistir en los eventos.

anniversaryeventsparadecommunity-engagementpublic-celebrationfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Anniversary Celebration Committee Subcommittee on Events & Logistics Agenda April 15, 2026 7:30 pm Meeting will be held at the Franklin Municipal Building-3rd Floor Training Room 355 East Central Street with Hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM WEBINAR DETAILS: https://us05web.zoom.us/j/84599434661?pwd=es8Dklx1NpA69Rkcr7QMyjU0zozwUH.1) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Call to order: Sub Committee chair Roberta Trahan called the meeting to order 2. Review and approve the minutes from our March 25, 2026 Meeting 3. Discussion of events/reports from Sub Committee Members: a. Anniversary Bell Ringing b. Interfaith gathering c. Library event d. Donor Event/Party e. Opening Gala f. Parade: 9/16/2028 g. Discussion of Parade Marshalls h. Golf Tournament: June 2028 i. Family Fun Day/Picnic: ? July/August 2028 j. Closing Gala: November 4, 2028 4. Presentation on Parade by Lee Mulligan 4. Discussion of Community Member involvement to lead/assist with events 5. Discussion of meet [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 15, 2026

Town Council

El Concejo votará sobre la aceptación de $958.78 en donaciones para el Centro de Personas Mayores y Servicios para Veteranos

El Concejo escuchará presentaciones de National Grid, el Departamento de Bomberos y el Departamento de Policía. El único punto de acción es una votación para aceptar $321 para el Centro de Personas Mayores y $637.78 para Servicios para Veteranos. No hay audiencias públicas ni nombramientos programados.

giftspresentationsfire-departmentpolice-departmentnational-gridproclamationstown-council
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet April 15, 2026 7:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #821 6052 3905 & Link: https://us02web.zoom.us/j/82160523905 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 14, 2026

School Committee

El Comité Escolar vota por rechazar estudiantes de elección escolar para 2026-27

El comité votará sobre no aceptar estudiantes de elección escolar y de intercambio extranjero para el año escolar 2026-27, aprobará los Planes de Mejora del Distrito y de la Escuela, establecerá nuevas cuentas rotatorias y realizará las primeras lecturas de las políticas sobre el reconocimiento de los logros estudiantiles y el uso comunitario de las instalaciones escolares. La agenda de consentimiento incluye la aceptación de varias donaciones que suman $12,328.52.

school-committeeeducationschool-choiceforeign-exchangepoliciesbudgetsdonations
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee April 14, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/87049378550?pwd=4hwPfpDEZMWs8x3GTOhpNmWo56n1RI.1 Passcode:856678 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 719 359 4580 US A G E N D A [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 13, 2026

School Committee

El Comité Escolar celebra una sesión ejecutiva para la negociación colectiva con múltiples unidades sindicales

El Comité Escolar de Franklin se reúne para entrar en sesión ejecutiva para la estrategia de negociación colectiva y sesiones con cuatro grupos de empleados. La sesión cerrada está autorizada bajo la ley estatal para evitar perjudicar la posición de negociación del comité. No hay asuntos públicos ni decisiones en la agenda abierta.

school-committeecollective-bargainingexecutive-sessionlaborcontractsfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Contractual Negotiations April 13 & 28, 2026 4:30-7:30 PM Municipal Building 3rd Floor Training Room A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1. Call to Order 2. Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. b. Pursuant to M.G.L. c. 30A, §21(a)(2) to conduct collective bargaining sessions with the Van Drivers, Cafeteria, ESP/LPN and Secretaries units.
Sun Apr 12, 2026

Franklin's 250th Anniversary Celebration Committee

El subcomité revisa hojas de cálculo de recaudación de fondos y aprueba carta

El Subcomité de Presupuesto y Recaudación de Fondos del Comité de Celebración del 250 aniversario de Franklin se reunirá virtualmente para revisar las hojas de cálculo de recaudación de fondos corporativos potenciales y de la gala, así como posibles compras de Strawberry Stroll. También tienen previsto aprobar una carta de recaudación de fondos.

budgetfundraising250th-anniversaryeventsfranklin
✓ Decidido: Budget subcommittee discusses fundraising, merchandise for 250th anniversary

The Budget Subcommittee reviewed potential event costs and fundraising strategies, approved previous meeting minutes, and formed an informal working group to order merchandise for the Strawberry Stroll. All events will be privately funded. No formal votes were taken on substantive items.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Budget and Fundraising April 12, , 2026 7:30 PM Meeting will be held virtually via Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair 2. Approval of minutes 3. Report of subcommittee members 4. Review: ● Potential corporation fundraising spreadsheet ● Potential Gala spreadsheet ● Potential Strawberry stroll purchases 5. Approval of: ● fundraising letter 6. Agenda items for next meeting 7. Adjourn
Fri Apr 10, 2026

School Committee

El subcomité de políticas discutirá el alquiler de instalaciones, perros de apoyo emocional y excursiones escolares

El Subcomité de Políticas del Comité Escolar de Franklin se reunirá para revisar y discutir revisiones de varias políticas, incluyendo las políticas de alquiler de instalaciones (KF, KF-E1 a KF-E5), una nueva política sobre perros de apoyo emocional (ID) y los procedimientos de excursiones escolares (IJOAA). El comité también discutirá la señalización en propiedades estatales y considerará nuevas políticas sobre informes administrativos (CL), el informe anual del distrito escolar (CM) y las normas y procedimientos del subcomité. No se esperan votos ni decisiones finales en esta reunión de trabajo.

school-committeepoliciesfacility-rentalemotional-support-dogfield-tripssignageadministrative-reportssubcommittee
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN SCHOOL COMMITTEE Policy Subcommittee Meeting DATE: 4/10/26 TIME: 8:15 AM Members of the public are now welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Meeting feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak will be able to raise their hand to be recognized by the Chair. The meeting host will invite the attendee to unmute for comment. Location: Municipal Building 3rd floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/87613144880?pwd=iIcBDqfME4LFgRgSy16WTBRkPSalz1.1 Passcode:536799 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law.” I. Attendance - II. Review of Minutes III. Approved Policies A. none IV. Discussion of Policies sent to School Committee A. none V. Discussion & Re [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 9, 2026

Charles River Pollution Control District (CRPCD)

El CRPCD escuchará una actualización sobre la apelación del permiso NPDES 2025

El Charles River Pollution Control District se reunirá el 9 de abril de 2026 para recibir actualizaciones sobre la apelación del permiso NPDES 2025 y revisar los datos de conexión de alcantarillado para Franklin y Medway. La junta también considerará la aprobación del Warrant 26-10 para gastos de operación y capital y discutirá los resultados del muestreo de cobre en el Mine Brook Interceptor.

wastewaternpdes-permitsewer-connectionscopper-samplingboard-meetingfranklinmedwaywarrant
✓ Decidido: Approved $382,626.62 in warrants for operations and capital projects

The Charles River Pollution Control District board unanimously approved Warrant #26-10 totaling $382,626.62 ($376,928.12 for operations and $5,698.50 for capital projects). The board also discussed ongoing work on the NPDES permit appeal and noted the treatment facility was not in compliance for March 2026 due to copper exceedance. Minutes from the March meeting were approved as well.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING APRIL 9, 2026 at 3:00 P.M. CONFERENCE ROOM AGENDA 1. Update on 2025 NPDES Permit Appeal 2. Approval of Warrant 26-10 a) O & M $ XXX,XXX b) Capital $ XXX,XXX 3. Engineer’s Report a) Submitted the Annual Collection System O&M Report b) Updating GIS System – GPS manholes in the field 4. Executive Director’s Report a) Sewer Connections (March 2026) Franklin 2 homes 440 gpd 5 multi-units (535 bdrms) 58,850 gpd 1 commercial 3,000 gpd Medway 2 homes 550 gpd b) NPDES Permit Compliance Report (March 2026) c) Update on Copper Sampling in Mine Brook Interceptor (MBI) d) Update on Elevator e) Proposed Future Board Meeting Dates: Wednesday, July 22nd at 3 pm Wednesday, August 12th at 3 pm Wednesday, September 9th at 3 pm Wednesday, October 14th at 3 pm Thursday, November 12th at 3 pm Thursday, December 10th at 3 pm 5. Public Comment 6. Approval of Minutes from the March 20, 2026 Monthly Meeting 7. Anticipated Topics for the Wednesday, May 13, 2026 Monthly Board Meeting at 3:00 pm a) Updates to Employee Handbook b) Annual Meeting
Thu Apr 9, 2026

Conservation

Conservación revisará el NOI de Symphony Drive y otros permisos

La Comisión de Conservación de Franklin revisará un Aviso de Intención (NOI) para Symphony Drive, un plan de transecto para Lewis Street, una revisión por pares para Donovan Estates (47 Partridge), varias actividades menores en la zona de amortiguamiento y una modificación de permiso para 160 Maple Street South. La reunión incluye la consideración de planes de ingeniería y planes de sitio para estos proyectos.

conservationnotices-of-intentbuffer-zonespermitssite-plansengineering
✓ Decidido: Commission approved timber‑mat permit modification for 160 Maple St

The Conservation Commission voted 7‑yes, 0‑no, 0‑absent to approve the permit modification for 160 Maple Street (Maplegate South CE159-1287) using timber matting and removing the gravel base and culvert. The motion was made by Matthew Stoltz and seconded by Michael Rein. The Commission also voted 7‑yes, 0‑no, 0‑absent to continue the Notice of Intent for the Nicholas Drive/Prospect Street culvert repair to April 23, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Revised Conservation Agenda - BACK IN COUNCIL CHAMBERS 4-09-2026 REVISED CONSERVATION AGENDA.PDF Symphony Drive SYMPHONY DRIVE NOI REVIEW 2026-03-26.PDF Lewis Street 25125 UPLAND TRANSECT PLAN 033126, STAMPED.PDF LEWIS ST NOI REVIEW 2026-03-24.PDF Donovan Estates 47 PARTRIDGE NOI PEER REVIEW 2026-03-27.PDF Minor Buffer Zone Activities MBZA PLANS 680 PLEASANT ST.PDF MBZA SITE PLAN 58 DANIELS STREET.PDF MBZA PHOTOS AND PLAN 8 CARDINAL DRIVE.PDF 160 Maple Street South Permit Modification 160 MAPLE STREET - TEMP ROAD OVERVIEW 4-8-26.PDF 1. 7:00 P.M. Documents: 2. Documents: 3. Documents: 4. Documents: 5. Documents: 6. Documents:
Thu Apr 9, 2026

Cultural District Committee

El Comité del Distrito Cultural Franklin revisa los conceptos de la torre del viento y los planes del 250 aniversario

El Comité del Distrito Cultural revisará y aprobará las actas de la reunión anterior, recibirá actualizaciones del subcomité sobre PorchFest, Fence Gallery y la torre del viento, y discutirá los conceptos de la torre del viento. Se presentarán informes sobre actualizaciones de artes, cultura y economía creativa, junto con una actualización sobre el 250 aniversario de Franklin. La orden del día incluye asuntos de negocios pendientes y nuevos, pero no se listan votaciones específicas o decisiones financieras.

cultural-districtartswind-phone250th-anniversaryporchfestfence-gallerymeeting-minutes
✓ Decidido: No votes taken, committee hears updates on Porch Fest and wind phone

The Cultural District Committee approved the previous meeting minutes but took no formal votes on any new business. Members received updates on Porch Fest registrations (21 bands, 18 porches), chain-link gallery banners ordered at $80 each, and a wind phone installation at the sculpture park. One Finance Committee member opposed the $20,000 budget request for the Director of Arts, Culture and the Creative Economy.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee MeetingThursday, April 9, 2026, 6:30 pmFranklin Historical Museum, 80 West Central St., Franklin AGENDAA.Review and Approval of the Meeting Minutes oMarch 12 , 2026, Cultural District Meeting B.Sub-Committee Updates oPorchFestoFence GalleryoWind phoneC.Wind phone Concepts – Amy AdamsD.Arts, Culture and the Creative Economy Updates – John LoPresti for Cory SheaE.Franklin, MA 250th Anniversary update - Roberta Trahan Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/Feedback Adjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: April 2, 2026Posted: Sent to Town Clerk on April 2, 2026, for posting
Thu Apr 9, 2026

Finance Committee

El comité de finanzas revisa las recomendaciones finales del presupuesto municipal del año fiscal 2027

El Comité de Finanzas del Pueblo de Franklin continuará su audiencia pública sobre el Presupuesto Operativo del Administrador Municipal para el año fiscal 2027 y revisará las recomendaciones presupuestarias finales. El comité también considerará una propuesta del Subcomité Conjunto de Presupuesto para modificar la membresía del Comité de Finanzas. La agenda no enumera decisiones finales ni votaciones.

budgetfinance-committeetown-administrationpublic-hearingcommittee-membership
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Thursday, April 9, 2026 AMENDED Meeting will be held at the Municipal Building 3rd Floor Training Room 355 East Central Street 6:00 PM A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Eranklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details: ID # 858 2301 9344 & (https://usO2web.zoom.us/j/85823019344) > Any participants who wish to speak during the webinar must enter their fullname and email address when joining the webinar. > All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. > All speakers will be required to state their full name and street address before commenting. Agenda 1. Call to Order 2. FY2/7 Town Administrator Operating Budget Hearing continued... FY27 Town Administrator Budget Materials website [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 9, 2026

Finance Committee

Continúa la audiencia sobre el presupuesto del Administrador Municipal para el año fiscal 2027 con recomendaciones finales

El Comité de Finanzas continuará su audiencia sobre el Presupuesto Operativo del Administrador Municipal para el año fiscal 2027 y considerará las recomendaciones presupuestarias finales. El comité también revisará una propuesta del Subcomité Conjunto de Presupuesto para modificar la membresía del Comité de Finanzas. Estas decisiones definirán el plan de gastos del municipio para el próximo año fiscal.

budgetfinanceoperating-budgetfy27town-administratorjoint-budget-subcommitteecommittee-membershipfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Thursday, April 9, 2026 AMENDED Meeting will be held at the Municipal Building 3rd Floor Training Room 355 East Central Street 6:00 PM A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details: ID # 858 2301 9344 & (https://us02web.zoom.us/j/85823019344) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full nam [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 9, 2026

Benjamin Franklin Classical Charter Public School

La Junta votará sobre el presupuesto propuesto y el tamaño de la junta para 2026-2027

La Junta de Fideicomisarios de Benjamin Franklin Classical Charter Public School llevará a cabo una reunión virtual para discutir y votar sobre el presupuesto propuesto para el próximo año escolar y el tamaño de la junta para 2026-2027. Otros puntos de la agenda incluyen la revisión de una encuesta de compromiso de los empleados, presentaciones de posibles asesores legales y actualizaciones de los comités.

budgetboard-sizecharter-schooleducationemployee-surveygovernancemeeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOL April 9th BOARD OF TRUSTEES MEETING Thursday, April 9, 2026 7-10pm Virtual Meeting Google Meet joining info Video call link: meet.google.com/ovq-sxxk-ehe Or dial: (US) US)+1 413-276-7715 PIN: 960522951 =================================== 7:00 Call to Order 7:05 Open Comment Period 7:10 Review and vote on meeting minutes from 3/12 meeting 7:15 ED Update 7:25 Student Leader Presentation 7:45 Prospective Counsel Presentations 8:30 Review of Employee Engagement Survey 9:15 Review of Proposed Budget (vote needed) 9:20 Board Size AY 2026-2027 (vote needed) 9:25 Strategic Plan Needs 9:35 Committee Updates -DEIB -Facilities -Finance -Governance -HR -Mission 9:55 Task List 10:00 Executive Session Adjournment The scheduled times as listed are approximate.
Thu Apr 9, 2026

Legal Notices

Audiencia pública sobre la instalación de un poste de National Grid en High Street

El Administrador del Pueblo llevará a cabo una audiencia pública sobre una petición de National Grid para instalar un nuevo poste de servicios públicos compartido en High Street, aproximadamente a 160 pies al este de Main Street. El poste también servirá a Verizon New England. La audiencia permite comentarios públicos en persona o vía Zoom.

public-hearingpolesutilitiesnational-gridverizonfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION PUBLIC HEARING April 9, 2026, 1:00 PM Pole Petition Plan # 31247143: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. HIGH STREET National Grid proposes to install a new JO Pole (# P1-50) on High St. beginning approximately 160 ft. East of the centerline of the intersection of High St. and Main St., at approximately (42°05’13”N 71°24’05”W). In conformity with the requirements of Section 22 of Chapter 166 of the General Laws (Ter. Ed.) you are hereby notified that a Public Hearing will be held in the Council Chambers on the second floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Tuesday, April 9, 2026 at 1:00 p.m. upon the petition by Massachusetts Electric Company d/b/a National Grid regarding the Pole Petition described above. All citizens are welcome to attend public meetings in person. Additionally, in an effort to maximize citizen engagement opportunities, citizens will also be able to participate remotely via Zoom using the following login information: Zoom ID: 834 4320 1082 Link: https://us02web.zoom.us/j/81343201082 Call-In Phone Number: 1-929-205-6099, enter Meeting ID, then press # For additional information call the Town Administrator’s Office at 508-520-4949. Respe [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 9, 2026

Municipal Affordable Housing Trust

El Fideicomiso discutirá el uso de las parcelas restantes en Veterans Memorial Dr.

El Franklin Municipal Affordable Housing Trust discutirá el uso de las parcelas restantes del fideicomiso en Veterans Memorial Drive, recibirá una actualización sobre el proyecto Franklin Ridge y revisará las finanzas del fideicomiso. La junta también considerará la aprobación de las actas de la reunión del 12 de marzo de 2026.

affordable-housingtrustfranklin-ridgeveterans-memorial-drfinancehousingfranklin
✓ Decidido: Trust approves March minutes and requests timeline for SHI/ASHI project updates

The Municipal Affordable Housing Trust met on April 9, 2026, to review the Franklin Ridge Senior Housing update and discuss future housing initiatives. The board approved the March 12 meeting minutes and directed staff to establish a timeline for future SHI/ASHI project discussions with town committees. Trustees discussed potential developments on two remaining parcels to address a documented housing gap for residents earning 30% to 50% of the area median income.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.520.4907 www.franklinma.gov Agenda April 9, 2026 Hybrid & In-Person 2pm To all residents- this meeting is available to be attended in person in the 3rd Floor Training Room of the Town of Franklin Municipal Building or via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. When: Apr 9, 2026 02:00 PM Topic: Franklin Municipal Affordable Housing Trust Fund Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/87487607101 Phone one-tap: +19292056099,,87487607101# 1. Franklin Ridge Update 2. Discussion a. Use of Remaining Trust Parcels on Veterans Memorial Dr. 3. Trust Finance Update 4. Meeting Minutes a. March 12, 2026 5. New Business/Old Business
Thu Apr 9, 2026

Pole Petition Hearing

Audiencia pública sobre el nuevo poste de National Grid/Verizon en High St

El Administrador del Pueblo llevará a cabo una audiencia pública sobre una petición de postes de Massachusetts Electric (National Grid) y Verizon para instalar un nuevo poste de uso compartido en High Street, aproximadamente a 160 pies al este de Main Street. La reunión está abierta en persona y vía Zoom.

polespublic-hearingutilitiesnational-gridverizonfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION HEARING AGENDA April 9, 2026 1:00 PM Pole Petition Hearing will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. Additionally, residents are also welcome to participate remotely via Zoom. ZOOM WEBINAR DETAILS: I D #81343201082 & Link: https://us02web.zoom.us/j/81343201082 Call-In Phone Number: 1-929-205-6099, enter Meeting ID then # ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Pole Petition Plan #31247143: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. HIGH ST. National Grid proposes to install a new JO Pole (# P1-50) on High St. beginning approximately 160 ft. East of the centerline of the intersection of High St. and Main St. at approximately (42°05’13”N 71°24’.05”W). Additional information can be found on our town website, Franklinma.gov or by calling the Town Administrator’s Office at 508-580-4949 TOWN ADMINISTRATOR’S OFFICE Cc: Massachusetts Electric Co. NOTICE TO ABUTTERS POLE PETITION PUBLIC HEAR [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 9, 2026

Bi-County Collaborative

La Junta votará sobre subvenciones para programas de educación especial y alfabetización

La Junta Directiva de Bi-County Collaborative se reunirá para aprobar actas, escuchar una actualización del director ejecutivo que incluye cambios de empleados y tendencias de inscripción, y votar sobre varias subvenciones, una donación y el presupuesto del FY26. La reunión también cubre las fechas de graduación y el calendario escolar 2026-2027.

educationcollaborativeboard-of-directorsgrantsenrollmentbudgetfranklin-maspecial-education
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BOARD OF DIRECTORS MEETING April 9, 2026 9:00-10:30 Agenda Join Zoom Meeting https://bicounty-org.zoom.us/j/87982401978?pwd=F085zIi5LzExtVJazxzRZN4EMa0pRo.1 Meeting ID: 879 8240 1978 Passcode: khqY1d 1. Approval of Minutes - Mrs. Jeanne Sullivan, Executive Director a. Board of Directors Meeting, March 12, 2026 (Vote Required) 2. Executive Director Update - Mrs. Jeanne Sullivan, Executive Director a. Employee Appointments/ Resignations/ LOA (Vote Required) b. Enrollment - Mrs. Julie O’Connor, Director of Student Services Mrs. Laurie Cunningham, Director of Clinical Services i. Current Enrollment / Referrals ii. Referral / Acceptance Data & Trends c. Update on Executive Director 25-26 Goals d. Program Highlights e. Collaborative Shoutouts 3. Business Office Updates - Ms. Holly Buttrick, Director of Finance & Operations a. Financial Overview i. FY26 Budget ii. Acceptance of Donation (Vote Required) iii. Grants - Mrs. Jeanne Sullivan, Executive Director, Mrs. Ann Buckley, Professional Dev. & Curriculum Specialist, Ms. Pamela Ludwig, Program Director 1. FC 0213 Support Implementing Time Out Practices (Vote Required) 2. PRISM III Continuation Grant (Vote Required) 3. Literacy Launch - Winter/ Spring 2026 Round 2 Early Literacy High-Dosage Tutoring ( Vote Required) 4. Registered Teacher Apprenticeship (Application Filed) 4. Other a. Graduation Dates: i. Learning Center: June 2, 2026 (2) ii. Summit/STAP : June 4, 2026 (10) b. 2026-2027 BICO School Calendar The Bi-County Collabor [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 8, 2026

Historical Commission

Solicitud de cambio de ubicación de cobertizo de Habitat for Humanity en la agenda

La Franklin Historical Commission discutirá una solicitud de cambio de Habitat for Humanity con respecto a la ubicación de un cobertizo, junto con actualizaciones sobre la planificación de Franklin 250, diseños de exhibiciones para Veterans y Police/Fire, y próximos eventos musicales. La reunión también incluye la revisión del estado de miembro asociado y los precios del tour en autobús.

historical-commissionfranklin-250habitat-for-humanityexhibit-planningcommunity-eventspreservation
✓ Decidido: Approved $600 for archival boxes and preservation award

The Historical Commission approved $600 from the budget for archival boxes and voted to award the Mary Olsson Historical Preservation award. Prior meeting minutes were also approved unanimously. No citizen comments or presentations were made.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin MassachusettsHistorical CommissionAgenda, Weds.,April 8, 2026, 6:00 pm Meeting at the Museum, 80 W. Central StAPPROVAL OF MINUTES – Mar. 11, 2026, Mar 25, 2026CITIZENS COMMENTS: PRESENTATIONS: FFHM REPORT: SUBCOMMITTEE REPORTS: TREASURER/ARCHIVIST FINANCIAL REPORT: COMMUNITY PRESERVATION COMMITTEE: FRANKLIN 250 UPDATEFRANKLIN 250 Historical Sub CommitteeFPS HORACE MANN COMMITTEE ARCHIVIST UPDATE—FEDERATED CHURCH---GENERAL UPDATESREGULAR BUSINESS:Assession and DeassessionsExhibit Planning -- Veterans exhibits and Police/FireOLD AND NEW BUSINESS:Review Associate Member StatusUpdate on Tri-County Bell StandHistoric Huddle in Plainville 6-6 1 pm, Plainville Town Hall, 190 South St , contact Kristine [email protected]Habitat for Humanity Change Request -- Shed LocationHabitat for Humanity May 30 event + Mary Olsson awardCory Shea 'Artist in Residency' idea.Discuss continuing updates to exhibits…status of timeline, etcReview Johnston Appraisal event...Bus tours for $?Discuss hosting and project helpMusic Programs for 2026 – Dennis Ferguson Jazz on Sunday, April 26, PorchfestReview and discuss upcoming events into 2026-7 and beyond. Ideas?Other matters not otherwise enumeratedCOMMISSIONER COMMENTS:ADJOURN
Wed Apr 8, 2026

Finance Committee

El Comité de Finanzas continúa la audiencia del presupuesto del AF27 para Seguridad Pública y DPW

Esta es una audiencia continuada sobre el Presupuesto Operativo del Administrador del Pueblo para el AF27. El comité revisará los presupuestos propuestos para los departamentos de Seguridad Pública (Policía, Bomberos, Despacho Regional, Inspección, Control de Animales) y el Departamento de Obras Públicas, incluyendo los Fondos Empresariales para Residuos Sólidos, Alcantarillado, Agua y Aguas Pluviales. No hay votaciones programadas; es una sesión de discusión.

finance-committeebudgetpublic-safetypolicefirepublic-worksenterprise-fundsfy27
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Wednesday, April 8, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers 355 East Central Street 6:00 PM A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details: ID # 830 5185 2189 & (https://us02web.zoom.us/j/83051852189) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name an [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 8, 2026

School Committee

Subcomité escolar planificará el Strawberry Stroll, el boletín informativo y una sesión de preguntas y respuestas

El Subcomité de Relaciones Comunitarias del Franklin School Committee discutirá las métricas actualizadas del sitio web, planificará una sesión de preguntas y respuestas de Franklin con funcionarios estatales y municipales, organizará el evento Strawberry Stroll y trabajará en la planificación del boletín informativo. Esta es una reunión de planificación en la que no se esperan votos ni partidas presupuestarias.

schoolscommunity-relationswebsiteeventsnewsletter
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Community Relations Sub Committee April 8, 2026 6:40 PM Virtual Only Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/82459006144?pwd=aWpp94CXo8raPpQ6tsGxu2QpZLYMBD.1 Passcode:761702 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 346 248 7799 US (Houston) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters is those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Updated Website Metrics ● Franklin Q&A Session / State & Town Officials' Breakfast/Coffee Hour ● Strawberry Stroll Planning ● Newsletter Planning
Tue Apr 7, 2026

OPEB Board of Trustees

PRIM Board and PRINT Fund overview presentation

The OPEB Trust Committee will hear a presentation on the PRIM Board and PRINT Fund during its April 7, 2026 meeting. The agenda also includes approval of minutes from July 2025, public comments, and future meeting scheduling.

opebpensionsinvestmentspublic-meetingfranklin
✓ Decidido: OPEB Board of Trustees reviews officer structure and investment performance

The Board reviewed the officer structure as outlined in Article 5 of the Trust Agreement. Laura Strickland from Mass PRIM presented a review of the Trust's current investment performance and strategy.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
OPEB Trust Committee Agenda & Meeting Packet Tuesday, April 7, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers 355 East Central Street 11:00am A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details : ID # 895 0466 6290 & (https://us02web.zoom.us/j/89504666290) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their fu [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Other Post-Employment Benefits (OPEB) Trust Meeting Minutes July 15, 2025 11:00 AM Municipal Building 355 East Central Street Third Floor Training Room 326A Meeting Minutes In Attendance: Committee Members : Chair Jamie Hellen, Town Administrator; Kerri Bertone, CFO; Jana Melotti, School Business Administrator; Chris Feeley, Resident Member Additional Attendees : Anne Marie Duggan, Treasurer; Laura Strickland, Sr. Client Services Officer Mass PRIM Absent: Greg McNeille, Resident Member Call to Order: Jamie Hellen called the meeting to order at 11am Election of Officers: The board reviewed the officer structure as outlined in Article 5 of the Trust Agreement. The Board of Trustees consists of five (5) members: Town Administrator Finance Director - CFO School Business Manager and two (2) residents Jamie Hellen, Town Administrator, will continue to serve as Chairperson in accordance with the agreement. Review of Investments Laura Strickland, Senior Client Services Officer from Mass PRIM, presented a review of the Trust’s current investment performance and strategy. Key highlights of the investment portfolio and performance metrics were discussed. Next Meeting Date: Tuesday, April 7, 2026 Adjournment: Jamie Hellen adjourned the meeting at 11:53 am
Tue Apr 7, 2026

Finance Committee

Finance Committee continues FY27 Town Administrator Operating Budget hearing

The Finance Committee is continuing a hearing on the FY27 Town Administrator Operating Budget. The discussion focuses on public education budget materials.

budgeteducationpublic-schools
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Tuesday, April 7, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers 355 East Central Street 6:00 PM A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details : ID # 872 7549 9947 & (https://us02web.zoom.us/j/87275499947) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state thei [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 7, 2026

Franklin's 250th Anniversary Celebration Committee

Committee to discuss 250th anniversary logo and merchandising

The Franklin 250th Anniversary Celebration Committee Communications Subcommittee will meet to approve a final logo concept and identify leads for merchandising, website, and social media. The meeting will be held via Zoom.

anniversarycommitteecommunicationslogomerchandisingwebsitesocial-media
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Communications Subcommittee Agenda April 7, 2026 6:00 PM Meeting will be held on Zoom. Joining details are listed below. A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/99204994726?pwd=RkyXYh3TX524wt2RoGxoNvzvG1z7C0.1 Meeting ID: 992 0499 4726 Passcode: 685907 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting ➢ Email [email protected] with any questions Agenda 1. Announcements from the chair 2. Approval of minutes a. March 10, 2026 3. Agenda items a. Approve final Logo Concept 1 to be presented to the General Committee for final approval b. Identify lead person for merchandising c. Identify lead person for website d. Identify lead person for social/media e. Discuss next steps for merchandising open call f. Discuss next steps for website open call g. Discuss a PR and Communication Plan/Cadence h. Confirm meeting cadence moving forward 4. Adjourn
Mon Apr 6, 2026

Planning Board

Planning Board holds public hearing on Olam Estates subdivision modification at 900 Washington St

The Franklin Planning Board will hold public hearings on several subdivision proposals, including a definitive subdivision modification for Olam Estates at 900 Washington Street and a new private definitive subdivision for Tanglewood Estates II on Symphony Drive. Hearings for Grillo Estates at 70 Daniels Street and Donovan Estates at 47 Partridge Street are continued. The board will also review two Approval Not Required (ANR) plans for 15 Rolling Ridge and 20 Veterans Memorial Drive.

planning-boardsubdivisionspublic-hearingszoningfranklin
✓ Decidido: Planning Board approves land transfers and continues several subdivision hearings

The Planning Board approved two land transfers via ANR for Rolling Ridge and Veterans Memorial Drive. Several subdivision applications, including Grillo Estates and Donovan Estates, were continued to a later date.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet April 6, 2026 Meeting will be held at the Municipal Building Training Room, 3rd floor, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/84714705664 or call on your phone at 312- 626-6799, meeting #84714705664. PUBLIC HEARINGS 1. 900 Washington St (Olam Estates) – Definitive Subdivision Modification Definitive Subdivision Plans Correspondence 2. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision TO BE CONTINUED 3. 47 Partridge Street (Donovan Estates) – Definitive Subdivision TO BE CONTINUED 4. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision Definitive Subdivision Plans Correspondence GENERAL BUSINESS: A. 81-P ANR: 15 Rolling Ridge B. 81-P ANR: 20 Veterans Memorial Drive This agenda is subject to change. The next meeting of the Planning Board is scheduled for April 27, 2026. Notice: The Franklin Planning Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Planning Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Fr [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board April 6, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, Training Room, 3rd Floor, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk; Mark Mucciarone; Eric Steltzer; William Lee, associate member. Members absent: None. Also present: Amy Love, Town Planner; Michael Maglio, Town Engineer; Steven Lee, BETA Group (via Zoom). Note: Documents presented to the Planning Board are on file. GENERAL BUSINESS A. 81-P ANR: 15 Rolling Ridge Ms. Love said they submitted an 81P. It is a plan of land for 37 Hilltop Road and 15 Rolling Ridge Road. A portion of 37 Hilltop Road is being conveyed to 15 Rolling Ridge Road. It does conform to the zoning; it is just a small portion of two backyards that they are conveying over to 15 Rolling Ridge. Motion to Approve the 81-P ANR for 15 Rolling Ridge. Rondeau. Second: Mello. Vote: 5-0-0 (5-Yes; 0- No; 0-Absent). B. 81-P ANR: 20 Veterans Memorial Drive Ms. Love said this is part of Eaton Place. Since the road was never extended until recently, the Town extended the roadway up for the next project, which is known as Franklin Ridge. They have always had [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 6, 2026

Legal Notices

Franklin Planning Board to hear Olam Estates subdivision modification

The Franklin Planning Board will hold a public hearing on April 6, 2026, to consider a Definitive Subdivision Modification for the Olam Estates project. The proposal involves creating an additional lot in the Rural Residential I district at 900 Washington Street.

zoningsubdivisionplanning-boardpublic-hearingrural-residential
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, April 6 , 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Definitive Subdivision Modification titled “Olam Estates” prepared by DiPrete Engineering , Milford, MA, and submitted to the Department of Planning & Community Development on March 16, 2026, by Cornerstone Luxury Homes, LLC, Hopkinton, MA. The property is located in the Rural Residential I Zoning District (Assessors Map 340 Lots 6.4 and 6.5) at 900 Washington Street. The proposed modification of the subdivision is to create an additional lot. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Copies of the plan and supporting documentation may be reviewed in the Department of Planning & Community Development during regular office hours as well as on the Franklin Planning Board website at www.franklinma.g [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 6, 2026

Finance Committee

Finance Committee reviews FY27 Town Administrator operating budget

The Finance Committee will review the proposed FY27 Town Administrator Operating Budget, covering General Government, Human Services, Culture & Recreation, Debt & Interest, and Employee Benefits. They will also consider approval of the March 11, 2026 meeting minutes. The meeting is open to the public in person and remotely.

budgetfinancetown-administratoroperating-budgetgeneral-governmenthuman-servicesculture-recreation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet April 6, 2026 6:00 PM Meeting will be held at the Municipal Building 2nd floor, Council Chambers 355 East Central Street A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Zoom Webinar Details: ID # 830 0707 6934 & (https://us02web.zoom.us/j/83007076934) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants - who have entered full name and email address - will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street add [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 2, 2026

Franklin Commission on Disability

Commission to discuss accessibility and plan Strawberry Stroll event

The Franklin Commission on Disability will meet to review handicap parking funds, discuss accessibility checks, and plan the Strawberry Stroll event. The meeting will also include updates on a new member and the Central Terrace project.

disabilityaccessibilityparkingsenior-centerfranklinstrawberry-stroll
✓ Decidido: Commission approves April minutes and prepares for new member ratification

The Commission approved the minutes from the April 2, 2026 meeting. Two new members will be notified and ratified at the upcoming May town council meeting, with Julie McCann set to become a voting municipal representative. Planning continues for the Strawberry Stroll event, including table placement and engagement activities.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Meeting Agenda Date: April 2, 2026 Time: 4:00pm Location: Senior Center, 10 Daniel McCahill St, Franklin, MA *Please note: we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance Call to Order ● Approve previous meeting minutes ● Public Comments ● Announcements from the Chair ○ AAB Non-Compliance Letters ○ Handicap Parking Funds: Chapter 40, Section 22G ● Old Business: ○ Accessibility in Franklin: check locations/events ○ Education Goal: check in on training ○ Event Goal: Plan for Strawberry Stroll: schedule slots ○ New member updates ○ Central Terrace update ● New Business: Adjourn meeting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Commission on Disability Meeting Minutes Date : May 7, 2026 Time : 4:00pm Meeting will be held at : Senior Center, 10 Daniel McCahill St, Franklin, MA, Computer Room Members Present: Alison Rheaume, Lauren Sanford, Kelly Quinlan, Michael Furilla, Cheryl Fisher Members Absent: Randy Jay Meeting Called to order by Alison Rheaume, Chairperson, at 4:00pm 1. Announcements from the Chair a. AAB letters non compliance letters - Glen Meadows responded with plan and will be completed July 3. b. AWG - connect all departments and discuss compliance and digital compliance. 2. Citizen Comments a. Counselor Maxwell Morrongiello - joining the meeting to see how we operate and acknowledge our committee 3. Member Comments a. none 4. Approval of Minutes: A motion was made and carried to accept the minutes of the April 2nd, 2026 meeting. Approved 5. Old Business a. Accessibility in Franklin document check-in: i. holistic updated, but need to locate file ii. eliminate entries that aren't Franklin b. Education goals: attending webinars or training updates i. None to report. ii. In next month, watch tips for hosting accessible events and meetings; link will be emailed. c. Strawberry stroll: event planning i. table donated, working with downtown partnership with table placement ii. discussion on engagement activity: interactive trivia and disability related tasks. Chair wi [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 2, 2026

Zoning Board of Appeals

ZBA to discuss litigation strategy for 444 East Central Street

The Zoning Board of Appeals will meet to approve previous minutes and enter an executive session. The board will discuss litigation strategy regarding a Land Court appeal of a Chapter 40B Comprehensive Permit for 444 East Central Street.

zoninglitigationchapter-40bland-court
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board of Appeals Agenda April 2, 2026, 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers and Zoom Platform A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID #: 982 6364 5070& Link: https://zoom.us/j/98263645070 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. 6:00pm Declare Public Session Open 2. ANNOUNCEMENTS FROM THE CHAIR 1. Chair to identify members participating remotely. 3. APPROVAL OF MINUTES March 5, 2026 4. Executive Session: To discuss litigation strategy related to abutters’ appeal pending in Land Court regarding the Zoning Board of Appeals issua [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 2, 2026

Economic Development Subcommittee

Economic Development Subcommittee to discuss priorities and 2026-27 goals

The subcommittee will review the town's economic development profile, including the 2025 Master Plan and the 2022 Downtown Franklin for All Study. Members will discuss next steps and priorities for the 2026-27 Town Council goals.

economic-developmentzoningtaxesmaster-plantourism
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Economic Development Subcommittee Agenda & Meeting Packet April 2, 2026 7:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #853 1960 7858 & Link: https://us02web.zoom.us/j/85319607858 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Introduction of Committee members 2. Economic Development Profile a. I-495 Partnership Profiles i. Frankli [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 1, 2026

Board of Health

Board will consider a public health advisory for Chilson Beach

The Franklin Board of Health will approve minutes from the March 4 and March 18, 2026 meetings. Citizens may comment for up to three minutes on matters not on the agenda. New business includes a public health advisory notice for Chilson Beach, a discussion on regulation of novel intoxicating products, an update on warming and cooling shelters in Franklin, and a food inspection presentation. Reports from the Metacomet Shared Service Grant health agent and public health nurse will also be presented.

public-healthnovel-substancessheltersfood-inspectionminutescitizen-comments
✓ Decidido: Board of Health discusses new product regulations and beach advisory

The Board discussed draft regulations for novel intoxicating products, including proposed fine amounts and specific substance additions. Director Liberty noted a DEP recommendation for a fish consumption advisory at Chilson Beach due to PFAS contamination. Research into 24-hour warming and cooling shelters will be presented at the May meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet April 1, 2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room https://meet.google.com/fta-qjjg-mon?authuser=0&hs=122 tel:+1-337-445-0643 A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. March, 4 2026 b. March 18,2026 NEW BUSINESS a. Public health advisory at Chilson Beach notice b. Novel intoxicating products or subst [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
BOH MEETING MINUTES April 1, 2026 In attendance: Chair, Kim Mu-Chow; Vice Chair, Jeff Harris; Member, Diane Daddario; Cathleen Liberty, Director; Ginny McNeil, Health Agent; Alicia Sullivan; Public Health Nurse, Kerry MacKay, Health Agent Guests: In person: Steve Sherlock CALL TO ORDER: ► Chair Mu-Chow called the meeting to order at 5:00 pm. CITIZENS COMMENTS: ►None APPROVAL OF MINUTES: ►March 4, 2026 ►MOTION to Approve the March 4, 2026 meeting minutes Harris. SECOND by Daddario. No discussion. ►ROLL CALL VOTE: Mu-Chow-YES; Daddario-YES►Jeff Harris-YES VOTE: Yes-3, No-0-Abstain 0 APPROVAL OF MINUTES: ►March 18, 2026 ►MOTION to Approve the March 18, 2026 meeting minutes Harris. SECOND by Daddario. No discussion. ►ROLL CALL VOTE: Mu-Chow-YES; Daddario-YES►Jeff Harris-YES VOTE: Yes-3, No-0-Abstain 0 NEW BUSINESS Public health advisory at Chilson Beach notice Director Liberty noted that the Department of Environmental Protection recommended posting an advisory notice at Chilson Beach to not eat the fish caught from Chilson beach due to the amount of PFAS that has contaminated the water. Novel intoxicating products or substances regulation discussion There was much discussion thereof regarding the draft regulations. The board recommended adding more language to the definition of the Business Agent to include adult smoke shops and tobacco retail stores. They also recommended changing the fines to $300, $500 for second offense, $750 [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 1, 2026

Town Council

Town Council to move four zoning bylaw amendments to a second reading

The Franklin Town Council will hold a public hearing and first reading on four zoning bylaw amendments (26-946, 26-947, 26-948, 26-949) and vote to move each to a second reading. The agenda also includes a FY27 budget release and archive presentation by the Town Administrator. No other items are scheduled for approval or appointment at this meeting.

zoningbylawspublic-hearingbudgettown-council
✓ Decidido: Franklin Town Council held meeting regarding upcoming budget hearings and community events

The Town Council meeting focused on announcements regarding upcoming Finance Committee budget hearings and local community events. No substantive legislative or policy decisions were made during this session.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet April 1, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #854 3879 0109 & Link: https://us02web.zoom.us/j/85438790109 ➢ Any participants who wish to speak , must enter their full name and address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon Channel 29. This meeting ma [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING April 1, 2026 A meeting of the Town Council was held on Wednesday, April 1, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Michael LeBlanc, Stephen Malloy, Max Morrongiello (via Zoom), Kenneth Ojukwu. Councilors absent: Jane Callaway-Tripp. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Mark Cerel, Town Attorney; Julie McCann, Operations Manager. Note: Documents for the Town Council are on file and provided in the online meeting packet. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:00 PM. He called for a moment of silence. All recited the Pledge of Allegiance. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number on the agenda. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided on the agenda. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube ch [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 31, 2026

Massachusetts Strategic Health Group

Mass. Strategic Health Group considers admitting Dudley and Charlton, terminating two contracts

The Massachusetts Strategic Health Group will hold a board meeting on March 31, 2026, to vote on hiring a new treasurer, discuss monthly financial reports and FY '27 renewals, and consider terminating the Swift MD and CANARx contracts for FY '27. The board will also review petitions from the Towns of Dudley and Charlton for admission to the group.

health-insuranceself-insurancemunicipalcontractsadmissionstreasurerfinance
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
MASSACHUSETTS Strategic Health GroupAbington MedwaySEBRSD DCRSDMURSD Templton Franklin NorthbridgeValley TrustGrafton NRSDWebster Massachusetts Strategic Health GroupBoard MeetingTuesday, March 31, 2026, at 1:00 PMMedway Town Hall155 Village Street, Medway MA 02053Join the meeting nowMeeting ID: 228 670 311 254 13Passcode: dL6ns97d1.Attendance2.Acceptance of minutes of Feb. 24, 20263.Monthly financial report and discussion of FY ’27 renewals – Ken Lombardi4.Vote to authorize the Chair and Vice-Chair to hire a new Treasurer and neogitate a contract consistent with the current contract.5.Status Reportsa. Regional JPA’s – Kevin Paicosb. Member/Withdrawn Member FY ’25 defict payments – Kevin Paicos6.Discussion regarding 1-month payment of Employer Working Rates – Steve Lamarche7.Review of Mass. Division of Local Services requirements regarding reporting of self-insurance trust fund deficits – Kevin Paicos8.Consideration of terminating Swift MD contract for FY ’27 – Eric Avrumson9.Consideration of terminating CANARx contract for FY ’27 – Eric Avrumson10.Petition for admitance to MSHG from the Town of Dudley and Town of Charlton – Ken Lombardi11.Set next Mtg. Date
Tue Mar 31, 2026

Design Review Commission

Design Review Commission discusses updating design guidelines and bylaw amendments

The Design Review Commission will discuss updating design guidelines and potential future bylaw amendments. This is a discussion item; no decisions are expected at this meeting. Public comment will be accepted.

design-reviewdesign-guidelinesbylaw-amendmentspublic-commentfranklin-ma
✓ Decidido: Commission discusses updating design guidelines and sign bylaws

The Design Review Commission held a special session to discuss potential updates to town design guidelines and sign bylaws. The discussion focused on reducing ambiguity regarding signage, defining 'New England character,' and improving the streamlining of the review process.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams, Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda March 31, 2026 In-Person & Virtual Meeting 355 East Central Street - 2nd Floor, Council Chambers 7pm To all residents- this meeting is available to be attended in person at the 2nd Floor Council Chambers of the Town of Franklin Municipal Building or via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. When: Mar 31, 2026 07:00 PM Eastern Time (US and Canada) Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/84952072392 Phone one-tap: (301)715-8592, 8495-207-2392# 1. Discussion Item a. Discussion on design guidelines update and goals for potential future bylaw amendments. 2. Public Comment
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4907 Fax: (508) 520-4906 1 Town of Franklin Design Review Commission Tuesday, March 31, 2026 Meeting Minutes Chair Sam Williams called the above- captioned meeting to order this date at 7:05 PM, as an in-person and virtual meeting, 355 East Central Street, 2nd Floor, Council Chambers. This meeting was recorded. The following is stated on the agenda: To all residents- this meeting is available to be attended in person at the 2nd Floor Council Chambers of the Town of Franklin Municipal Building or via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. Members in attendance: Chair Sam Williams, Vice Chair Andrew Pratt, Derek Darvish. Members absent: Kyle Galvin, Associate Priya Natarajan, Associate James Bartro. Also present: Morena Zelaya, Director of Planning & Community Development. Discussion Item: a. Discussion on design guidelines update and goals for potential future bylaw amendments. Chair Williams welcomed everyone to a special session of the Franklin Design Review Commission. He reviewed that on the agenda tonight is a discussion of the design review guidelines and bylaws, and th [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 31, 2026

Massachusetts Strategic Health Group

Vote to authorize hiring a new Treasurer and negotiate contract

The Massachusetts Strategic Health Group board will vote to authorize the Chair and Vice-Chair to hire a new Treasurer and negotiate a contract consistent with the current one. The board will also discuss the monthly financial report and FY ’27 renewals, consider terminating contracts with Swift MD and CANARx for FY ’27, and review a petition for admission from the Towns of Dudley and Charlton. Status reports on regional JPAs and member deficit payments will be presented.

healthinsurancemunicipalbudgetcontractstreasurermassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
MASSACHUSETTS Strategic Health GroupAbington MedwaySEBRSD DCRSDMURSD Templton Franklin NorthbridgeValley TrustGrafton NRSDWebster Massachusetts Strategic Health GroupBoard MeetingTuesday, March 31, 2026, at 1:00 PMMedway Town Hall155 Village Street, Medway MA 02053Join the meeting nowMeeting ID: 228 670 311 254 13Passcode: dL6ns97d1.Attendance2.Acceptance of minutes of Feb. 24, 20263.Monthly financial report and discussion of FY ’27 renewals – Ken Lombardi4.Vote to authorize the Chair and Vice-Chair to hire a new Treasurer and neogitate a contract consistent with the current contract.5.Status Reportsa. Regional JPA’s – Kevin Paicosb. Member/Withdrawn Member FY ’25 defict payments – Kevin Paicos6.Discussion regarding 1-month payment of Employer Working Rates – Steve Lamarche7.Review of Mass. Division of Local Services requirements regarding reporting of self-insurance trust fund deficits – Kevin Paicos8.Consideration of terminating Swift MD contract for FY ’27 – Eric Avrumson9.Consideration of terminating CANARx contract for FY ’27 – Eric Avrumson10.Petition for admitance to MSHG from the Town of Dudley and Town of Charlton – Ken Lombardi11.Set next Mtg. Date
Mon Mar 30, 2026

Board of Assessors

Board of Assessors to discuss tax abatements and exemptions

The Board of Assessors will meet to approve minutes and discuss motor vehicle, personal property, and real estate tax abatements, exemptions, and appeals. The meeting will also include an executive session to discuss confidential matters.

taxassessorsabatementsexemptionsexecutive-session
✓ Decidido: Franklin Board of Assessors approves various tax abatements and exemptions

The Board of Assessors approved several real estate abatements, exemptions, and tax deferrals. The board also signed the Motor Vehicle Excise tax Warrant for Commitment 2 of 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF ASSESSORS MEETING AT FRANKLIN MUNICIPAL BUILDING, ROOM 106, 355 EAST CENTRAL STREET, FRANKLIN, MASSACHUSETTS MONDAY, MARCH 30, 2026 AT 8:30 AM AGENDA The following is a list of matters reasonably anticipated by the Chair that may be discussed. Not all items may be discussed and other related items not listed may be raised for discussion to the extent permitted under Massachusetts General Law. A. APPROVAL OF MINUTES: Regular & Executive Sessions B. ADMINISTRATION, OLD BUSINESS AND NEW BUSINESS (any matters not otherwise in a specific category below). C. MOTOR VEHICLE EXCISE 1. MV Excise Tax Abatement Denials. 2. MV Monthly Letters. D. PERSONAL PROPERTY 1. PP abatements. 2. PP Monthly Letters. E. BOAT EXCISE F. REAL ESTATE 1. RE Abatements, Exemptions & ATB Appeals. 2. RE Monthly Letters. G. EXECUTIVE SESSION 1. I move that the Board vote to go into Executive Session under Purpose 7 to discuss and vote on matters that are confidential in accordance with law, such as, but not limited to abatements and exemptions (MGL Ch. 59, Sec. 60), or property income & expense disclosures (MGL Ch. 59, Sec 52B). Following Executive Session, the Board will return to Open Session.
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
MINUTES OF THE BOARD OF ASSESSORS MEETING - MARCH 30, 2026 THE BOARD OF ASSESSORS MET AT THE FRANKLIN MUNICIPAL BUILDING, ROOM 106, 355 EAST CENTRAL STREET, FRANKLIN, MASSACHUSETTS ON MONDAY, MARCH 30, 2026 AT 8:30 АM. MEMBERS: CHRIS FEELEY, CHAIRMAN - present DAN BALLINGER, CLERK - present CHERYL HANLY, MEMBER - present STAFF: KEVIN W. DOYLE, DIRECTOR OF ASSESSING - present A. APPROVAL OF MINUTES -- Minutes of the Regular & Executive Sessions were not available.B. ADMINISTRATION: OLD BUSINESS & NEW BUSINESS С. МОТOR VEHICLE EXCISE 1. Motor Vehicle Excise tax Warrant for Commitment 2 of 2026 signed. D. PERSONAL PROPERTY PP Abatements were approved: 105 E. BOAT EXCISE PropertyConstitution #122850 Dell Mrktng#115120 F. REAL ESTATE RE Chapterland were approved: Property Owner DelleaFisher-Garcia RE Exemptions were denied: Property 5 Downingwood Dr 35 East Park St 90 Highwood Dr 25 Innsbruck Way 127 King St, U-206 144 King St 35 Longobardi Dr 3 Sandy Ln 5 Shepard Rd 132 Summer St 860 Upper Union St RE Exemptions were approved: Property 67 Alpine Pl 8 Bogastow Brook Ln 12 Colella Dr 402 Coronation Dr 299 Country Way 217 Crossfield Rd 235 Irondequoit Rd 417 Lincoln St 123 Longhill Rd 420 Maple St 25 Mount St 149 Pond St 129 School St 24 Spruce Pond Rd 571 Washington St 270 West Central St RE Tax Deferrals [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026

Library Board of Directors

Library board to discuss strategic plan, survey, and rental policy

The Franklin Public Library Board will hear a Summer Reading overview, discuss strategic planning including preliminary patron satisfaction survey results and staff vision statements, and consider a draft policy on property rental, commercial photography, and filming. The Library Director will report FY27 Budget Hearing dates.

librarystrategic-planningbudgetpoliciesprogramspublic-comment
✓ Decidido: Library Board approves March minutes and discusses future strategic planning

The Board approved the minutes from the March 2nd meeting. Discussions included potential library kiosks at MBTA stations and a draft facility rentals policy for future review. The Library Director reported that patron survey results will be used to develop a strategic plan.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors Meeting March 30, 2026 7:00 PM Meeting Room Agenda 1. Call to Order 2. Public Comment Patrons are welcome to express their views for up to three minutes on a matter that is not on the agenda but relates to library concerns. The Board will not engage in a dialogue or comment on a matter raised during public comments. The Library Board will give remarks appropriate consideration and may ask the Library Director to review the matter. 3. Summer Reading overview – Youth Services Librarian 4. Approval of Minutes 5. Report of Board members • Discussion o Strategic planning ▪ Patron satisfaction survey – preliminary results ▪ Staff vision and value statements o Draft - Property rental, Commercial photography, & filming policy 6. Library Director’s Report o FY27 Budget Hearing dates 7. Agenda items for next meeting. April 27, 2026 8. Adjourn
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors Meeting Minutes March 30, 2026 Present: Charleen Belcher, Kathleen Gerwatowski, Amanda Rabbitt, Barbara Steele and Alison Wallace of the Board, Youth Services Librarian Caleigh Keating, and Library Director Felicia Oti. Call to Order: Charleen called the meeting at 7:02 p.m. Public Comment: Letha Heminway and Liz Pungitore of the Friends of Franklin Library joined the meeting. Caleigh Keating: This year, for the very first time, Caleigh was invited to the literacy specialist program meetings. There are six literacy specialists in the Franklin Public Schools. Caleigh will oversee the book selection for the summer reading program. A summer reading flyer with participation instructions will go home with summer learning folders. Everything will be integrated with the schools. Incoming kindergartners will receive a folder inviting them to participate. Caleigh is also working with the high school librarian to encourage summer reading since typically this initiative ends after middle school. Minutes: The minutes of the March 2nd meeting were approved. Report of the Board Members: Amanda: Amanda shared a photo of a library kiosk in Worcester. She wondered if a kiosk might be a good option for Franklin’s two MBTA stations. Felicia will investigate the costs of kiosks, which need to be protected from the elements and have a power source. However, she warned that the maintenance can be harrowing. Library Director’s Report: Felic [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026

Agricultural Commission

Agricultural Commission to finalize Earth Day event plans and review large-landowner meeting

The Franklin Agricultural Commission will meet online to approve minutes from February and March meetings, then discuss updates on the upcoming Earth Day event, a meeting for owners of 5+ acres, the commission's brochure, farmer interviews, and a debrief on a prior meeting. All items are for discussion or update; no votes on new ordinances or expenditures are listed.

agricultureearth-dayeventslandownersoutreachplanning
✓ Decidido: Commission approves postcard mailing and shifts to digital farm information

The Commission approved $71.00 for informational postcards for potential Chapter land owners following a canceled event. Members also decided to use a QR code instead of printing paper brochures for farm information.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 3/30/2026 7:00pm A NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded. ZOOM MEETING DETAILS: Topic: Ag Com Time: Mar 30, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/89770215229 Meeting ID: 897 7021 5229 One tap mobile +16469313860,,89770215229# US +13017158592,,89770215229# US (Washington DC) Join instructions https://us02web.zoom.us/meetings/85028019368/invitations?signature=dr0_ET_XkXiGGxUeEuDG6Me AnWH5jqHkI7mE-fcJRas Participants will be automatically muted upon entry but can un-mute themselves by pressing*6 Participants joining by phone will be able to listen to the meeting and speak when l. Approval of the minutes - from February 26, 2026 meeting and from the 3/5/26 meeting with the Town Administrator ll. Old Business: A. Earth Day Event-Update and finalize our plans. B. Meeting for Owners of 5+ Acres of Land in Franklin- Update. C. Ag Commission Brochure Status- Update D. Franklin Farmer Interviews- Updates. E. Debrief on 3/5/26 Meeting- Respectfully Submitted, Marian Szymanski
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Agricultural Committee Meeting March Minutes - March 30, 2026 In Attendance: Marian Szymanski, CJ Koshivas, Benjamin Rousseau, and Matt Stolz- Call to Order: The Meeting was called to order at 7:03 PM by Marian Szymanski Acceptance of the Minutes: The Minutes from our February 2026 Meeting and from our 3/5/26 meeting with Jamie H. were unanimously accepted. Old Business: A. Earth Day April 18th 2026 Event: The Agricultural Commission will partner with Fairmount Farm and the Conservation Commission for this event. The Con Com will have an information table and will lead tours of local conservation land. Over 15 farms and local makers will have tables for an Earth Day Farmer’s Market. There will be 4 activity stations where families can create bee hotels and bird feeders, conduct soil experiments, and plant an assortment of flowers and vegetables. B. Event For 5+ Acre Property Owners: The Agricultural Commission was hoping to host an informational event on April 22, from 7 to 9, in the Municipal Building’s Council Chambers. Unfortunately, scheduling conflicts made this impossible, so the Commission has pivoted and will now be sending informational postcards to all potential Chapter land owners. The Commission unanimously voted to spend $71.00 for this action. C. Ag Commission Brochure: The Commission voted to not print and distribute paper brochures. Instead, a QR code will be created and posted so that residents can find images and information about each [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026

School Committee

Discussion of Kick‑off Event for Horace Mann Legacy Sub‑Committee

The Franklin School Committee Horace Mann Legacy Sub‑Committee will meet on March 30, 2026 at 7:00 PM in the Municipal Building’s 3rd‑floor training room and via Zoom. The agenda lists a call to order, a discussion of a kick‑off event, a breakout session, and a report‑out. Items not listed may also be discussed as permitted by law.

educationschool-committeeeventsmeeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee March 30, 2026 7:00 PM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89540323712?pwd=HdHyE5KRjoR6zeTpbfUxPsaMB06e94.1 Passcode:679883 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Call to Order ● Discussion of Kick-off Event ● Breakout Session ● Report Out
Thu Mar 26, 2026

Franklin's 250th Anniversary Celebration Committee

250th Anniversary Committee to hear from Sharon, Easton celebration leaders

The committee will discuss subcommittee reports on communications (logo draft and community engagement strategy), events, and budget/fundraising. Guest speakers from Sharon and Easton will share insights from their town celebrations. The chair also announced a check disbursed to Lake Pearl on March 13 and a future presentation to the Town Council on June 24.

committeecelebration250th-anniversarycommunity-engagementbudgetevents
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda March 26, 2026 | 7:00 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. ZOOM DETAILS: Meeting ID: 974 0008 8938 | Passcode: 352554 https://zoom.us/meetings/97400088938/invitations?signature=M-dELBC0qucQAF9eYII6Uas5aQFZjV78QFRKgdcReVM ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair a. Check disbursed to Lake Pearl on 3/13 b. Dept head meeting on 4/1 c. Presenting to Town Council on 6/24 d. Norms & values document & meeting time policy in April meeting 2. Approval of minutes a. March 3, 2026 (Special) b. February 26, 2026 3. Approval of subcommittee members 4. Subcommittee Reports a. Communication i. Logo draft presentation ii. Future community engagement strategy draft b. Events c. Budget/Fundraising 5. Guest Speaker(s) a. Dave Clifton, chair of both Sharon 250 and Easton 300 celebrations b. Dale Kerester, vice chair of Easton 300 celebration 6. Future agenda items & Member comments 7. Adjourn
Thu Mar 26, 2026

Conservation

Conservation Commission to review projects at Symphony Drive, Partridge Street, and Maple Street

The Conservation Commission is meeting to review documentation and reports for three specific properties. The agenda includes peer review responses and stormwater plans for residential developments and a permit modification.

conservationstormwaterpermitsland-use
✓ Decidido: Franklin Conservation Commission approved a wetland permit for 670 King Street

The Franklin Town Conservation Commission approved a Notice of Intent for pool drainage at 670 King Street, attaching standard special conditions for safe water discharge. The commission also continued three other wetland-related applications to April 9, 2026, pending further review or applicant revisions. All four actions passed on unanimous 7-0-0 roll call votes.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Conservation Commission Agenda 3-26-2026 CONSERVATION AGENDA.PDF Symphony Drive - Tanglewood Estates II 25-0108 CORRESPONDENCE - PEER REVIEW 2 RESPONSE 20260318.PDF 25-0108C 20260318.PDF 47 Partridge Street - Donovan Estates DONOVAN_ESTATES_STORMWATER_REPORT_REV2-EMAIL.PDF DONOVAN_ESTATES_WATERSHED_PLANS_REV2-EMAIL.PDF DONOVAN_ESTATES_STORMWATER_FACILITIES_PLAN_REV2-EMAIL.PDF DONOVAN_ESTATES_SUBDIVISIONS_PLAN_REV2-EMAIL.PDF 160 Maple Street - Permit Modification 160 MAPLE STREET - TEMP ROAD OVERVIEW.PDF 1. 7:00 P.M. Documents: 2. Documents: 3. Documents: 4. Documents:
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Conservation Commission March 26, 2026 Meeting Minutes As stated on the agenda, this meeting is available to be attended in person and via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or citizens can participate by using the Zoom link provided on the agenda. This meeting will be held in the Town Council Chambers on the Second Floor of the Municipal Building for citizens wishing to attend in person. Commencement Chair Mark LePage called the above-captioned meeting to order this date at 7:00 PM as a remote/virtual/in-person meeting. Members in attendance: Mark LePage, Lui Puga, Michael Rein, Richard Johnson, Roger Trahan, Nicole Chiaramonte (via Zoom), Matthew Stoltz (via Zoom). Absent: None. Also present: Breeka Li Goodlander, Director of Conservation (via Zoom); Tyler Paslaski, Administrative Staff. Note: Documents presented to the Conservation Commission are on file. SCHEDULING None. PUBLIC HEARINGS Public Hearing – NOI – Nicholas Drive/Prospect Street Culvert Repair Chair LePage said there was a request for a continuance. There was a motion made by Roger Trahan to continue the NOI for Nicholas Drive/Prospect [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 25, 2026

Council on Aging

Franklin Council on Aging to discuss 2027 budget narrative

The Council on Aging will meet to review the 2027 budget narrative and upcoming town meetings. The body will also discuss the Older Adult Lobby Day scheduled for May 6, 2026.

budgetseniorstown-meetingspolicy
✓ Decidido: Council on Aging approves February minutes and reviews center updates

The Council approved the amended minutes from the February 25, 2026 meeting. The Director reported on gym equipment installation, upcoming professional development closures, and a denied MCOA grant.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Council on Aging Meeting Agenda March 25, 2026 11:00 AM Meeting will be held at the Franklin Senior Center 10 Daniel McCahill Street, Franklin, MA 02038 1. Call to order; 11:00 AM 2. Minutes of last meeting 3. Citizen’s Comments 4. Correspondence 5. Director’s Report 6. Chairman’s Comments 7. FOFE Liaison Report 8. Old Business ● Board Picture ● Older Adult Lobby Day: Wednesday May 6, 2026 11:30AM to 2:00PM 9. New Business ● 2027 Budget Narrative ● Review upcoming town meetings ○ 3/27/26 TA files Budget per Town Charter ○ Health Insurance numbers more final end of May 10. Committee Reports ● Budget Committee ● Bylaw Committee ○ Review finalized Senior Center Policies & Procedures ○ Updating COA Binder ● Expo Committee ○ Schedule April Meeting ● Housing Committee ○ Housing Director, Nayda Sanchez DeJesus, attending April Mtg ● Nominating Committee ● Program Committee ● Supportive Day Committee 11. Comments 12. Agenda for Next Meeting 13. Adjournment Next Meeting: April 22, 2026 11:00AM
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Council on Aging Minutes March 25, 2026 Franklin Senior Center Members Present: Lyn O’Brien (Chair), Phyllis Malcolm (Vice Chair), Faith Flaherty (Secretary), Kit Brady, Beth Sawyer, Kim Muchow, Roberta Trahan, Tina Powderly, and Jim Lane. Also Present: Sarah Amaral (Director), Chasity Cheng, (Deputy Director), and Mr. Mark Dempsey-Coordinator of The Metro West Center for Independent Living. Called to Order: 11:03 AM Minutes of February 25, 2026 Amendments: date of the Minutes to Feb. 25 ● Spelling of Chasity’s name, ● Updates had a change from MCOA board to committee and the offerings at Mclean should be trainings. ● Chairperson’s Comments had two: 1.Sunshine funding sought from towns whose residents participate. 2. Discussion regarding Meals on Wheels using the Senior Center. Approved Motion: Kim Mu-Chow Second: Roberta Trahan Approved Citizen’s Comments: Mr. Mark Dempsey, the Coordinator of Independent Living, Metro West Center for Independent Living, Framingham, MA, introduced himself and his organization. He advocates for persons with disabilities. The Center offers services to help transition people with disabilities into independent living. Franklin is one of the communities the MWCIL services. Correspondence: The Senior Center has received another donation from Robert Catalano Estate, which we appreciate. There may be one more donation coming. Director’s Report: Updates: ● Gym equipment has bee [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 25, 2026

Franklin's 250th Anniversary Celebration Committee

Subcommittee discusses 250th anniversary events including parade, galas

The Events & Logistics Subcommittee of Franklin's 250th Anniversary Celebration Committee will discuss and receive updates on planned events such as the anniversary bell ringing, interfaith gathering, library event, donor event, opening and closing galas, parade in September 2028, golf tournament in June 2028, and a family fun day. The meeting will also cover community member involvement and future meeting cadence. No votes or decisions are scheduled; the agenda is purely for discussion and planning.

anniversaryeventsparadegalacommunity
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Events & Logistics Agenda March 25, 2026 7:30 pm Meeting will be held at the Franklin Municipal Building-3rd Floor Training Room 355 East Central Street with Hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM WEBINAR DETAILS: https://us05web.zoom.us/j/84599434661?pwd=es8Dklx1NpA69Rkcr7QMyjU0zozwUH.1) ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Call to order: Sub Committee chair Roberta Trahan called the meeting to order 2. Review and approve the minutes from our February 25, 2026 Meeting 3. Discussion of events/reports from Sub Committee Members: a. Anniversary Bell Ringing b. Interfaith gathering c. Library event d. Donor Event/Party e. Opening Gala f. Parade: 9/16/2028 g. Discussion of Parade Marshalls h. Golf Tournament: June 2028 i. Family Fun Day/Picnic: ? July/August 2028 j. Closing Gala: November 4, 2028 4. Discussion of Community Member involvement to lead/assist with events 5. Discussion of meeting cadence 1. ADJOURN
Wed Mar 25, 2026

Historical Commission

Historical Commission to discuss May Appraisal Day event

The Franklin Historical Commission meets virtually to discuss planning for the May Appraisal Day event. No votes or decisions are scheduled; the agenda consists solely of this discussion item.

historical-commissionevent-planningappraisal-dayfranklin
✓ Decidido: Commission voted to run May Antiques Appraisal event without Friends

The Historical Commission formally recorded its intent to run the May Antiques Appraisal event entirely as a Commission activity, excluding the Friends group. The motion was made, seconded, and approved unanimously in a roll‑call vote. The meeting then adjourned unanimously.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Virtual Meeting Agenda, Weds., Mar. 25, 2026, 6:00 pm Meeting via Zoom: https://us05web.zoom.us/j/87286928033?pwd=4mCyR55KRPj3N5tQPA8Wttbp6azmoH.1 Meeting ID 872 8692 8033 Passcode a2983v CALL TO ORDER NEW BUSINESS Discuss May Appraisal Day Event ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Virtual Meeting Minutes, Weds., Mar. 25, 2026, 6:00 pm Meeting via Zoom: CALL TO ORDER -- 6 PM Attendees included Alan Earls, Scott Mason, Brandon Carrico, Phyllis Malcolm, with WIll Lee and Randy LaRosa Joining after a few minutes NEW BUSINESS Discuss May Appraisal Day Event The chair noted that at the regular March meeting, the Commission had expressed its wish to run the May Antiques Appraisal event in its entirety. He noted that this decision had upset the friends and that the meeting was called to make sure he understood the intent of the Commission and to record that intention as a formal vote. The brief discussion led to expression by each member of a strong preference to run the event as a Commission activity. This was emboded in a Motion to "Have the Commission take full responsibility for running the May Appraisal event and not include the Friends in the operation." This was made, seconded, and approved unanimously in a roll call vote. ADJOURN The chair then asked for a motion to adjoun, which was duly seconded and voted unanimously. The meeting adjourned at 6:05
Tue Mar 24, 2026

School Committee

School budget subcommittee reviews FY27 spending plan

The Franklin School Committee Budget Subcommittee will hold a check-in on the FY27 budget, discussing questions and next steps. This is a discussion session, not a final vote, to refine the budget proposal before full committee consideration.

budgetschoolsfiscal-year
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Budget Subcommittee Meeting March 24, 2026 6:00 PM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/81919833332?pwd=57bJGT94wdDxueboblzuI0aFF2nl96.1 Passcode:597482 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." ● FY27 Budget check-in, questions, and next steps
Tue Mar 24, 2026

School Committee

School Committee to vote on Student Opportunities Act Plan

The Franklin School Committee will meet to vote on the Student Opportunities Act Plan and the endorsement of a Request for Statement of Interest for a Strategic Plan. The meeting includes a presentation on Lifelong Learning and the acceptance of several donations.

educationstrategic-planningstudent-servicesdonations
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee March 24, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/81639433910?pwd=kBbZRVPsGvrzk7MtcWfI5eUQyLjayy.1 Passcode:961894 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 360 209 5623 US +1 386 347 50 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 23, 2026

Legal Notices

Town Council to consider zoning by-law amendments

The Franklin Town Council will hold a public hearing on April 1, 2026, to consider amending Chapter 185 of the Town Code. The proposed changes affect use regulations and lot dimensions across various residential and commercial districts.

zoningtown-councilpublic-hearingland-useby-law-amendmentsfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, March 23, 2026 at 7:00 PM , and the Franklin Town Council will hold a public hearing on Wednesday, April 1, 2026 at 6:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, to consider amending Chapter 185 of the Code of the Town of Franklin. ZONING BY-LAW AMENDMENTS 26-946: Chapter 185 of the Code of the Town of Franklin is hereby amending §185, Attachment 7, Use Regulations Schedule Part VI. 26-947: Chapter 185 of the Code of the Town of Franklin is hereby amending §185, Attachment 9, Schedule of Lot, Area, Frontage, Yard and Height Requirements. 26-948: Chapter 185 of the Code of the Town of Franklin is hereby amending §185, Use Regulation Schedule Attachment 2- Use Regulations Schedule Part I, Attachment 3- Use Regulations Schedule Part II, Attachment 4- Use Regulations Schedule Part III, Attachment 7- Use Regulations Schedule Part VI, and Attachment 8- Use Regulations Schedule Part VII 26-949: Chapter 185 of the Code of the Town of Franklin is hereby amending §185, Attachment 9 Schedule of Lot, Area, Frontage, Yard and Height Requirements The exact wording and detail of the proposed By-Law amendments, including additions and deletions to §185, as well as the updated Schedule documents, [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 23, 2026

Planning Board

Planning Board to hold hearings on zoning amendments and three subdivisions

The Planning Board will conduct public hearings regarding four zoning bylaw amendments. The board will also review three definitive subdivision applications for residential estates.

zoningsubdivisionsland-usepublic-hearings
✓ Decidido: Planning Board recommended four zoning bylaw amendments to Town Council

The board voted unanimously to continue three subdivision applications—70 Daniels Street, 47 Partridge Street, and Symphony Drive—until April 6, 2026. It also closed the four zoning bylaw amendments (26‑946, 26‑947, 26‑948, 26‑949) and recommended each amendment to the Town Council, with votes of 5‑0 except amendment 26‑948 which passed 4‑0‑1 (abstain). The meeting was adjourned at 7:54 PM.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet March 23, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/84857387288 or call on your phone at 312- 626-6799, meeting #84857387288. PUBLIC HEARINGS 1. Zoning Bylaw Amendments 26-946, 947, 948 and 949 2. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision 3. 47 Partridge Street (Donovan Estates) – Definitive Subdivision 4. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision TO BE CONTINUED GENERAL BUSINESS: This agenda is subject to change. The next meeting of the Planning Board is scheduled for April 6, 2026. Notice: The Franklin Planning Department has been made aware of fraudulent emails impersonating Town departments and requesting payment via wire transfer. The Planning Department will never request payment by wire transfer. All applicant fees must be paid by check and mailed or delivered to the Franklin Municipal Building. If you receive a suspicious email or are unsure if a request is legitimate, please contact the Department at 508-520-4907 to verify any outstanding fees related to [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board March 23, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, 2nd floor, Council Chambers, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk; Mark Mucciarone (via Zoom); Eric Steltzer; William Lee, associate member. Members absent: None. Also present: Morena Zelaya, Director of Planning and Community Development; Amy Love, Town Planner. Note: Documents presented to the Planning Board are on file. PUBLIC HEARINGS 1. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision Ms. Love said they requested to be continued to April 6, 2026. Motion to Continue 70 Daniels Street (Grillo Estates), Private Definitive Subdivision, to April 6, 2026. Rondeau. Second: Mello. Roll Call Vote: Rondeau-YES; Mello-Yes; Stickney-YES; Mucciarone-YES; Steltzer-YES. Vote: 5-0 (5-Yes; 0-No). 2. 47 Partridge Street (Donovan Estates) – Definitive Subdivision Ms. Love said she received an email today requesting this to be continued to April 6, 2026. She said the decision deadline was March 31. The applicant put it in writing that they gave the Planning Board until April 31. Motion to Continue 47 [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Mar 20, 2026

Charles River Pollution Control District (CRPCD)

Board will vote on the FY 2027 budget for the Charles River Pollution Control District

The board will approve the meeting warrant, which includes $300,043.82 for operations and $33,556.00 for capital projects. They will discuss and vote on the FY 2025 audit and the FY 2027 budget, and approve the fourth‑quarter operating and capital assessments totaling $949,950. Additional updates will cover the 2025 NPDES permit appeal, copper at the treatment plant, and the I‑495 pump station force main Phase 2 design.

budgetauditpermitsoperationscapitalwater-treatmentinfrastructure
✓ Decidido: District unanimously approves FY 2027 budget and key financial items

The Charles River Pollution Control District approved its FY 2027 budget, the FY 2025 audit, and the fourth‑quarter O&M and capital assessments for FY 2026. It also approved the meeting warrant, the minutes from the February 17, 2026 meeting, and the executive‑session minutes. All motions passed with unanimous votes.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING MARCH 20, 2026 at 3:00 P.M. CONFERENCE ROOM AGENDA 1. Approval of Warrant 26-09 a) O & M $ 300,043.82 b) Capital $ 33,556.00 2. Discussion and Vote on FY 2025 Audit with Renee Davis from CBIZ 3. Update on Town Flows for Calendar Year 2025 4. Discussion and Vote on FY 2027 Budget 5. Update on 2025 NPDES Permit Appeal 6. Approval of 4th Quarter O & M and Capital Projects Assessments for FY 2026 Town O & M Capital Total Bellingham $82,140 $2,140 $84,280 Franklin 519,820 33,660 553,480 Medway 190,490 7,540 198,030 Millis 109,200 4,960 114,160 Totals $901,650 $48,300 $949,950 7. Executive Director’s Report a) Sewer Connections (February 2026) - None b) NPDES Permit Compliance Report (February 2026) c) Update on Copper at the Treatment Plant d) Update on the I-495 Pump Station Force Main Phase 2 Design e) Update on New Heating Oil Tanks 8. Public Comment 9. Approval of Minutes from the February 17, 2026 Monthly Meeting and Executive Session Meeting 10. Anticipated Topics for the Thursday, April 9, 2026 Monthly Board Meeting at 3:00 pm a) None at this time
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
CHARLES RIVER POLLUTION CONTROL DISTRICT 66 Village Street, Medway, MA 02053 Minutes from March 20, 2026 Monthly Meeting - 3:00 p.m. The meeting was held in the John McCahill Conference Room at the District’s treatment facility. In attendance were Chairman David C. Formato, District Commissioners Ted Kenney, Douglas M. Downing, Wolfgang Bauer and Mark Cataldo, Executive Director Elizabeth Taglieri and Executive Secretary Barbara W. Maffeo. Also in attendance were Renee Davis from CBIZ, the District’s auditing firm and Ellen Rosenfeld representing the Town of Millis Select Board. Engineer Kristen Mucciarone was not in attendance. The following attachments were presented during the monthly meeting and are on file at the District with the approved minutes. e Year to Date O & M Budget versus Actual July 2025- February 2026); e O&M Budget Prior Year Comparison (July 2024 - February 2025 vs July 2025 - February 2026); e Septage Revenue Prior Year Comparison July 2024 - February 2025 vs July 2025 - February 2026); e Sewer connections (February 2026); e Overview of FY 2026 Spending dated March 20, 2026; e Copy of Credit Card Expenses Statement for Harbor One Credit Card—Elan Financial dated February 6, 2026 - March 5, 2026; e Handout reflecting CRPCD 2016-2025 Average Daily Flows & Capacity Remaining dated March 20, 2026; e Handout Draft FY 2025 CRPCD Audit; e Handout CRPCD FY 2027 Budget; e Copy of Draft February 17, 2026 Monthly Meeting Minutes and Draft Executive Session Meetin [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 19, 2026

School Committee

Franklin School Committee holds open office hours

The School Committee is holding an open office hours meeting. The agenda consists of procedural boilerplate and contains no specific items for decision or discussion.

educationschool-committeepublic-meeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee Open Office Hours Meeting March 19, 2026 5:00 - 7:00 PM Lincoln Street Elementary School A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." ● Call to Order ● Open Office Hours ● Adjournment
Thu Mar 19, 2026

Zoning Board of Appeals

No Zoning Board of Appeals meeting on March 19, 2026

The Zoning Board of Appeals meeting scheduled for March 19, 2026, has been cancelled. The next meeting is scheduled for April 2, 2026.

zoningprocedural
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING March 19, 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR April 2, 2026
Wed Mar 18, 2026

Board of Health

Board will discuss prohibiting the sale of mind‑altering products

The Franklin Board of Health will approve the meeting minutes, hear citizen comments, and discuss a proposal to prohibit the sale of mind‑altering products. No decisions are recorded yet; the item is listed under new business for discussion. The meeting also includes routine announcements and procedural items.

healthregulationpublic-hearingboard-meeting
✓ Decidido: Board approved drafting a regulation on mind‑altering products

The Board of Health voted 3‑0 to approve writing a draft regulation, modeled on North Hampton’s novel intoxicating products rule, to address sales of items like kratom and psychedelic mushroom candy bars. The draft will be reviewed at the next meeting, with an open public forum planned for May. No other substantive actions were taken.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet March 18, 2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room meet.google.com/mfx-ytbt-qto Join by phone (US) +1 502-610-3058 PIN: 534 818 480# A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. NEW BUSINESS a. Discuss prohibiting the sale of mind altering products PUBLIC HEARING REPORTS a. b. FUTURE AGENDA ITEMS [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
BOH MEETING MINUTES March 18, 2026 In attendance: Chair, Kim Mu-Chow; Vice Chair, Jeff Harris; Member, Diane Daddario; Cathleen Liberty, Director; Ginny McNeil, Health Agent; Alicia Sullivan; Public Health Nurse, Kerry MacKay, Health Agent Guests: In person: Steve Sherlock CALL TO ORDER: ► Chair Mu-Chow called the meeting to order at 5:00 pm. CITIZENS COMMENTS: ►None NEW BUSINESS Discuss prohibiting the sale of mind altering products Director Liberty noted that several tobacco retail stores are selling mind altering products such as Kratom and Psychedelic mushroom candy bars. These products are being sold as “natural” but we recently learned on a webinar that the mind altering products such as Kratom are a synthetic opioid that can be addictive and are packaged to attract youth. Director Liberty showed a power point depicting the issue of mind altering products' rise in sales and the impending public health crisis they are causing. The board had much discussion thereof as to what other towns and cities are doing to avert the crisis. ►MOTION to write a draft regulation based on North Hampton’s Novel intoxicating products regulation that the board can review at the next meeting so they can hold an open forum at the May meeting. MOTION by Mu-Chow. SECOND by Daddario. ►Discussion: Member Daddario noted that using Novel intoxicating products or substances to catch as many products now or in the future should be included in the regulation. [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 18, 2026

Town Council

Town Council will vote on a resolution to increase the local hotel excise tax.

The council will approve four resolutions covering a strategic‑plan request, support for the FY 2027 state budget, backing of a state arts‑education bill, and a request to raise the local hotel excise tax. They will also hear presentations from the Department of Elementary and Secondary Education and a school‑committee strategic planning request. Additionally, they will appoint new members to the Zoning Board of Appeals and approve recent meeting minutes.

zoningbudgeteducationtaxesappointmentslegislation
✓ Decidido: Town Council approves three sets of minutes and appoints a finance committee member

The Council approved the minutes from the January 21, February 4, and March 4, 2026 meetings, each with an 8‑yes, 0‑no vote and one absent member. They also ratified the appointment of Thomas Sullivan to serve on the Finance Committee through June 30, 2026, with the same vote tally.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet March 18, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #894 4938 1756 & Link: https://us02web.zoom.us/j/89449381756 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING March 18, 2026 A meeting of the Town Council was held on Wednesday, March 18, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Jane Callaway-Tripp, Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Stephen Malloy, Max Morrongiello, Kenneth Ojukwu. Councilors absent: Michael LeBlanc. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Mark Cerel, Town Attorney; Julie McCann, Operations Manager. Note: Documents for the Town Council are on file and provided in the online meeting packet. At 6:01 PM, School Committee Chair Paul Griffith called the School Committee meeting to order. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:00 PM. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number on the agenda. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided on the agenda. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 18, 2026

School Committee

School Committee to conduct Chapter 70 Review with DESE

The Franklin School Committee is holding a special meeting to discuss a Chapter 70 Review with the Department of Elementary and Secondary Education (DESE).

educationstate-fundingschool-committee
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee School Committee Special Meeting At Town Council Meeting Council Chambers March 18, 2026 6:00 - 8:00 PM A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." ● Chapter 70 Review with DESE
Tue Mar 17, 2026

Design Review Commission

Design Review Commission to discuss proposed developments

The Design Review Commission will hold a virtual meeting to discuss proposed developments at 110 East Central Street and 287 East Central Street, and review minutes from February 17, 2026.

design-reviewdevelopmentvirtual-meetingminutes
✓ Decidido: Design Review Commission unanimously approved vertical trim changes at 110 East Central St

The commission recommended the site‑plan and façade changes for 110 East Central Street, approving the vertical trim adjustment. It also approved the sign package for 287 East Central Street, accepted the February 17 minutes, and scheduled a March 31 meeting. All actions passed with a 4‑yes, 0‑no vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams, Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda March 17, 2026 Virtual Meeting 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: Mar 17, 2026 07:00 PM Eastern Time Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/83169604409 Phone one-tap: (305)224-1968 Meeting ID:831 6960 4409 1. New Business a. 110 East Central Street- Proposed Development b. 287 East Central Street- Stretch Med 2. Meeting Minutes a. February 17, 2026 3. New Business/Old Business
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4907 Fax: (508) 520-4906 1 Town of Franklin Design Review Commission Tuesday, March 17, 2026 Meeting Minutes Chair Sam Williams called the above- captioned meeting to order this date at 7:02 PM, as a remote access virtual Zoom meeting. This meeting was recorded. The following is stated on the agenda: Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided on the agenda. Members in attendance: Chair Sam Williams, Vice Chair Andrew Pratt, Derek Darvish, Associate Priya Natarajan. Members absent: Kyle Galvin, Associate James Bartro. Also present: Morena Zelaya, Director of Planning & Community Development. NEW BUSINESS: a. 110 East Central Street - Proposed Development Mr. Brad Chaffee, owner, said they came before the Commission about two years ago, and they just finished their full plans for construction. They wanted clarification on some of the vertical siding comers. Building Commissioner Gus Brown suggested going before the Commission to make sure they are okay with the changes as much as they are very minor. Mr. Chaffee explained that where the red lines are shown on the submitted plans which are available in the online meeting packet, they accentuated the vertical trim. It is about 10 in. opposed to 4 in. He said they added the trim to make it look less flat. He point [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026

Pole Petition Hearing

Public hearing on National Grid pole installation on Oak St.

The Franklin Town Administrator will hold a public hearing on March 17, 2026, to consider a pole petition from National Grid and Verizon. The proposal is to install a new joint pole on Oak Street, approximately 170 feet east of Donny Lane. No other business is on the agenda.

pole-petitionpublic-hearingutilitiesnational-gridverizon
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION HEARING AGENDA March 17, 2026 12:30 PM Pole Petition Hearing will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. Additionally, residents are also welcome to participate remotely via Zoom. ZOOM WEBINAR DETAILS: I D # 834 7414 5309 & Link: https://us02web.zoom.us/j/83474145309 Call-In Phone Number: 1-929-205-6099, enter Meeting ID then # ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Pole Petition Plan #31247141: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. OAK ST. National Grid proposes to install a new JO Pole (# P67-50) on Oak St. beginning approximately 170 ft. East of the centerline of the intersection of Oak St. and Donny Ln. at approximately (42°06’10”N 71°25’29W). Location approximately as shown on the plan attached. NOTICE TO ABUTTERS POLE PETITION PUBLIC HEARING Massachusetts Electric Company d/b/a National Grid & Verizon New Engla [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026

Legal Notices

Public hearing on National Grid pole installation on Oak St.

The Town Administrator will hold a public hearing on a pole petition submitted by Massachusetts Electric Company d/b/a National Grid (and Verizon New England) to install a new JO pole #P67-50 on Oak Street. The proposed pole would be placed about 170 ft east of the centerline of the Oak St. and Donny Ln. intersection. Residents may attend in person at the Municipal Building or join remotely via Zoom.

pole-petitionutilitiespublic-hearinginfrastructure
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION PUBLIC HEARING March 17, 2026, 12:30pm Pole Petition Plan # 31247141: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. OAK STREET National Grid proposes to install a new JO Pole (# P67-50) on Oak St. beginning approximately 170 ft. East of the centerline of the intersection of Oak St. and Donny Ln. at approximately (42°06’10”N 71°25’29W). In conformity with the requirements of Section 22 of Chapter 166 of the General Laws (Ter. Ed.) you are hereby notified that a Public Hearing will be held in the Training Room on the third floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Tuesday, March 17, 2026 at 12:30 p.m. upon the petition by Massachusetts Electric Company d/b/a National Grid regarding the Pole Petition described above. All citizens are welcome to attend public meetings in person. Additionally, in an effort to maximize citizen engagement opportunities, citizens will also be able to participate remotely via Zoom using the following login information: Zoom ID: 834 7414 5309 Link: https://us02web.zoom.us/j/83474145309 Call-In Phone Number: 1-929-205-6099, enter Meeting ID # 834 7414 5309, then press # For additional information call the Town Administrator’s Office at 508-520 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 16, 2026

Housing Authority

Board to approve $175k in accounts payable and write off $7,668 in rents

The Franklin Housing Authority Board will review financial reports, accounts payable, and a rent write-off. The board will also receive updates on a laundry room construction project and a training session.

housingfinanceaccounts-payableconstructiontraining
✓ Decidido: Approved $175,236.13 February 2026 accounts payable

The Franklin Housing Authority approved the February 9, 2026 meeting minutes and the February 2026 accounts payable totaling $175,236.13, as well as Capital One charges of $977.63. The board also accepted the Director of Facilities Report, the Director's Report, and the January 2026 operating statements. Write‑offs of $7,668.66 were approved, and board members will attend the April 15 Governor Healey meet‑and‑greet.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing AuthorityPeter L. Brunelli Community Center 1000 Central Park TerraceFranklin, MA 02038Regular Meeting of the Board of CommissionersMarch 16, 20264:30 PMAGENDAChairman requests all cell phones to be silencedRoll Call MinutesMinutes of the Regular Meeting February 9, 2026Accounts PayableAccounts Payable for February 2026 -- $175,236.13Capital One Charges for February 2026 -- $977.63Director of Facilities ReportDirector Report Operating Statements – January 2026Community Preservation Committee (CPC) Update – Commissioner Feeley CorrespondenceThank you, card -- Tri-ValleyGood job, note -- TenantThank you, card – StaffThank you, card – Nayda and BrianNorfolk HA Update – Managing AgencyLaundry Room/Office Project construction, laundry room 100% complete, office almost complete. Norfolk delinquency Old BusinessNoneNew BusinessCommissioner’s Training ReportApril 15 – Governor Healey Write-Off Rents --- $7,668.66Adjournment
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Housing Authority Peter L. Brunelli Community Center Regular Meeting Minutes March 16, 2026 The Regular Meeting of the Franklin Housing Authority took place at the Peter L. Brunelli Community Center located on Central Park Terrace, Chairman George A. Danello called the meeting to order at 4:30 PM. * ROLLCALL Members Present Members Absent George A. Danello, Chairman Christopher K. Feeley, Vice Chairman Andrew M. Kepple, State Appointee Christopher Lennon, Tenant Board Member Jennifer Knight-Levine, Commissioner © Others Present Nayda Sanchez DeJesus, Executive Director Brian Drainville, Director of Facilities Candice Day, Administrative Assistant © MINUTES Motion is made by Commissioner Kepple, second by Commissioner Lennon to approve the Minutes of the Regular Meeting of February 9, 2026. All in favor. So voted. © ACCOUNTS PAYABLE Motion is made by Commissioner Kepple, second by Commissioner Lennon to approve the Accounts Payable for February 2026 totaling $175,236.13. All in favor. So voted. Motion is made by Commissioner Kepple, second by Commissioner Lennon to approve the Capital One Charges for February 2026 totaling $977.63. All in favor. So voted. = DIRECTOR OF FACILITIES = Discussion regarding maintenance accomplishments for January 2026 and upcoming projects. Motion is made by Commissioner Kepple, second by Commissioner Lennon to accept the Directors of Facilities Report as presented. All in favor. So voted. = DIRECTOR REPORT "Court Cases ~ 1 c [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 16, 2026

School Committee

School Community Relations Subcommittee meets for planning

The Franklin School Committee's Community Relations Sub Committee will meet on March 16, 2026, to discuss website usage metrics, a quarterly community engagement update, a senior center visit and Q&A session, Strawberry Stroll planning, and newsletter planning. No decisions or votes are scheduled; all items are discussion and planning topics.

school-committeecommunity-relationsengagementplanningsubcommittee
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Community Relations Sub Committee March 16, 2026 6:30 PM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/85000028803?pwd=RkxYbXC0Q9rHBlUyuuFFPcWSa37Qsm.1 Passcode:791579 Join via audio: +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters is those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Website Usage Metrics ● Quarterly Community Engagement Update ● Senior Center Visit / Monthly Q&A Session ● Strawberry Stroll Planning ● Newsletter Planning
Thu Mar 12, 2026

Cultural District Committee

Cultural District Committee to discuss grant recipients and town anniversaries

The committee will review updates regarding grant recipient assignments and district initiative ambassadors. Discussions include the Franklin 250th Anniversary and reports from the Department of Arts, Culture & the Creative Economy.

culturegrantstourismcommunity-events
✓ Decidido: Committee members assigned as ambassadors for cultural initiatives

The committee approved the February 12, 2026 meeting minutes. Members were assigned as ambassadors for specific projects, such as cultural weekends, the Wind Phone, the Dean Bank mural, outdoor frames, Porch Fest, and World Cup events. The next Porch Fest planning meeting was set for March 25 at 6 p.m., and the next Cultural District Committee meeting was scheduled for April 9, 2026 at 6:30 p.m.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee Meeting Thursday, March 12, 2026, 7:00 pm Franklin Senior Center, 10 Daniel McCahill St., Franklin AGENDA A. Review and Approval of the Meeting Minutes o February 12 , 2026, Cultural District Meeting B. Updates from Cultural District Chair, John LoPresti o Assignment of Grant Recipient and District Initiative Ambassadors o PorchFest C. Department of Arts, Culture & the Creative Economy Updates, Cory Shea o World Cup Configuring 25 o MetroWest Boston Visitors Bureau Annual Tourism Summit o A Wreath of Franklin Vendors Report D. Cultural District Check-in update, Pandora Carlucci E. Franklin, MA 250th Anniversary update, Roberta Trahan Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include: Items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/Feedback Adjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: March 3, 2026 Posted: Sent to Town Clerk on March 4, 2026 for posting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Cultural District Committee Meeting Minutes | March 12, 2026Meeting Name: Cultural District Committee MeetingDate: March 12, 2026Time: 7:00-9:00 pm Location: Franklin Senior Center Chairperson: John LoPrestiSecretary: Katherine Botelho1. Call to Order●Time: 7:00 p.m. ●Chairperson: John LoPresti●Attendance:○Present Members:■John LoPresti ■Pandora Carlucci ■Peter Rochat■Roberta Trahan■Patrick Conlon■Sue Cass■Katherine Botelho ■Absent Members:■None ○Guests/Other Attendees:■Cory Shea, Director of Arts, Culture and the Creative Economy■Mitzi Gousie, Franklin Public Library■Margaret Munson, Franklin Art Association■Alan Earls, Franklin Historical Commission 2. Approval of Previous Meeting Minutes●Minutes from February 12, 2026○Approved: Yes○Amendments: No 3. Agenda Items from March 12 Meeting:a. Updates from the Chairperson●Chairman LoPresti asked committee members to select the previously approved initiatives for which they would like to serve as ambassadors. The assignments are as follows:Pandora Carlucci - Cultural weekends and World Cup eventsRoberta Trahan – Wind PhoneSue Cass – Dean Bank muralPeter Rochat – Outdoor frames and gallery. (Also, assistance at Pride Day June 27)John LoPresti – Porch Fest and Outdoor galleryKatherine Botelho – World Cup events ●LoPresti reported that the Proch Fest Committee held its first meeting on February 25. They reviewed the positive and negative aspects of last year’s event. A decision regarding a rain-date for the June 6 event will [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 12, 2026

Bi-County Collaborative

Board to vote on new executive director contract and FY27 budget

The Bi-County Collaborative Board of Directors will vote on a new executive director contract and the FY27 budget (second read). The board will also approve minutes from recent meetings and act on employee appointments, resignations, and leaves of absence. Updates on enrollment, program highlights, and facilities will be discussed.

executive-directorbudgetschool-calendarenrollmentfinancefacilitiespersonnel
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BOARD OF DIRECTORS MEETING March 12, 2026 9:00-10:30 Agenda 1. Approval of Minutes - Mrs. Jeanne Sullivan, Executive Director a. Board of Directors Meeting, February 5, 2026 (Vote Required) b. Board of Directors Meeting, February 10, 2026 (Vote Required) c. Budget Subcommittee Meeting, March 9, 2026 (Vote Required) 2. New Executive Director Contract (Vote Required) - Dr. Allan Cameron 3. Executive Director Update - Mrs. Jeanne Sullivan, Executive Director a. Employee Appointments/ Resignations/ LOA (Vote Required) b. Updates to 25-26 School Calendar c. Enrollment i. Current Enrollment / Referrals d. Program Highlights e. Collaborative Shoutouts 4. Business Office Updates - Ms. Holly Buttrick, Director of Finance & Operations a. Financial Overview i. FY26 Budget b. Facilities Update c. FY27 Budget (Second Read) (Vote Required) 5. Other 6. Routine Matters a. Approval of Payroll Warrants b. Approval of Bill Warrants Adjourn Future Meetings: Board of Directors Meeting: Thursday, April 10, 2025 The Bi-County Collaborative does not discriminate in admission to, access to, treatment in, or employment in its services, programs, and activities, on the basis of race, color, sex, gender identity, religion, national origin, sexual orientation, homelessness, disability, pregnancy or pregnancy-related conditions, age, veteran or military status, ancestry, or genetic information.
Thu Mar 12, 2026

Municipal Affordable Housing Trust

Municipal Affordable Housing Trust to discuss Franklin Ridge easement

The Municipal Affordable Housing Trust will meet to discuss a grant of easement for Franklin Ridge. The body will also review a finance update and approve meeting minutes from February 12, 2026.

affordable-housingeasementfinance
✓ Decidido: Trust will initiate follow-up with Chris Feeley on CPA involvement

The trustees approved the February 12, 2026 meeting minutes unanimously. They accepted the Trust's accounting report. The board agreed to begin a follow‑up conversation with Chris Feeley about the Community Preservation Act and to have Jon Juhl attend the April meeting. A motion to adjourn the meeting was passed.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda March 12, 2026 Virtual 2pm To all residents- this meeting is available to be attended in person at the 2nd Floor Council Chambers of the Town of Franklin Municipal Building or via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. When: Mar 12, 2026 02:00 PM Topic: Franklin Municipal Affordable Housing Trust Fund Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/85602644324 Phone one-tap: (646) 931-3860 Meeting ID: 85602644324 1. Franklin Ridge- Grant of Easement 2. Trust Finance Update 3. Meeting Minutes a. February 12, 2026 4. New Business/Old Business
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Municipal Affordable Housing TOW N of F enn Ma Oooas ranklin, Trust Christopher Vericker, Chair F R A N K L [ N P.508.520.4907 www.franklinma.gov MASSACHUSETTS Meeting Minutes March 12, 2026 Call to order: Zoom Meeting called to order at 2:04PM by Chair Chris Vericker. Trust Members present were: Chair Chris Vericker, Member Kimberly Mu-Chow, Secretary Susan Younis, Member Mark Minnichelli and Amy Love, attendee Absent: Vice Chair, Chris Feeley, Town Administrator Jamie Hellen Meeting Minutes: Minutes from February 12, 2026: have been presented for review and approval. Vericker motioned to approve the minutes. Younis seconded. Vote: Sue Younis: yes, Chris Vericker: yes, Kim Mu-Chow: yes, Mark Minnichelli: yes. Review of the Trust accounting report — accepted Trustees held a generalized roundtable discussion ranging on topics from affordable housing initiatives, skyrocketing rental/homeownership affordability, local/national policies and general procedures affecting affordable housing non-profits and agencies. It is noted that the conversation was conducted in general terms and included floating ideas for new initiatives and cooperatives; context was specific to current and future Franklin projects but not in all instances. Once Franklin Ridge completes construction and lease-up initiatives, early 2027, what will be the next step for the Trustee given two parcels of land still remain to be developed. The Trust will/may have funds available to initiate a start-up prog [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 12, 2026

Benjamin Franklin Classical Charter Public School

Board will vote on the FY 2026‑27 school calendar

The Franklin Town charter school board will review and approve the proposed academic calendar for the 2026‑27 school year. The meeting also includes updates from the executive director, faculty representative, and various committees, as well as a review of the previous meeting minutes. No other decisions or contracts are listed on the agenda.

educationcalendarboard-meetingminutescommittee-reports
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOL March 12th BOARD OF TRUSTEES MEETING Thursday, March 12, 2026; 7-10pmIn Person-BFCCPSGoogle Meet joining info Video call link: meet.google.com/dpt-ypip-qrdOr dial: ‪(US) 1 414-909-5071 PIN: 327 335 126#===================================7:00Call to Order 7:05Open Comment Period7:10Review and vote on meeting minutes from 2/12 meeting 7:15 ED Update7:35Prospective Council Presentations8:05HOS Updates8:20Faculty Rep Updates8:30SSO Edgility Review8:45AY 26/27 School Calendar 9:00 Committee Updates-DEIB-Facilities-Finance-Governance-HR-Mission9:30Task List9:35Adjourn to Executive SessionThe scheduled times as listed are approximate.
Thu Mar 12, 2026

Conservation

Commission will review multiple conservation site plans and stormwater reports

The Franklin Town Conservation Commission will consider a series of documents related to conservation site plans, stormwater facilities, and related reviews. Items include plans for Symphony Drive/Tanglewood Estates II, 670 King Street, Lewis Street, Donovan Estates, and a minor buffer zone activity. The commission will discuss these materials but no decisions are listed in the agenda.

conservationstormwaterland-usezoningenvironment
✓ Decidido: Commission voted to continue all pending NOI hearings to March 26 2026

The Conservation Commission postponed the notice‑of‑intent hearings for five projects, setting new dates on March 26 2026. Motions to continue the hearings for Nicholas Drive/Prospect Street culvert repair, Symphony Drive/Tanglewood Estates, 670 King Street, Lewis Street, and 47 Patridge Street each passed unanimously with one member absent (vote 6‑0‑1). No other approvals or actions were taken during the meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Conservation Commission Agenda 3-12-2026 CONSERVATION AGENDA.PDF Symphony Drive/Tanglewood Estates II 25-0108B 20260226.PDF 25-0108 CORRESPONDENCE - CONCOM PEER REVIEW RESPONSE 20260226.PDF 25-0108 NOI CORRESPONDENCE V2 20260226.PDF 25-0108 STORMWATER V2 20260226.PDF 670 King Street REVISED SCAN 2026-1-7 (15,30,40).PDF Lewis Street 25125 CONSERVATION SITE PLAN REV030226.PDF LPI RESPONSE 03.02.26 - BETA PEER REVIEW 1B, SIGNED.PDF TR 900 SERIES - UPLAND.PDF TR 900 SERIES - WETLAND.PDF 25125 EXISTING CONDITIONS REV030226.PDF LEWIS ST NOI REVIEW 2026-02-23.PDF 47 Partridge Street DONOVAN_ESTATES_STORMWATER_FACILITIES_PLAN_REV2-EMAIL.PDF DONOVAN_ESTATES_SUBDIVISIONS_PLAN_REV2-EMAIL.PDF DONOVAN_ESTATES_STORMWATER_REPORT_REV2-EMAIL.PDF DONOVAN_ESTATES_WATERSHED_PLANS_REV2-EMAIL.PDF Minor Buffer Zone Activity POOL FENCING PLACEMENT-5 OAK TREE LANE.PDF 1. Documents: 2. Documents: 3. Documents: 4. Documents: 5. Documents: 6. Documents:
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520-4906 1 Town of Franklin Conservation Commission March 12, 2026 Meeting Minutes As stated on the agenda, this meeting is available to be attended in person and via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or citizens can participate by using the Zoom link provided on the agenda. This meeting will be held in the Town Council Chambers on the Second Floor of the Municipal Building for citizens wishing to attend in person. Commencement Chair Mark LePage called the above-captioned meeting to order this date at 7:00 PM as a remote/virtual/in- person meeting. Members in attendance: Mark LePage, Lui Puga, Michael Rein, Roger Trahan, Nicole Chiaramonte, Matthew Stoltz. Absent: Richard Johnson. Also present: Breeka Li Goodlander, Director of Conservation (via Zoom); Tyler Paslaski, Administrative Staff. Note: Documents presented to the Conservation Commission are on file. SCHEDULING None. PUBLIC HEARINGS Public Hearing – NOI – Nicholas Drive/Prospect Street Culvert Repair Chair LePage said they did not receive any new information; there was a request for continuance. There was a motion made by Matthew Stoltz to continue the NOI for Nicholas Drive/Prospect Street Culvert Repair to March 26, 2026, at 7:01 PM. The motion was seconded by Michael Rein and accepted with a [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 11, 2026

Cultural Council

Cultural Council to plan A-Wreath-of-Franklin and review FY26 grants

The Cultural Council will discuss planning for the A-Wreath-of-Franklin event, including theme and date selection. The body will also review FY26 grants and plan a grants reception. Additional agenda items include the Horace Mann District Initiative and the selection of new council members.

arts-and-culturegrantscommunity-eventsappointments
✓ Decidido: Council cancels Grants Reception and unanimously approves prior meeting minutes

The Cultural Council unanimously approved the minutes from the November 13, 19, 24 and December 2 meetings. It decided to forgo this year’s Grants Reception, citing lack of impact. The council also set the Wreath of Franklin 2026 for Dec 12, created subcommittees, confirmed a 22‑member limit, and scheduled future meetings for the third Wednesday of each month.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Cultural Council Meeting Agenda Date: Wednesday, March 11, 2026 Time: 7 PM Location: Franklin Municipal Building Training Room (3 rd floor) 1. Welcome 2. Approval of Minutes 3. Financial Update 4. FY26 Grants Update 5. Franklin Culture Updates 6. A-Wreath-of-Franklin Debrief and 2026 Planning • Theme • Market • Businesses • Events/Entertainment • New Committee Organization Proposal • Date Selection • Theme Selection Proposal 7. Horace Mann District Initiative 8. FY26 Grants Reception • Date • Scope • Entertainment • Venue 9. Strawberry Stroll Planning 10. Harvest Festival Planning 11. Sealing the Lady Bugs Art 12. Promoting the Importance of Arts & Culture in Franklin 13. Selecting New Franklin Cultural Council Members Committee 14. Topics for Future Meetings 15. Adjourn
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Cultural Council Meeting Minutes March 11, 2026 Date: Wednesday, March 11, 2026 Time: 7 PM Location: Franklin Municipal Building Training Room (3 rd floor) Present: John Ristaino, Caryn Parnell, Kayla Nisbet, Nicole Horseman, Cory Shea, Ryan Hanley, Heather Carroll, Will Lee and Lisa Oxford. 1. Welcome a. John opened the meeting at 7:11. b. The Council was informed that MD Hassan has officially resigned from the Franklin Cultural Council. 2. Approval of Minutes a. The meeting minutes of the November 13th, 19th and 24th, and December 2nd were unanimously approved. 3. Financial Update a. The $18,100.00 from the Mass Cultural Council is expected to be populated into our account within the next week. b. There are still two grant recipients from FY2025 who have not yet submitted requests for reimbursement. 4. Grants Update a. Mansfield Music and Arts Association will be requesting an extension on their grant to extend to their next theatrical season. 5. Franklin Culture Updates a. World Cup: i. Cory recently spoke at the Metrowest Arts and Culture Summit. She has applied for a grant through the Massachusetts Off [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 11, 2026

Norfolk County Commissioners

Norfolk County Commissioners to review Fiscal Year 2027 Budget Proposal

The Norfolk County Commissioners will hold a public hearing to review the proposed budget for Fiscal Year 2027. Residents may provide oral or written comments during the meeting or examine the proposal starting March 6, 2026.

budgetpublic-hearingcounty-government
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
PUBLIC HEARING: To Review the Commissioners’ Fiscal Year 2027 Budget Proposal The Norfolk County Commissioners will hold a public hearing on Wednesday, March 11, 2026, at 1:00 P.M. in the Commissioners’ Office Conference Room at 614 High Street (2nd Floor), Dedham, MA 0202 7 and via Zoom Teleconference https://us06web.zoom.us/j/81289005527?pwd=q4Foz6YvIKpfb qBkqTcYFaZ1t5ecEb.1 Meeting ID: 812 8900 5527 Passcode: 898470 to review the Commissioners’ Fiscal Year 20 27 Budget Proposal. Citizens’ oral or written comments and suggestions are welcome. The F iscal Year 2027 proposed budget may be examined beginning March 6, 2026, at www.norfolkcounty.org or between 8:00 am and 4:00 pm commencing Friday, March 6, 2026, at the Norfolk County Commissioners ’ Office. Please contact the Commissioners’ Office at (781) 461-6105 with any questions. The Norfolk County Commissioners’ Office provides a barrier-free environment for people with disabilities. NORFOLK COUNTY COMMISSIONERS JOSEPH P. SHEA PETER H. COLLINS RICHARD R. STAITI MUNICIPAL CLERKS PLEASE POST
Wed Mar 11, 2026

Finance Committee

Finance Committee to review town financial policies and grant process

The Finance Committee will review the 2025-2026 Financial Policies and receive a presentation on the municipal grant process and historical grant data. No votes on specific expenditures are scheduled, but the meeting sets the stage for upcoming budget hearings in April.

financebudgetgrantspoliciescommittee
✓ Decidido: Finance Committee approved Feb. 24, 2026 minutes

The committee approved the minutes for the February 24, 2026 meeting. The motion was made by Jennifer D'Angelo, seconded by Ryan Lavorgna, and passed by voice vote with six ayes and no nays. No other items received a vote; the remaining agenda items were discussion only.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Wednesday, March 11, 2026 6:00 PM Franklin Municipal Building 355 East Central Street, 2nd Floor Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #892 8239 7154 & https://us02web.zoom.us/j/89282397154 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda 1. Call to Order 2. Public Comments - Citizens are welcome to express their views for up to three minutes on a matter that is not on the [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Finance Committee Meeting Minutes Wednesday, March 11, 2026 6:00 PM Franklin Municipal Building, Council Chambers, 355 East Central Street A meeting of the Finance Committee was held on Wednesday, March 11, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Members Present George Conley, Chair, Christopher Diaz, Ryan Lavorgna, Jen D’Angelo, Shannon Nealon, John Barnes Member not Present Natalie Riley, Vice Chair Lauren Nagel, Clerk 1. Call to Order SUMMARY: George Conley, Finance Committee Chair, called the meeting to order at 6:09 PM. VOTE(S): [NONE] 2. Public Comments - Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Finance Committee cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Finance Committee may ask town staff to review the matter. Nothing herein shall prevent the town staff from correcting a misstatement of fact. SUMMARY: Chair Conley asked if anyone in chambers or on Zoom wished to make a public comment. No one came forward. VOTE(S): [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 11, 2026

Historical Commission

Museum transition to for-profit model discussed; $3,498 approved for depot diorama

The Franklin Historical Commission will hear a presentation from Dean Business School on transitioning the museum to for-profit and boosting marketing. They approved $3,498, including $1,000 for a depot diorama, and will discuss updates on exhibits, the Tri-County Bell Stand, and 2026 music programs.

historical-commissionmuseumfor-profit-transitionbudgetexhibitscommunity-events
✓ Decidido: Friends approved $3,498 museum funding, including $1,000 for depot diorama

The commission unanimously approved the minutes from February 11, 2026. The Friends of the Museum approved $3,498 for museum projects, with $1,000 designated for a depot diorama addendum to the Train Town exhibit. The commission also unanimously voted to adjourn the meeting. No other substantive decisions were recorded.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Agenda, Weds., Mar. 11, 2026, 6:00 pm Meeting at the Museum, 80 W. Central St APPROVAL OF MINUTES – Feb. 11, 2025 CITIZENS COMMENTS: PRESENTATIONS: Dean Business School-- Joseph Fargnoli and team will discuss the expertise they can provide in transitioning the museum to ‘for profit’ and boosting marketing. FFHM REPORT: SUBCOMMITTEE REPORTS:  TREASURER/ARCHIVIST:  COMMUNITY PRESERVATION COMMITTEE:  FRANKLIN 250 UPDATE  FPS HORACE MANN COMMITTEE – RESULTS OF FIRST MEETING  ARCHIVIST UPDATE —FEDERATED CHURCH ---GENERAL UPDATES REGULAR BUSINESS:  Assession and Deassessions  Exhibit Planning OLD AND NEW BUSINESS:  Update on Tri-County Bell Stand  New volunteer, former Commissioner Connie Lawson, coming aboard  Discuss continuing updates to exhibits….  Report on Friends Annual Meeting --$3,498 was approved. This included a $1,000 check written to Scott Mason for the "depot diorama"  Possible fundraiser With Jim Johnston  Music Programs for 2026 – Dennis Ferguson Jazz on Sunday, April 26  Upcoming events into 2026-7. Ideas?  Other matters not otherwise enumerated COMMISSIONERS COMMENTS: ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Meeting Minutes, March 11, 2026, 6:00 pm Commission Members Present: Alan Earls, Phyllis Malcolm, Randy LaRosa, Jan Prentice, Scott Mason, Will Lee, Associate Member Mary O’Leary, Archivist Rowan Lowell. Members of the Public Present: Joseph Fargnoli and Ursula Weffers, Dean College School of Business APPROVAL OF MINUTES: The minutes from February 11, 2026 were unanimously approved. CITIZENS COMMENTS: Joe and Ursula discussed the strategy for increasing marketing and revenue for the Museum. A group of student volunteers will be working with the Commission to identify pain points and devise plans to mitigate them. The first meeting between volunteers and Commission members will be Wednesday, March 18. PRESENTATIONS: None. FFHM REPORT: No Friends present. SUBCOMMITTEE REPORTS: ● TREASURER: Phyllis submitted the budget summary to the Treasurer’s office. ● COMMUNITY PRESERVATION COMMITTEE: Meeting scheduled in May. ● FRANKLIN 250TH UPDATES: Alan reported that the 250th Committee has $50,000 to spend by June and is organizing events, such as a parade in September 2028, and a final send-off event at Lake Pearl in November 2028. ● ARCHIVIST UPDATE: Rowan received a summary of the donations for the previous calendar year. Rowan visited the Federated Church to index their artifacts and documents and presented the Commission with a list of their inventory. There are several items of interest to the museum. Rowan [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 10, 2026

Franklin's 250th Anniversary Celebration Committee

Select brand/logo concepts for Franklin's 250th anniversary

The Communications Subcommittee will review and select brand/logo concepts to present to the full committee on March 26. They will also discuss action items from the previous meeting and begin planning a community T-shirt initiative, including timeline, parameters, qualifying participants, and production plan. Minutes from December 2025 and January 2026 are pending approval.

anniversarybrandinglogocommunity-t-shirtscelebrationcommunicationssubcommittee
✓ Decidido: Committee decided to present both logo concepts at the March 26 meeting

The subcommittee approved the prior meeting minutes (unanimous roll call, D. Pellegri abstaining). It voted to bring both brand/logo options to the full Committee meeting on 3/26/26. The community T‑shirt contest was tabled until the next meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin 250 th Anniversary Communications Subcommittee Agenda March 10, 2026 - 5:30-6:30 Approve Previous Meeting Minutes ● 12/16/25 Minutes ● 1/13/26 Minutes Old Business ● Recap Brand Discovery Document New Business ● Recap Brand Discovery Document ● Review Brand/Logo Concepts and Select options to bring to the Committee meeting on 3/26/26. ● Discuss any action items from the 2/26/26 Meeting ● Begin discussion for community T-Shirt content ○ Timeline ○ Parameteres ○ Qualifying Participants ○ Production Plan
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
DRAFT 250th - Communications Subcommittee Meeting Via Zoom Tuesday, March 10, 2026 · 5:30 – 6:30pm The meeting came to order at 5:30 with Juli Cornoni, Alan Earls, and Ali Rheaume, Deb Pellegri, Rob Brown, and Jayson Joyce present. Vote to Approve Both Previous Meeting Minutes (Unanimous roll call vote with D. Pellegri abstaining) 12/16/25 Minutes 1/13/26 Minutes Old Business ● Recap Brand Discovery Document —Julie shared her screen and explained surveys, discussion, and thought that had gone into branding work led by her and by Ali New Business ● Julie revealed the two Brand/Logo Concepts that she and Ali developed and solicited feedback ● Discussion led to a plurality of interest in the simple `open book’ logo but the group voted to bring both options to the Committee meeting on 3/26/26. ● Began discussion of community T-Shirt contest but decided to table until the next meeting due to shortage of time. ADJOURN A unanimous roll call vote was taken to adjourn at approximately 6:30
Tue Mar 10, 2026

School Committee

School Committee to accept $5,096 gift for field trips, hear food services report

The Franklin School Committee will meet to discuss routine business, including a presentation on food services and a monthly financial report. The committee will also consider a consent agenda to accept a $5,096 gift from the Washington Street K-2 PCC for field trips and approve meeting minutes. No action items are listed for discussion.

school-committeebudgetgiftsfood-servicesfinancial-report
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee March 10, 2026 Municipal Building – Council Chambers 6:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/86298816472?pwd=gaoj28Ccn6owpF08qb4QHPQQOxWwSm.1 Passcode:782771 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 253 205 0468 US +1 253 215 87 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026

School Committee

School Committee to hold closed-door bargaining sessions

The Franklin School Committee will meet with four separate negotiating sub-committees to discuss collective bargaining strategy with the FEA/ESP, FEA/Van Drivers, FEA/Secretaries, and FEA/Cafeteria Workers units. The meetings will be held in executive session under state law.

school-committeenegotiationscollective-bargainingexecutive-sessionfeupublic-employees
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee Negotiations Sub Committees March 9, 2026 4:30 P.M. This meeting will not be recorded  Vision Statement  The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. LOCATION: Municipal Building – 3rd Floor Training Room A G E N D A “The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items l isted may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law.” Meeting of the Negotiating Sub-Committee with the FEA/ESP Unit 1. Call to Order 2. Adjourn to Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the FEA/ESP Unit as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. Meeting of the Negotiating Sub-Committee with the FEA/Van Drivers Unit 1. Call to Order 2. Adjourn to Executive Session a. Pursuant to M.G.L. c. 30A, §21(a)(3) to discuss strategy with respect to collective bargaining with the FEA/Van Drivers Unit as an open meeting may have a detrimental effect on the bargaining position of the School Committee and the chair so declares. Meeting of the Negotiating Sub-Committee with the FEA/Secretaries Unit 1. Call to Order 2. Adjourn to Executive Sessi [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026

Planning Board

Planning Board to review subdivision plans for Partridge Street and Symphony Drive

The Planning Board will hold public hearings regarding definitive subdivision plans for three residential projects. The board will also discuss future zoning amendments and a specific ANR for Populatic Street.

zoningsubdivisionland-useplanning
✓ Decidido: Planning Board approves parcel swap and postpones three subdivision votes

The board approved an amendment to the 81‑P ANR for parcels at 78 & 79 Populatic Street, allowing a parcel swap to relocate a driveway. The board voted to continue the pending private definitive subdivision applications for 70 Daniels Street (Grillo Estates), 47 Partridge Street (Donovan Estates), and Symphony Drive (Tanglewood Estates II) to the next meeting on March 23, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet March 9, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/81532457068 or call on your phone at 312 - 626-6799, meeting #81532457068. PUBLIC HEARINGS 1. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision TO BE CONTINUED 2. 47 Partridge Street (Donovan Estates) – Definitive Subdivision Definitive Subdivision Plans – Revised Correspondence 3. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision Definitive Subdivision Plans - Revised Correspondence GENERAL BUSINESS: a. 81-P ANR: 78 & 79 Populatic Street b. Discussion: Future Zoning Amendments This agenda is subject to change. The next meeting of the Planning Board is scheduled for March 23, 2026.
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board March 9, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, 2nd floor, Council Chambers, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk; Mark Mucciarone (via Zoom); William Lee, associate member. Members absent: Eric Steltzer. Also present: Michael Maglio, Town Engineer; Morena Zelaya, Director of Planning and Community Development; Steven Lee, BETA Group. Note: Documents presented to the Planning Board are on file. GENERAL BUSINESS A. 81-P ANR: 78 & 79 Populatic Street Mr. Maglio said he had no issues; it looks like they are just switching one corner of the parcel for another corner. Mr. Ted Lyzenga from Tilton & Associates representing Bright Ideas by JRP LLC said they are doing a parcel swap. Both parcels are non-buildable and the same land area, so it does not affect the size of the existing lots. He explained the purpose which is that there is an existing driveway that is crossing over the realty trust’s lot. The intent is to swap the parcels to relocate the driveway. Motion to Approve the 81-P ANR for 78 & 79 Populatic Street. Rondeau. Second: Mello. Roll Call Vote: Ro [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Mar 6, 2026

School Committee

Policy subcommittee to discuss facility rentals, emotional support dogs, and online fundraising

The Franklin School Committee's Policy Subcommittee will review and discuss several policies, including online fundraising and crowdfunding (GBEBD), facility rental policies, and a new policy on emotional support dogs (ID). No final decisions are expected; the meeting is for discussion and revision of policies before any committee vote. Other items such as signage on state property are held for a future meeting.

school-committeepoliciesfundraisingfacility-rentalemotional-support-dogadministrative-reportsannual-report
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN SCHOOL COMMITTEE Policy Subcommittee Meeting DATE: 3/6/26 TIME: 8:15 AM Members of the public are now welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Meeting feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak will be able to raise their hand to be recognized by the Chair. The meeting host will invite the attendee to unmute for comment. Location: Municipal Building 3rd floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/88247204142?pwd=NXV0aBQx5Oe1XiBLGxZxubMxWUayrB.1 Passcode:175401 Join via audio: +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 646 558 8656 US (New York) +1 646 931 3860 US +1 360 209 5623 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US A G E N D A “The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law.” I. Attendance - II. Review of Minutes III. Approved Policies A. BL: Remote Participation IV. Discussion of Policies sent to School Committee A. none V. Discussion & Revisions on Policies From Previous Policy Meetings A. GBEBD - Online [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026

Legal Notices

Variance hearing for 17.7-foot side-yard setback at 1A Overlook Drive

The Franklin Zoning Board of Appeals will hold a public hearing on March 5, 2026, at 7:30 PM to consider a variance application from Michael Bavineau for property at 1A Overlook Drive. The applicant seeks to construct an addition that would be 17.7 feet from the left side yard setback, where 40 feet is required, and a building permit was denied without a variance. The hearing will take place in the Municipal Building and via Zoom.

zoningvariancepublic-hearing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on March 5 , 2026 at 7: 30 pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 5 pm Applicant: Michael Bavineau Address of Subject Property : 1A Overlook Drive (Map 258 , Lot 045 ) Zoning District: RR I Petition Type: Variance Zoning B y-Law Sections: 185 Attachment 9 Schedule of Lot, Area, Frontage, Yard and Height Requirements Reason for Denial : Applicant is seeking to construct an addition that is 17.7 ’ from the left side yard setback where 40 ’ is required. The building permit is denied without a Variance from the ZBA. An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu Mar 5, 2026

Franklin Commission on Disability

Commission will discuss accessibility improvement updates

The Franklin Commission on Disability will approve the previous meeting minutes and hear public comments. It will share updates on the resource document, new accessibility locations and events, and check on education training. The commission will plan items for the upcoming Strawberry Stroll event and discuss member numbers and further accessibility improvements.

disabilityaccessibilitycommunity-eventspublic-commentsmeeting-procedures
✓ Decidido: Commission unanimously approved adding two new members

The Franklin Commission on Disability accepted the February 5 minutes and unanimously approved a motion to add two additional members. The commission also unanimously approved the purchase of a table, chairs, tablecloth, and tent for upcoming events. Additional actions include replying to St. Johns Church about inclusion in the accessibility list and continuing various accessibility improvements across town.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Meeting Agenda Date: March 5, 2026 Time: 4:00pm Location: Senior Center, Craft Room, 10 Daniel McCahill St, Franklin, MA *Please note: we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance Call to Order ● Approve previous meeting minutes ● Public Comments ● Announcements from the Chair ○ AAB Non-Compliance Letters ● Old Business: ○ Update on Resource Document going live ○ Accessibility in Franklin: share new locations/events ○ Education Goal: check in on training ○ Event Goal: Plan for Strawberry Stroll: items to order ● New Business: ○ Discuss member numbers ○ Accessibility improvement updates ● Next Meeting: (Subject to Change) Adjourn meeting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Meeting Minutes Date: March 5, 2026 Location: Senior Center, 10 Daniel McCahill Street, Franklin MA Members Present: Alison Rheaume, Lauren Sanford, Kelly Quinlan, Michael Furilla, Cheryl Fisher Members Absent: Gus Brown Meeting Called to order by Alison Rheaume, Chairperson, at 4:01 pm ● Past Minutes: A motion was made and carried to accept the minutes of the February 5, 2026 meeting. Approved. ● Public Comments: ○ Mark - Work is being done to have a round table with multiple commissions present. ○ Steve - Meeting is being recorded to help raise awareness. ● Old Business: 1. Resource document: a. Brief reminder on social media post sharing policy b. The resource document has gone live. The community has been responsive. c. St. Johns Church reached out to be added as a resource. Council will reply to add them to the accessibility. d. Change “resources” to “services” as it fits the mission better. 2. Accessibility in Franklin: a. Updates on progress in each category. Will continue to update document criteria. b. Move “health and medical” and “fitness and sport”. 3. Education Goal: a. Locate “education” under Dis Com folders 4. Event Goals: a. Update on purchases. b. Allegra flyers are printed and ready for pickup. c. Tables are possibly available to borrow from TV studio. d. Hire an interpreter for the Strawberry Stroll. e. Review remaining balances and items needed for future events. f [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026

Legal Notices

Special permit hearing for garage, family room, and suite at 32 Elm Street

The Franklin Zoning Board of Appeals will hold a public hearing on March 5, 2026 at 7:30 PM for a special permit application by Lauren Egan for property at 32 Elm Street. The applicant seeks permission to construct a 2-car garage, family room, and primary suite that would be closer to property lines than allowed (31' front, 20.1' right, 26.3' left vs required 40'). The board will decide whether to grant the special permit for these setback variances.

zoningboard-of-appealsspecial-permitsetback-variancepublic-hearingfranklin-ma32-elm-street
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on March 5, 2026 at 7:30pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov to view meeting access under ZBA Agenda. Time: 7:30pm Applicant: Lauren Egan Address of Subject Property: 32 Elm Street (Map 214, Lot 033) Zoning District: RR I Petition Type: Special Permit Zoning By-Law Sections: 185-18 A.(2), 185 Attachment 9 Schedule of Lot, Area, Frontage, Yard and Height Requirements Reason for Denial: Applicant is seeking to construct a 2-car garage, family room and primary suite that is 31’ from the front lot line where 40’ is required, 20.1’ from the right side lot line where 40’ is required and 26.3’ from the left side lot line where 40’ is required. The building permit is denied without a Special Permit from the ZBA An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk. All records and files for this project can be viewed in the Building Department on the 1st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026

Zoning Board of Appeals

ZBA to hear special permit request for home additions at 32 Elm Street

The Zoning Board of Appeals will hold a public hearing regarding a special permit request for 32 Elm Street. The applicant seeks to build a 2-car garage, family room, and primary suite that do not meet current setback requirements.

zoningspecial-permitresidential-constructionsetbacks
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on March 5, 2026 at 7:30pm in the Municipal Building located at 355 East Central Street, Franklin MA and via Zoom Platform. Please go to Franklinma.gov to view meeting access under ZBA Agenda. Time: 7:30pm Applicant: Lauren Egan Address of Subject Property: 32 Elm Street (Map 214, Lot 033) Zoning District: RR I Petition Type: Special Permit Zoning By-Law Sections: 185-18 A.(2), 185 Attachment 9 Schedule of Lot, Area, Frontage, Yard and Height Requirements Reason for Denial: Applicant is seeking to construct a 2-car garage, family room and primary suite that is 31’ from the front lot line where 40’ is required, 20.1’ from the right side lot line where 40’ is required and 26.3’ from the left side lot line where 40’ is required. The building permit is denied without a Special Permit from the ZBA An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk. All records and files for this project can be viewed in the Building Department on the 1st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026

Agricultural Commission

Agricultural Commission to discuss Right-to-Farm designation with Town Administrator

The Franklin Agricultural Commission is meeting with the Town Administrator to discuss three topics: making Franklin a Right-to-Farm town, the Commission's use of land, and a future community canning center. No votes or decisions are scheduled; the meeting is solely for discussion.

agricultural-commissionright-to-farmland-usecommunity-canningfranklin-matown-administrator
✓ Decidido: Agricultural Commission discussed right‑to‑farm by‑law and land use

The commission explained the Right‑to‑Farm by‑law and the town administrator said his understanding differed, agreeing to research it. The administrator said no town land is currently available for commission use and noted Schmidt’s Farm will not be usable for several years. He also said a community canning center would need private funding.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Ag Com Meeting with Town Administrator Agenda~ 3/5/2026 10:00am 1. Meeting with Town Administrator- March 5th 10:00 -11:00 at the Municipal Building Discussion Topics: A. Making Franklin, MA a Right-to-Farm Town- B. Ag Commission’s use of land- C. Future Community Canning center- Respectfully Submitted, Marian Szymanski
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
~Ag Com Meeting with Town Administrator Minutes~ 3/5/2026 10:00am 1. Meeting with Town Administrator- March 5th 10:00 -11:00 at the Municipal Building Present: Jamie Hellen – Town Administrator, Marian Szymanski, C.J. Koshivas, Benjamin Rousseau, and Jen Anderson Sweeney Discussion Topics: A. Making Franklin, MA a Right-to-Farm Town- The Ag Commission explained what the “Right-To-Farm” By-law means and what it would do for the town of Franklin. Jamie Hellen’s understanding of the By-law was not the same as the Commission’s. Jamie Hellen agreed to do some research into this By-law. The Town Administrator suggested the possibility of creating a customized By-law that could prevent some of the opposition he predicted would come from other Boards, Commissions, and Committees in the town. B. Ag Commission’s use of land- The Town Administrator listened to our reasons for wanting the use of some town land, but explained that, at this time, there is no land available for our use. The property, known as, “Schmidt’s Farm”, will not be a possibility for several years – as construction on the property is a year and a half away from beginning. There is currently no sewer and no water on the property. The Ag Commission suggested the possibility of creating produce gardens at our local schools. Marian will connect with the people in charge of the grounds at Franklin’s schools. C. Future Community Canning center- Jamie Hellen heard our thoughts on the ben [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026

Zoning Board of Appeals

ZBA to hear three setback variance and special permit applications

The Zoning Board of Appeals will hold public hearings on three applications where proposed construction violates required setbacks. Items include a special permit for a garage and addition at 32 Elm Street, a variance for an addition at 1A Overlook Drive, and a variance for an attached ADU at 23 September Drive — the last applicant has submitted a letter of withdrawal request.

zoningvariancesspecial-permitssetbackspublic-hearing
✓ Decidido: Zoning Board approves special permit for 32 Elm Street addition

The board unanimously approved the minutes from the February 19, 2026 meeting. It granted a special permit for the 32 Elm Street project despite the property’s setbacks. The board also approved a variance for 1A Overlook Drive to allow an addition that falls short of the required side‑yard setback. Finally, it accepted the applicant’s request to withdraw the 23 September Drive ADU application without prejudice. All votes were 3-0 in favor.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board of Appeals Agenda March 5, 2026, 7:30 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers and Zoom Platform A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID # 991 4613 9279 & Link: https://zoom.us/j/99146139279 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR 1. Chair to identify members participating remotely. 2. APPROVAL OF MINUTES February 19, 2026 3. TOPIC 1. 7:30PM : 32 Elm Street-Lauren Egan- Applicant is seeking to construct a 2-car garage, family room and a primary suite that is 31’ from the front lot line where 40’ is requir [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 553-4856 Fax: (508) 520-4906 1 Town of F ranklin Zoning Board of Appeals Thursday, March 5 , 2026 Meeting Minutes Chair Ginelle Lang called the above-captioned meeting held in the Town Council Chambers, second floor of the Franklin Municipal Building, 355 E. Central Street, and online via the Zoom platfor m to order this date at 7:30 PM. Members in attendance : Ginelle Lang, Chair; Jennifer Williams, Vice Chair; Isabella Carter, Clerk; Joseph Halligan , Associate; Meghan Whitmore, Associate (via Zoom) . Members absent: None. Also in attendance: Casey Thayer, Administrative Assistant; Gus Brown, Building Commissioner . The following was provided on the agenda and read aloud by Chair Lang . All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929- 205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Chair Lang r ead aloud the Zoom details as provided on the agenda. ANNOUNCEMENTS FROM THE CHAIR: Chair Lang announced Ms. Whitmore is attending the meeting via Zoom. All [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 4, 2026

Town Council

Franklin Town Council to vote on fire truck borrowing and town goals

The Town Council will discuss and vote on the 2026-2027 goals for the Town Administrator and the Council. The body will also consider borrowing funds for a new fire truck and the establishment of a charter review subcommittee.

budgetfire-departmentzoningtown-charterpublic-safety
✓ Decidido: School Committee approves FY27 superintendent budget with 2.5% increase

The School Committee reported that it unanimously approved the superintendent’s FY27 budget. The budget includes a 2.5 percent increase over the current budget. The approval follows more than $3 million in cost avoidance from recent school reorganization.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet March 4, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #871 0412 8201 & Link: https://us02web.zoom.us/j/87104128201 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING March 4, 2026 Link to FranklinTv YouTube Recording: 3/4/2026 Town Council Meeting A meeting of the Town Council was held on Wednesday, March 4, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Jane Callaway-Tripp, Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Michael LeBlanc, Stephen Malloy, Max Morrongiello, Kenneth Ojukwu. Councilors absent: None. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Mark Cerel, Town Attorney; Julie McCann, Operations Manager. Note: Documents for the Town Council are on file and provided in the online meeting packet. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:01 PM. He called for a moment of silence. All recited the Pledge of Allegiance. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 4, 2026

Board of Health

Board of Health to discuss tobacco product inspection violations

The Board of Health will meet to discuss tobacco product sale restrictions and inspection violations. The board will also receive updates on the Women’s Health Expo and reports regarding the Metacomet shared service grant.

public-healthtobacco-regulationhealth-servicesgrants
✓ Decidido: Board approves prior minutes and adjourns meeting, orders tobacco letters

The Board of Health approved the February 4, 2026 meeting minutes by a 3‑0 vote. It then voted 3‑0 to adjourn the March 4, 2026 meeting. The board directed that tobacco permit holders receive a letter about regulatory amendments and that the inspected retailers be re‑inspected in six months.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet March 4, 2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room meet.google.com/rhp-gqjw-wfv (US) +1 724-567-8219 PIN: 259 912 956# A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. February 4, 2026 NEW BUSINESS a. Restricting the sale of tobacco products inspection violations discussion b. Report My Meal Report My Meal | [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
BOH MEETING MINUTES March 4, 2026 In attendance: Chair, Kim Mu-Chow; Vice Chair, Jeff Harris; Member, Diane Daddario; Cathleen Liberty, Director; Ginny McNeil, Health Agent; Alicia Sullivan; Public Health Nurse, Kerry MacKay, Health Agent Guests: In person: Steve Sherlock, Virtual: Sarah McColgan CALL TO ORDER: ► Chair Mu-Chow called the meeting to order at 5:00 pm. CITIZENS COMMENTS: ►None APPROVAL OF MINUTES: ►February 4, 2026 ►MOTION to Approve the February 4, 2026 meeting minutes Diane Daddario. SECOND by Jeff Harris. No discussion. ►ROLL CALL VOTE: Mu-Chow-YES; Daddario-YES►Jeff Harris-YES VOTE: Yes-3, No-0-Abstain 0 NEW BUSINESS Restricting the sale of tobacco products inspection violations discussion Director Liberty noted that ten tobacco retail stores were inspected by the MHOA agent that we are contracted with on February 18, 2026. Three out of the ten have first and second violations within 36 months in which they are prohibited to sell tobacco products for a number of consecutive days as the Restricting the sale of tobacco products indicates. They are asking for leniency in regards to prohibiting the sale of tobacco products. There was much discussion but the board remains adhering to the violations indicated in the regulation. Chair Mu-Chow asked that the tobacco permit holders get a letter indicating the amendments to the Restricting the sale of tobacco products regulations and to have the retailers inspected again in si [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026

Franklin's 250th Anniversary Celebration Committee

Committee considers deposit for 2028 anniversary gala venue

The 250th Anniversary Celebration Committee is holding a special meeting via Zoom. The body will vote on authorizing a deposit to secure event space at Lake Pearl for a gala scheduled for November 3, 2028.

anniversaryeventslake-pearl
✓ Decidido: Committee approved $1,000 deposit for Lake Pearl gala venue

The committee voted unanimously to approve a $1,000 deposit to secure event space at Lake Pearl for the November 3, 2028 gala. The motion was made by Alan Earls and passed on a roll‑call vote. The meeting was then adjourned unanimously.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee (Special Meeting) Mar 3, 20267:30 PM Meeting will be held exclusively via Zoom A NOTE TO RESIDENTS: This meeting will be held remotely via Zoom. Members of the public may access the meeting using the Zoom information below. ZOOM DETAILS: ID # Meeting ID: 982 7897 3437 Passcode: 867400 ➢ Zoom Meeting Information: ➢ Meeting ID: 982 7897 3437 ➢ Passcode: 867400 ➢ https://zoom.us/j/98278973437?pwd=t7SbpoDid7Kec9O1U8anuH4pjInzj0.1 Agenda 1. Announcements from the chair 2. Vote to authorize a deposit to secure event space at Lake Pearl for the November 3, 2028 Gala 3. Adjourn
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee (Special Meeting) 250th Anniversary Celebration Committee Minutes March 3. 2026 7:30 PM Meeting was held exclusively via Zoom. Participants included Jayson Joyce, Alan Earls, Lyn Pickhover, Roberta Trahan, Deb Pellegri, Rob Browne, Julie Cornoni, Matt Keras, Ali Rheaume 1. Announcements from the chair 2. Matter for Discussion; A Vote to authorize a deposit to secure event space at Lake Pearl for the November 3, 2028 Gala This item produced a lengthy discussion with Lyn and Alan expressing some concerns about the cost and questioning whether a venue could be found in Franklin. This prompted considerable discussion with members of the Events subcommittee offering assurances and explaining their thinking and accounting thoughts. Alan eventually offered a motion to approve the deposit of $1,000 and this was approved unanimously on a roll call vote. 3. Adjournment was voted unanimously by roll call vote shortly after 8 pm.
Mon Mar 2, 2026

Library Board of Directors

Library board to discuss strategic planning and FY27 budget

The Franklin Public Library Board will discuss strategic planning, including approving a patron survey and reviewing staff visioning results and a SOAR worksheet. The Library Director will report on the FY27 budget and the hiring of a new Assistant Youth Services Librarian. The board will also consider revenue generation ideas.

library-boardstrategic-planningbudgetsurveyyouth-servicesrevenue
✓ Decidido: Board approved November minutes and scheduled March 3 library survey release

The board approved the minutes from the November meeting. They agreed to launch the patron satisfaction survey on March 3 for the month of March. The board confirmed that a Volunteer Appreciation Brunch will be held on May 2. The board noted that the $6,000 Nook Pods are not handicap accessible and will not be purchased for the library.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors Meeting March 2, 2026 7:00 PM Meeting Room Agenda 1. Call to Order 2. Public Comment Patrons are welcome to express their views for up to three minutes on a matter that is not on the agenda but relates to library concerns. The Board will not engage in a dialogue or comment on a matter raised during public comments. The Library Board will give remarks appropriate consideration and may ask the Library Director to review the matter. 3. Approval of Minutes 4. Report of Board members • Discussion o Strategic planning ▪ Approve patron survey ▪ Staff visioning session – Results ▪ SOAR worksheet o Revenue generation ideas 5. Library Director’s Report o FY27 Budget o New Assistant Youth Services Librarian 6. Agenda items for next meeting. March 30, 2026 7. Adjourn
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors Meeting Minutes March 2, 2026 Present: Charleen Belcher, Kathleen Gerwatowski, Amanda Rabbitt, Barbara Steele and Alison Wallace of the Board, and Library Director Felicia Oti. Call to Order: Charleen called the meeting at 7:01 p.m. Public Comment: Letha Heminway and Liz Pungitore of the Friends of Franklin Library joined the meeting. Minutes: The minutes of the November meeting were approved. The January meeting was canceled due to inclement weather. The February meeting was moved to March 2nd due to inclement weather. Report of the Board Members: Kathleen: Kathleen shared a bookmark from the Concord Public Library wth a QR code to complete their patron satisfaction survey. Felicia said they plan to use a QR code for the upcoming survey. Kathleen also shared a photo of the new Nook Pods at the Adirondack Club which cost $6000. Felicia noted that those Nook Pods are not handicap accessible so they would not be acceptable at the Franklin Public Library. However, she will look at the company’s website for other options. Charleen: Charleen is serving as treasurer of the town’s 250th Celebration Committee and shared that it requires a lot of time. She regrets that she is unable to attend the Friends’ meetings going forward, except perhaps occasionally, due to the time commitment of the committee. Library Director’s Report: Felicia asked about the distribution timing of the satisfaction survey. The Board agreed that the surv [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 2, 2026

Recreation

Franklin Recreation Department to meet March 2

The Recreation Department will meet to discuss fields, playgrounds, and program updates. The agenda consists of standard procedural items and general department updates.

recreationparkstown-management
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
RECREATION DEPT MEETING 235 WACHUSETT ST. TOWN OF FRANKLIN MONDAY MARCH 2, 2026 nn Penn 7:00 PM 2b FEB-S AI: Sy AGENDA: 1) CALL TO ORDER 2) APPROVAL OF MINUTES 3) PUBLIC COMMENTS 4) FIELDS AND PLAYGROUNDS 5) RECREATION PROGRAM UPDATE 6) FLETCHER FUND UPDATE 7) NEW BUSINESS 8) OLD BUSINESS 9) DISCUSSION 40) NEXT MEETING 41) ADJOURN WAYNE SIMARRIAN, CHAIRMAN
Mon Mar 2, 2026

Recreation

Recreation Department to discuss fields, programs, and Fletcher Fund updates

The Franklin Town Recreation Department holds a regular meeting with routine agenda items including fields and playgrounds, recreation program updates, and the Fletcher Fund. No specific proposals, votes, or dollar amounts are listed; the meeting primarily covers reports and public comments.

recreationfieldsplaygroundsfletcher-fundfranklin-town
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
RECREATION DEPT MEETING 235 WACHUSETT ST. MONDAY MARCH 2, 2026 7:00 PM AGENDA: 1) CALL TO ORDER 2) APPROVAL OF MINUTES 3) PUBLIC COMMENTS 4) FIELDS AND PLAYGROUNDS 5) RECREATION PROGRAM UPDATE 6) FLETCHER FUND UPDATE 7) NEW BUSINESS 8) OLD BUSINESS 9) DISCUSSION 10) NEXT MEETING 11) ADJOURN WAYNE SIMARRIAN, CHAIRMAN TOWN OF F TOWN CLERK (lb FEBS ALI 5y
Mon Mar 2, 2026

Recreation Advisory Board

Recreation Advisory Board holds procedural meeting with no major items

This agenda consists primarily of procedural items such as call to order, approval of minutes, and public comments. The board will discuss fields and playgrounds, receive a recreation program update, and review the Fletcher Fund update. No specific recommendations or votes are listed in the agenda.

recreationadvisory-boardfieldsplaygroundsprogramsfletcher-fundtown-of-franklinmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
RECREATION DEPT MEETING 235 WACHUSETT ST. MONDAY MARCH 2, 2026 7:00 PM AGENDA: 1) CALL TO ORDER 2) APPROVAL OF MINUTES 3) PUBLIC COMMENTS 4) FIELDS AND PLAYGROUNDS 5) RECREATION PROGRAM UPDATE 6) FLETCHER FUND UPDATE 7) NEW BUSINESS 8) OLD BUSINESS 9) DISCUSSION 10) NEXT MEETING 11) ADJOURN WAYNE SIMARRIAN, CHAIRMAN TOWN OF F TOWN CLERK (lb FEBS ALI 5y
Sun Mar 1, 2026

Franklin's 250th Anniversary Celebration Committee

Budget and Fundraising Subcommittee to draft 250th Anniversary budget

The Subcommittee on Budget and Fundraising is meeting to create a budget draft using data from February. The committee will also consider the approval of a fundraising letter.

anniversary-celebrationbudgetfundraising
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Budget and Fundraising March 1, , 2026 7:30 PM Meeting will be held virtually via Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair 2. Approval of minutes 3. Report of subcommittee members 4. Create budget draft based on data from February meeting 5. Approval of: ● fundraising letter 6. Agenda items for next meeting 7. Adjourn
Thu Feb 26, 2026

Franklin's 250th Anniversary Celebration Committee

Committee continues planning for 250th anniversary with guest speakers and subcommittee updates

The Franklin 250th Anniversary Celebration Committee will hear guest speakers from Easton 300 and Mass250, review subcommittee reports on budget, events, and communications, and discuss norms and historical importance. No votes or funding decisions are scheduled; the meeting is focused on continuing coordination for the anniversary.

anniversaryplanningsubcommitteesguest-speakersfranklin-townmass250
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
TOWN OF FRANKLIN “TOWN CLERK 12h FEB 2125Qth:Arqniversary Celebration Committee Agenda RECEIVED Feb 26, 2026 7:00 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 > Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. > Allspeakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair 2. Approval of minutes a. January 22, 2026 3. Accessibility norms (Ali) 4. Norms & values conversation 5. Guest speaker(s) invitation a. David Clifton (Easton 300) b. Sheila Green (MOTT, Mass250) 6. Subcommittee reports a. Budget/Fundraising Subcommittee lb. Events Subcommittee c. Communications Subcommittee 7. Historical Importance subcommittee (name, guests, deliverables) 8. Future agenda items & member comments 9. Adjourn
Thu Feb 26, 2026

Franklin's 250th Anniversary Celebration Committee

Franklin's 250th Anniversary Celebration Committee meets to discuss planning

The committee is meeting to discuss accessibility norms, values, and guest invitations. Members will receive reports from the budget, events, and communications subcommittees.

anniversarycommunity-eventsplanningtown-celebration
✓ Decidido: Committee creates new historical subcommittee and approves guest speaker

The committee approved the minutes from Jan. 22, 2026. It unanimously created a fourth subcommittee on historical topics. The members agreed to invite David Clifton to the next meeting, while postponing an invitation to Sheila Green. A motion to approve a $1,000 deposit for the 2028 gala was not seconded and therefore not approved.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
TOWN OF FRANKLIN “TOWN CLERK 12h FEB 2125Qth:Arqniversary Celebration Committee Agenda RECEIVED Feb 26, 2026 7:00 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j/97400088938?pwd=s9secLqi1anUmWbJZWPjGuzqYN3Mh4.1 > Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. > Allspeakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair 2. Approval of minutes a. January 22, 2026 3. Accessibility norms (Ali) 4. Norms & values conversation 5. Guest speaker(s) invitation a. David Clifton (Easton 300) b. Sheila Green (MOTT, Mass250) 6. Subcommittee reports a. Budget/Fundraising Subcommittee lb. Events Subcommittee c. Communications Subcommittee 7. Historical Importance subcommittee (name, guests, deliverables) 8. Future agenda items & member comments 9. Adjourn
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Approved Minutes Feb. 26. 2026 7:00 PM The meeting was held at the Municipal Building Training Room, E Central Street Members present: Robert Brown, Charleen Belcher, Roberta Trahan, Jayson Joyce, Lee Mulligan,Alan Earls, Maureen Brennan, Dan Brunelli, Julie Cornoni, Matt Keras, Debbie Pellegri, Participating remotely: Lynn Pickhover, Ali Rheaume, The Meeting came to order at approximately 7 pm ANNOUNCEMENTS FROM THE CHAIR ● Met with Pam Vickery, will have a form for smaller expenses for reimbursement ● OK to acknowledge member contributions as individuals but not with their company name. ● Met with State Rep. Jeff Roy. He had many thoughts. Wants to send us to MA 250 to perhaps integrate efforts. He ensured that $25 K of $50 K approved from state has been made available to the town ● Suggested Inviting MA 250 Sheila Green to our meeting (but by acclamation, those present decided ‘not right now’) ● Rob met with Dean Pres. Kulesza and was joined by new Dean appointee, Courtney Shimer. Kulesza is interested in getting students involved. Shimer will officially be voted onto the Committee at an upcoming Town Council Meeting. ● Rough Easton celebration budget was made available for comparison. APPROVAL OF MINUTES The minutes of Jan. 22, 2026 were approved by roll call vote PRESENTATION: ACCESSIBILITY NORMS Ali Rheaume walked the committee through a thorough discussion of signage and typogr [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 26, 2026

School Committee

Subcommittee meets for introductions and procedural items

The Franklin School Committee Horace Mann Legacy Sub Committee is meeting for procedural items only: call to order, welcome, and introduction of members. No substantive decisions or discussions are listed on the agenda.

franklin-public-schoolsschool-committeesubcommitteehorace-mann-legacyprocedural
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee February 26, 2026 2:30 PM Franklin High School Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/88067127402?pwd=tmTIzpAI8vZ1rggp1tFTbZDat0WDoO.1 Passcode:419792 Join via audio: +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Call to Order ● Welcome ● Introduction of Members
Thu Feb 26, 2026

Conservation

Conservation Commission to hear NOI presentation for 47 Partridge Street

The Franklin Conservation Commission will review multiple Notices of Intent (NOIs), including a presentation for 47 Partridge Street, and consider an appeal for 444 East Central Street. They will also discuss minor buffer zone activities, permit extensions, and certificates of compliance.

conservation-commissionnotice-of-intentappealbuffer-zonepermit-extensioncompliancefranklin-massachusetts
✓ Decidido: Commission unanimously continued three NOI hearings to March 12, 2026

The Conservation Commission voted 7‑0‑0 to continue the Notice of Intent hearings for the Nicholas Drive/Prospect Street culvert repair, the Symphony Drive/Tanglewood Estates project, and the 670 King Street development to March 12, 2026. No other actions were taken; the commission noted that the 670 King Street applicant must provide a DEP file number and updated fill plans before the next meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
1. Revised Conservation Agenda-2-26-2026 Documents: 2-26-2026 REVISED CONSERVATION AGENDA-2 PDF 2. 670 King Street NO! Documents: 670_KING_ST__PLAN_WITH_EROSION_BARRIER_THU_FEB_19 2026 14.23- 46.POF 3. Lewis Street NOI Documents: LEWIS ST NOI REVIEW 2026-02-13.PDF 4. 47 Partridge Street Documents: 2026-01-18 SITE PLANS 47 PARTRIDGE STREET. POF 2026-02-12 STORMWATER REPORT-47 PARTRIDGE STREET NOI.PDF 47 PARTRIDGE STREET NOI APPLICATION.POF 4.1. 47 Partridge Street NOI Presentation Documents: PRESENTATION GRAPHICS 47 PARTRIDGE STREET.POF 5. Minor Buffer Zone Activities Documents: MBZA ELM STREET POLE INSTALLATION NATIONAL GRID.POF 76 PLAIN STREET MBZA - TREE REMOVAL POF 6. Permit Extensions Documents: 47 SOUTHGATE ROAD 2023 SIGNED AND MAILED MBZA.POF 47 SOUTHGATE ROAD MBZA SITE PHOTOS.POF 47 SOUTHGATE ROAD MBZA NARRATIVE AND SITE PLANS.POF 6. 47 SouthGate Road - MBZA Extension Request Documents: 47 SOUTHGATE ROAD - MBZA EXTENSION REQUEST.PDF 7. Certificates Of Compliance Documents: 2026-02 CERTIFICATE OF COMPLIANCE REQUEST - 38 POND STREET (CE159-1201.PDF 8. 444 East Central Street-Appeal Documents: 2026-02-25 444 EAST CENTRAL STREET OOC APPEAL COPY CE159- 1320.PDF
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520-4906 1 Town of Franklin Conservation Commission February 26, 2026 Meeting Minutes As stated on the agenda, this meeting is only available to be attended via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number (cell phone or landline required) or citizens can participate by copying the provided link (phone, computer, or tablet required). This meeting will not be available for in-person attendance and can only be participated in using the Zoom platform. Commencement Chair Mark LePage called the above-captioned meeting to order this date at 7:00 PM as a remote meeting. Members in attendance: Mark LePage, Lui Puga, Michael Rein, Richard Johnson, Roger Trahan, Nicole Chiaramonte, Matthew Stoltz. Absent: None. Also present: Breeka Li Goodlander, Director of Conservation; Tyler Paslaski, Administrative Staff. Note: Documents presented to the Conservation Commission are on file. SCHEDULING None. PUBLIC HEARINGS Public Hearing – NOI – Nicholas Drive/Prospect Street Culvert Repair Chair LePage said there was a request for continuance. There was a motion made by Richard Johnson to continue the NOI for Nicholas Drive/Prospect Street Culvert Repair to March 12, 2026, at 7:01 PM. The motion was seconded by Michael Rein and accepted with a roll call vote of 7-0-0 (7-Yes; 0-No; 0-A [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 26, 2026

Legal Notices

Hybrid public hearing on subdividing 47 Partridge St into 8 lots with 7 homes

The Franklin Conservation Commission will hold a hybrid public hearing on Feb. 26, 2026 to consider a Notice of Intent to subdivide an existing lot at 47 Partridge Street into eight lots and build seven single‑family homes. The proposal includes work within wetland buffer zones and a riverfront area. The hearing will be conducted via Zoom and in‑person, and the public may comment on the project.

zoninghousingwetlandsdevelopmentpublic-hearing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, February 26, 2026 at 7:05 PM on a Notice of Intent filed by Chris Frattaroli of Goddard Consulting, LLC, Northborough, MA on behalf of Nancy Donovan of Donovan Family Realty Trust, Franklin, MA. The applicant is proposing to subdivide an existing lot into 8 separate lots and construct 7 new single family homes along with associated stormwater management utilities. Approximately 36,300 Square Feet (SF) of proposed work is within the 100-foot Buffer Zone to Bordering Vegetated Wetlands (BVW), of which approximately 5,961 SF is within the 25- to 50-foot Buffer Zone to BVW and 30,339 SF is within the 50- to 100-foot Buffer Zone to BVW. Additionally, approximately 9,575 SF of work is proposed within the 200-foot Riverfront Area. The Project is located at the end of 47 Partridge Street, Map 220, Lots 13, 14, and 15 within the Rural Residential II Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 25, 2026

Finance Committee

Finance Committee to discuss financing for new fire truck

The Finance Committee will meet to discuss financing options for a new fire truck costing $935,000 and review the FY27 budget forecast. The committee will also nominate members for the Joint Budget Sub Committee.

financebudgetfire-truckfiscal-forecastpublic-safety
✓ Decidido: Finance Committee approves Jan 14 minutes and appoints Joint Budget Subcommittee members

The committee unanimously approved the minutes from the January 14, 2026 meeting. It also unanimously confirmed the membership of the Joint Budget Subcommittee, naming the chair, vice chair, clerk, a regular member and an alternate. Both actions were recorded with roll‑call votes showing all present members voting Yes.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Wednesday, February 25, 2026 6:00 PM Franklin Municipal Building 355 East Central Street, 2nd Floor Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #820 7981 8365 & https://us02web.zoom.us/j/82079818365 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda 1. Call to Order 2. Public Comments - Citizens are welcome to express their views for up to three minutes on a matter that is not on th [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Finance Committee Meeting Minutes Wednesday, February 25, 2026 6:00 PM Franklin Municipal Building, Council Chambers, 355 East Central Street A meeting of the Finance Committee was held on Wednesday, February 25, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Members Present George Conley, Chair, Natalie Riley, Vice Chair, Christopher Diaz, Ryan Lavorgna, Jen D’Angelo Member Present Remotely John Barnes Member not Present Lauren Nagel Shannon Nealon Bill Batchelor (resigned effective 2/25/2026) Agenda 1. Call to Order SUMMARY: George Conley, Finance Committee Chair, called the February Finance Committee meeting to order. VOTE(S): [NONE] 2. Public Comments SUMMARY: Steve Sherlock, Franklin Matters, Franklin Public Radio, 13 Magnolia Drive, thanked the committee for their work and for proper use of microphones. He noted that another committee has been having issues with microphone use, which makes recordings difficult to listen to. He expressed appreciation that this committee uses their microphones properly, making recordings easy to listen to. VOTE(S): [NONE] 3. Approval of Minutes a. January 14, 2026 SUMMARY: Chair Conley asked for a motion to approve the [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 25, 2026

Council on Aging

Franklin Council on Aging to discuss hotel voucher donations and 2026 schedule

The Council on Aging will meet to review board meeting dates and the allocation of donations for hotel vouchers. The board will also discuss the Older Adult Lobby Day scheduled for May 6, 2026.

seniorsdonationshousinggovernment-administration
✓ Decidido: Council approved a motion (details not recorded) and set new meeting dates

The council approved a motion, though the minutes do not specify its content. It changed upcoming meeting dates to November 18 and December 16. Board members were directed to track their volunteer hours, and donation funds were earmarked for hotel stays for homeless individuals. The senior‑center budget was scheduled for discussion on April 6, and the Volunteer Appreciation Group will be merged into another committee.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Council on Aging Meeting Agenda February 25, 2026 11:00 AM Meeting will be held at the Franklin Senior Center 10 Daniel McCahill Street, Franklin, MA 02038 1. Call to order; 11:00 AM 2. Minutes of last meeting 3. Citizen’s Comments 4. Correspondence ● Testimonials 5. Director’s Report 6. Chairman’s Comments 7. FOFE Liaison Report 8. Old Business ● Board Picture - March 9. New Business ● Review 2026 COA Board Meeting Dates ● Board Members tracking their volunteer hours ● Donation Allocation for Hotel Vouchers ● Review meeting spreadsheet of Town Council, FinCom, and Office Hours ● Review Resource Guide for COA Board Members (MCOA) ● Older Adult Lobby Day: Wednesday May 6, 2026 11:30AM to 2:00PM 10. Committee Reports (tabled from October Agenda) ● Budget Committee ○ Set Meeting ● Bylaw Committee ○ Review finalized Senior Center Policies & Procedures ○ Updating COA Binder ● Expo Committee ● Housing Committee ○ Invite new housing director to come speak to board in March ● Nominating Committee ● Program Committee ● Supportive Day Committee 11. Comments 12. Agenda for Next Meeting 13. Adjournment Next Meeting: March 25, 2026 11:00AM
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Council of Aging Amended Minutes February 25, 2026 Franklin Senior Center Members Present: Lyn O’Brien (Chair), Phyllis Malcolm (Vice Chair), Faith Flaherty (Secretary), Kit Brady, Beth Sawyer, Kim Muchow, Roberta Trahan, Tina Powderly via audio : Excused–Jim Lane Also Present: Sarah Amaral (Director), Chasity Cheng (Deputy Director) via zoom, Called to Order: 11:01 AM Minutes of January 16, 2026 Amendments: Lyn O’Brien was excused, not absent. The Beatles were misspelled. Approved Motion: Kim Mu-Chow Second: Roberta Trahan Citizen’s Comments: None Correspondence: Testimonial from Mr. & Mrs. Long commending the work of the Senior Center and the Supportive Day program. Director’s Report: ● The Town Administrator put out his budget. The Town meeting of February 11, 2026 had some feisty moments over it. 1. No cuts in FY 27 2. Free cash not sustainable 3. Mixed acceptance ● The Director is sending FINCOM our budget. 1. GATRA $ 37,000 There are some issues with our Supportive Day clients to be discussed. 2. Senior Center supports the bus for ALL citizens. ● Capital request for Fire System to be approved. ● Facilities brought in new gym equipment. Signs giving directions to be installed. ● Custodial Meeting: 1. Conversation overdue 2. Cleaning schedule ● New appliances coming: 1. Convection oven. 2. New freezer over due. 3. Water heater (replaced by capital funds). 4. Tables needed for cafe. Quotes and other idea [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 25, 2026

Franklin's 250th Anniversary Celebration Committee

Committee will discuss plans for Franklin's 250th anniversary events

The 250th Anniversary Celebration Committee will review and approve the minutes from the January 20, 2026 meeting, discuss reports on proposed anniversary events, and consider the meeting schedule going forward.

eventsanniversarycommunityplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Events & Logistics Agenda February 25, 2026 7:30 pm Meeting will be held at the Franklin Municipal Building-3rd Floor Training Room 355 East Central Street with Hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom... ZOOM WEBINAR DETAILS: https://zoom.us/j/97743314781? pwd=z5|AQUG@sOJIINVIyloAWw4VpvskoT4.] > Any participants who wish to speak during the webinar must enter their fullname and email address when joining the webinar. > All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand" function to request to be unmuted. > All speakers will be required to state their full name and street address before commenting Agenda 1. Call to order: Sub Committee chair Roberta Trahan called the meeting to order 2. Review and approve the minutes from our January 20, 2026 Meeting 3, Discussion of events/reports from Sub Committee Members: Anniversary Bell Ringing Interfaith gathering Library event Donor Event/Party Opening Gala Parade: 9/16/2028 Golf Tournament: June 2028 Family Fun Day/Picnic: ? July/August 2028 Closing Gala: November 4, 2028 Toa *O9 2050 ® 4, Discussion of meeting cadence 1. ADJOURN
Tue Feb 24, 2026

School Committee

Franklin School Committee to vote on $72.3M FY27 budget

The Franklin School Committee will vote on the FY27 School Budget of $72,341,254.00 and adopt the 2026-27 School Calendar. The agenda also includes acceptance of a $13,500 gift from the FMS PCC for field trips, approval of minutes, and reports from sub-committees and liaisons.

budgeteducationschool-committeecalendargifts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee February 24, 2026 Municipal Building – Council Chambers 6:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/82282121288?pwd=knM8IUM4bPz7waugBd4394P9O7jAux.1 Passcode:289054 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 669 444 9171 US +1 689 278 [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 24, 2026

Massachusetts Strategic Health Group

Meeting agenda contains no legible text

The provided agenda consists of numerical codes and delimiters. There are no legible items, decisions, or discussions listed in the record.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
/i255/i255/i255/i255/i255/1/2/3/3/2/4/5/6/3/7/8/8/3/i255/i255 /i255/i255/i255/i255/10/11/12/13/11/14/15/16/17/i255/18/14/13/19/11/20/i255/21/12/22/23/24/i255 /i255 /25/26/27/28/29/30/31/28/i255/33/34/35/36/36/37/i255/38/39/40/41/30/31/28/i255/33/34/35/36/42/37/i255/43/31/39/30/44/26/39/27/45/29/46/i255/33/34/35/36/36/37/i255/47/46/48/49/50/46/30/31/28/i255/33/34/35/36/51/37/i255 /52/53/54/52/i255/33/34/35/36/36/37/i255/55 /46/45/56/40/57/i255/33/34/35/36/36/37/i255/43/53/58/59/i255/33/34/35/36/51/37/i255/60 /46/26/61/30/46/39/i255/33/34/35/62/63/37/i255/i255 /59/52/53/58/59/i255/i255/33/34/35/62/63/37/i255/55 /46/39/39/27/48/40/64/i255/33/34/35/36/42/37/i255/58/40/50/27/61/26/65/39/57/i255/33/34/35/36/42/37/i255/i255 /66/39/40/28/67/50/27/28/i255/33/34/35/36/36/37/i255/55 /68/53/58/59/i255/33/34/35/36/51/37/i255/58/69/70/53/58/59/i255/33/34/35/36/42/37/i255 /i255 /i255/i255/i255/i255/i255/i255 /i255 /72/13/73/73/13/17/20/23/73/14/11/11/73/i255/10/11/12/13/11/14/15/16/17/i255/18/14/13/19/11/20/i255/21/12/22/23/24/i255 /74/75/76/77/78/i255/1/79/79/80/81/82/83/i255 /8/84/79/85/78/76/86/87/i255/88/79/89/90/i255/91/92/87/i255/91/93/91/94/87/i255/76/80/i255/95/96/93/93/i255/97/1/i255 /98/99/100/101/102/103/i255/105/106/101/107/i255/108/102/109/109/i255 /95/110/110/i255/111/81/112/112/76/83/79/i255/3/80/77/79/79/80/87/i255/1/79/78/113/76/86/i255/1/2/i255/93/91/93/110/114/i255 /115/116/117/118/i255/120/121/122/i255/123/122/122/120/117/118/124/i255/118/116/125/i255 /127/128/128/129/13 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 23, 2026

Planning Board

Franklin Planning Board meeting for February 23, 2026, is cancelled

The February 23, 2026, Planning Board meeting was cancelled due to weather. No decisions were made on the scheduled items.

planning-boardzoningsubdivision
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cancelled due to Weather FRANKLIN PLANNING BOARD Agenda & Meeting Packet February 23, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the m in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the l ink https://us02web.zoom.us/j/84972893187 or c all on your phone at 312- 626-6799, meeting #84972893187 PUBLIC HEARINGS 1. 4 7 Partridge Street (Donovan Estates) – Definitive Subdivision Definitive Subdivision Plans – Revised Correspondence 2. Sy mphony Drive (Tanglewood Estates II) - Private Definitive Subdivision To Be Continued GENERAL BUSINESS: A. Discussion: Future Zoning amendments B. 81-P ANR: 78 & 79 Populatic Street T his agenda is subject to change. The next meeting of the Planning Board is scheduled for March 9, 2026.
Mon Feb 23, 2026

Agricultural Commission

Ag Commission to discuss farmer interviews and Earth Day event

The Franklin Agricultural Commission will meet online to approve minutes from January 26, 2026, and discuss new business including a proposal to post presentations online. The agenda also covers old business such as the Earth Day event, a meeting for landowners, and assignments for interviewing local farmers.

agricultureearth-dayfarmer-interviewslandownersminuteszoomtown-meeting
✓ Decidido: Commission unanimously approves linking its PPP to town website

The minutes from the January 2026 meeting were unanimously accepted. The commission unanimously approved Jen Anderson Sweeney's proposal to link the Agricultural Commission PPP to the town website, pending town approval. The commission decided to partner with the Conservation Commission and Fairmount Farm for the 2026 Earth Day event and to host an informational meeting for owners of five‑acre properties on April 22. Members also agreed on interview questions for local farmers and will each conduct one or two interviews.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 2/23/2026 7:00pmA NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded.ZOOM MEETING DETAILS: Topic: Ag Com Time: Feb 23, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/85028019368 Meeting ID: 850 2801 9368 One tap mobile +16465588656,,85028019368# US (New York) +16469313860,,85028019368# US Join instructions https://us02web.zoom.us/meetings/85028019368/invitations?signature=dr0_ET_XkXiGGxUeEuDG6MeAnWH5jqHkI7mE-fcJRasParticipants will be automatically muted upon entry but can un-mute themselves by pressing*6 Participants joining by phone will be able to listen to the meeting and speak when l. Approval of the minutes - from January 26, 2026 meeting ll. New Business: A. Proposal to Attach and Link our new Franklin Ag Com PowerPoint Presentation to Town Website and Facebook Page- AgCom PowerPoint lll. Old Business: A. Earth Day Event- B. Meeting for Owners of 5+ Acres of Land in Franklin- Council Chambers is reserved for this meeting on Wednesday, 4/22, from 7pm-9pm C. Meeting with Town Administrator- March 5th 10:00 -11:00 at the Municipal Building D. Ag Commission Brochure Status- E. Franklin Farmer Interviews- 1. Decision on Questions to Be Asked. 2 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Agricultural Committee Meeting February Minutes - February 23, 2026 In Attendance: Franklin Agricultural Commission: Marian Szymanski, CJ Koshivas, Benjamin Rousseau, Matt Stolz, and Jen Andersen Sweeney. Also present: Mark LePage, Roger Trahan and Breeka Li Goodlander from the Franklin Conservation Commission. Call to Order: The Meeting was called to order at 7:02 PM by Marian Szymanski Acceptance of the Minutes: The Minutes from our January 2026 Meeting were unanimously accepted. New Business: A. Proposal to Link Ag Commission PPP to Town Website: Ag Commission member, Jen Anderson Sweeney explained her proposal. The Commission unanimously approved her suggestion, contingent on the Town’s approval. Old Business: A. Earth Day 2026 Event: The Agricultural Commission will partner with the Conservation Commission and Fairmount farm for this event. The Con Com members will have an information table and will lead tours of local conservation land. An assortment of local vendors will have tables for an earth Day farmer’s Market, and residents can create birdfeeders and bug hotels, plant seeds, learn about soil, and enjoy some adorable baby goats! B. Event For 5+ Acre Property Owners: The Agricultural Commission will host an informational event on April 22, from 7 to 9, in the Municipal Building’s Council Chambers. Franklin residents – especially property owners of five acres or more- will be invited to learn more about the benefits of the Chapter 61 Program [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 23, 2026

Library Board of Directors

Library Board to discuss strategic planning and FY27 budget

The Library Board of Directors will meet to review strategic planning materials and revenue generation ideas. The board will also receive reports on the FY27 budget and a new Assistant Youth Services Librarian.

librarystrategic-planningbudgetstaffing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors Meeting February 23, 2026 7:00 PM Meeting Room Agenda 1. Call to Order 2. Public Comment Patrons are welcome to express their views for up to three minutes on a matter that is not on the agenda but relates to library concerns. The Board will not engage in a dialogue or comment on a matter raised during public comments. The Library Board will give remarks appropriate consideration and may ask the Library Director to review the matter. 3. Approval of Minutes 4. Report of Board members • Discussion o Strategic planning ▪ Approve patron survey ▪ Staff visioning session – Results ▪ SOAR worksheet o Revenue generation ideas 5. Library Director’s Report o FY27Budget o New Assistant Youth Services Librarian 6. Agenda items for next meeting. March 23, 2026 7. Adjourn
Thu Feb 19, 2026

Legal Notices

Public hearing on two new utility poles on Dean Ave. and Elm St.

The Town of Franklin will hold a public hearing on two pole petitions submitted by Massachusetts Electric Company d/b/a National Grid and Verizon New England, Inc. The petitions request installation of a new JO pole on Dean Avenue and a new 50‑ft JO Class H1 mid‑span pole on Elm Street. Attendees may join in person at the Council Chambers or remotely via Zoom.

pole-petitionsutilitiespublic-hearinginfrastructuretown-government
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITIONS (2) PUBLIC HEARING February 19, 2026, 1:00pm 1. DEAN AVE: Pole Petition Plan #31239004 - Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. National Grid proposes to install one new JO Pole (# P15-50) on Dean Ave., beginning approximately 55 ft. North of the centerline of the intersection of Hillside Rd. and Fales St. and continuing in a North direction. 2. ELM ST: Pole Petition Plan #31246278 - Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. National Grid proposes to install one new 50 ft. JO Class H1 Mid-span Pole (# P2-50) on Elm St. beginning approximately 460 ft. West of the centerline of the intersection of Lincoln St., between Poles P2 and P3. Pole will be located on Town property intersected by Lincoln St. and Jeffrey Rd. A Public Hearing will be held in the Council Chambers on the second floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Thursday, February 19, 2026 at 1:00 p.m. upon the two pole petitions described above. All citizens are welcome to attend public meetings in person. Additionally, in an effort to maximize citizen engagement opportunities, citizens will also be able to participate remotely via Zoom using the foll [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 19, 2026

Zoning Board of Appeals

Variance hearing for attached ADU at 23 September Drive

The Zoning Board of Appeals will hold a public hearing on a variance request for an attached ADU with garage at 23 September Drive, where the proposed structure is 15.5 feet from the right side yard setback instead of the required 40 feet. The applicants, Timothy and Jenny McGee, are also requesting a continuance to March 5, 2026. The board will also approve minutes from December 23, 2025 and January 22, 2026, and conduct general business.

zoningvarianceaduaccessory-dwelling-unitboard-of-appealsfranklin-massachusetts
✓ Decidido: Zoning Board denies ADU permit and postpones hearing to March 5

The board approved the minutes from the December 23, 2025 and January 22, 2026 meetings. It denied the building permit for Timothy and Jenny McGee’s proposed attached ADU on 23 September Drive because the setback was less than required. The board voted to continue the hearing on that application to March 5, 2026 at 7:40 PM. The meeting was then adjourned.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board of Appeals Agenda February 19, 2026, 7:30 PM Meeting will be held Zoom Platform ONLY A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID # 943 1239 9467 & Link: https://zoom.us/j/94312399467 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2. APPROVAL OF MINUTES December 23, 2025 January 22, 2026 3. TOPIC a. 7:30PM : 23 September Drive – Timothy and Jenny McGee Applicant is seeking to construct an attached ADU with a garage that is 15.5’ from the right side yard setback where 40’ is required. The building permit is denied without a variance f [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 553-4856 Fax: (508) 520-4906 1 Town of Franklin Zoning Board of Appeals Thursday, February 19, 2026 Meeting Minutes Chair Ginelle Lang called the above-captioned meeting held via Zoom platform only to order this date at 7:30 PM. Members in attendance (all via Zoom): Ginelle Lang, Chair; Jennifer Williams, Vice Chair; Isabella Carter, Clerk; Joseph Halligan, Associate; Meghan Whitmore, Associate. Members absent: None. Also in attendance: Casey Thayer, Administrative Assistant. The following was provided on the agenda and read aloud by Chair Lang. All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number provided on the agenda. To participate in the meeting remotely citizens may join Zoom using the information provided on the agenda. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. Chair Lang read aloud the Zoom details as provided on the agenda. ANNOUNCEMENTS FROM THE CHAIR: Chair Lang said the reason they are meeting only via Zoom this week is that the only items for review on the agenda are minutes, and we do have one item on the agenda we are going to b [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 19, 2026

Pole Petition Hearing

Two new utility poles proposed on Dean Ave and Elm St

The Town Administrator will hold a public hearing on two pole petitions from National Grid and Verizon. The first proposes a new joint pole on Dean Ave near Hillside Rd and Fales St. The second proposes a new 50-ft pole on Elm St west of Lincoln St on town property.

polesutilitiespublic-hearingnational-gridverizonfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION HEARING AGENDA February 19, 2026 1:00 PM Pole Petition Hearing will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. Additionally, residents are also welcome to participate remotely via Zoom. ZOOM WEBINAR DETAILS: I D # 869 5728 2008 & Link: https://us02web.zoom.us/j/86957282008 Call-In Phone Number: 1-929-205-6099, enter Meeting ID then # ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Pole Petition Plan #31239004: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. DEAN AVE. National Grid proposes to install one new JO Pole (# P15-50) on Dean Ave., beginning approximately 55 ft. North of the centerline of the intersection of Hillside Rd. and Fales St. and continuing in a North direction. 2. Pole Petition Plan #31246278: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. ELM ST. National Grid proposes to inst [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026

Design Review Commission

Design Review Commission to review three new business proposals

The Design Review Commission will hold a virtual meeting on February 17, 2026, to review design proposals for three new businesses: INS Spa at 4 Main Street, Aesthetics Lounge at 9 Summer Street, and Bar Pizza & Salad Co at 384 Union Street. The commission will also approve minutes from the January 20, 2026 meeting.

design-reviewbusiness-permitsfranklin-ma
✓ Decidido: Design Review Commission approves wall sign for Bar Pizza & Salad Co.

The commission approved the sign package for INS Spa at 4 Main Street and the Aesthetics Lounge at 9 Summer Street, each by a unanimous 5‑0 vote. It also approved the awning portion of the Bar Pizza & Salad Co. sign package at 384 Union Street by 5‑0, and approved a 48 sq ft wall‑sign painting for the same location by a 4‑1 vote. The minutes from the January 20 meeting were approved and the meeting was adjourned, both unanimously.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams , Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda February 17, 2026 Virtual Meeting 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: Feb 17, 2026 07:00 PM Eastern Time Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/89292820537 Phone one-tap: (929) 205-6099, Meeting ID: 892 9282 0537# 1. New Business a. 4 Main Street- INS Spa b. 9 Summer Street- Aesthetics Lounge c. 384 Union Street- Bar Pizza & Salad Co 2. Meeting Minutes a. January 20, 2026 3. New Business/Old Business
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4907 Fax: (508) 520-4906 Town of Franklin Design Review Commission Tuesday, February 17, 2026 Meeting Minutes Chair Sam Williams called the above-captioned meeting to order this date at 7:05 PM, as a remote access virtual Zoom meeting. This meeting was recorded. The following is stated on the agenda: Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided on the agenda. Members in attendance: Chair Sam Williams, Vice Chair Andrew Pratt, Derek Darvish, Kyle Galvin, Associate Priya Natarajan. Members absent: Associate James Bartro. Also present: Morena Zelaya, Director of Planning & Community Development. NEW BUSINESS: a. 4 Main Street - INS Spa Mr. Cam Afonso of Signs by Cam stated the previous business is gone, and this new place is going in. They are replacing the same size sign and same kind of make with the tube frame. They will be three-dimensional letters, 4 in. thick PVC. They are under what they are allowed. No comments from Commission members. Motion: To Approve the sign package as submitted. Motioned by A. Pratt. Seconded by K. Galvin. Roll Call Vote: Natarajan-YES; Galvin-YES; Darvish-YES; Pratt-YES; Williams-YES. Voted 5-0 (5-Yes; 0-No). 9 Summer Street - Aesthetics Lounge Mr. Cam Afonso of Signs by Cam stated they are making a faux cover to cover the whole wall area. It is about a | [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026

Charles River Pollution Control District (CRPCD)

Executive session on NPDES permit appeal litigation strategy

The CRPCD will hold an executive session to discuss litigation strategy for the 2025 NPDES Permit Appeal. The board will also receive updates on the I-495 Pump Station Force Main Design Phase 2 and the FY 2027 Budget Estimate. Action items include approval of Warrant 26-08 totaling $350,108.96 for operations and capital.

executive-sessionlitigationnpdes-permitbudgetwastewaterinfrastructureintergovernmental
✓ Decidido: District approved Warrant #26-08, allocating $337,706.84 O&M and $12,402.12 capital

The board unanimously approved entering an executive session to discuss strategy for the 2025 NPDES permit appeal. It also unanimously approved Warrant #26-08, authorizing $337,706.84 for operations and maintenance and $12,402.12 for capital projects. The minutes from the January 15 meeting were approved, and the meeting was adjourned. No other formal votes were taken; budget estimates and water‑quality updates were presented for information only.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING FEBRUARY 17, 2026 at 4:00 P.M. CONFERENCE ROOM AGENDA 1. Executive session to discuss strategy with respect to the following litigation matters, as an open session may have a detrimental effect on the litigating position of the public body: a) 2025 NPDES Permit Appeal 2. Update on the I-495 Pump Station Force Main Design Phase 2 3. Update on FY 2027 Budget Estimate 4. Approval of Warrant 26-08 a) O & M $ 337,706.84 b) Capital $ 12,402.12 5. Engineer’s Report a) Sludge Report b) Garelick Farms Report 6. Executive Director’s Report a) Sewer Connections (January 2026) - None b) NPDES Permit Compliance Report (January 2026) c) Update on Copper at the Treatment Plant d) Update on Sale of Capacity Discussions Between Franklin and Millis e) Update on Meeting with Beyond the Dome 7. Public Comment 8. Approval of Minutes from the January 15, 2026 Monthly Meeting 9. Anticipated Topics for the Wednesday, March 11, 2026 Monthly Board Meeting at 3:00 pm a) Discussion and Vote on FY 2025 Audit with Renee Davis from CBIZ b) Update on Town Flows for Calendar Year 2025 c) Discussion and Vote on FY 2027 Budget
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
CHARLES RIVER POLLUTION CONTROL DISTRICT 66 Village Street, Medway, MA 02053 Minutes from February 17, 2026 Monthly Meeting - 4:00 p.m. The meeting was held in the John McCahill Conference Room at the District’s treatment facility. In attendance were Chairman David C. Formato, District Commissioners Ted Kenney, Douglas M. Downing and Mark Cataldo, Executive Director Elizabeth Taglieri, Engineer Kristen Mucciarone and Executive Secretary Barbara W. Maffeo. Commissioner Wolfgang Bauer was not in attendance. The following attachments were presented during the monthly meeting and are on file at the District with the approved minutes. e Year to Date O & M Budget versus Actual July 2025- January 2026); © O&M Budget Prior Year Comparison (July 2024 - January 2025 vs July 2025 - January 2026); | e Septage Revenue Prior Year Comparison July 2024 - January 2025 vs July 2025 - January 2026); e Sewer connections January 2026); e Copy of Preliminary Estimates on FY 2027 Budget dated February 12, 2026; e Overview of FY 2026 Spending dated February 17, 2026; e Copy of Credit Card Expenses Statement for Harbor One Credit Card-Elan Financial dated January 8, 2026 - February 5, 2026; e Handout reflecting Summary of Kleinfelder |-495 Pump Station force Main Alternative 1A Design - Phase 2 Proposal dated February 12, 2026; e Copy of Draft January 15, 2026 Monthly Meeting Minutes; e Copy of Warrant #26-08 dated February 17, 2026. Item #1 - Executive Session to discuss strategy with respect to [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026

Legal Notices

Conservation Commission to hear garage project in wetland buffer zone

The Franklin Conservation Commission will hold a hybrid public hearing on a Notice of Intent for work at 670 King Street. The applicant proposes to remove an existing pool and build a detached garage, with about 850 square feet within the 100-foot buffer zone to bordering vegetated wetlands.

conservationwetlandspublic-hearingzoningbuffer-zone
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, February 12, 2026 at 7:06 PM on a Notice of Intent filed by Russell E. Waldron of Applied Ecological Services, Norfolk, MA on behalf of Michael Davis, Franklin, MA. The applicant is proposing to remove the existing pool and construct a detached garage. Approximately 850 Square Feet (SF) of proposed work is within the 100-foot Buffer Zone to Bordering Vegetated Wetlands (BVW), specifically within the 50- to 100-foot Buffer Zone to BVW. The Project is located on 670 King Street, Map 313, Lot 65, within the Single Family III Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to access the meeting. All records and files for this project can be viewed at the Conservation Office located on the first floor of the Franklin Municipal Building. Any person or organization so wishing will be afforded an opportunity to be heard. The hearing location is accessible to persons [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026

Legal Notices

Conservation Commission to hold public hearing on proposed home at Lewis St.

The Conservation Commission will conduct a hybrid public hearing on Thursday, February 12, 2026 at 7:07 PM to consider a Notice of Intent filed by Norman Hill of Land Planning, Inc. on behalf of Tony Marinella of Lewis Street Realty, LLC. The proposal seeks to build a new single‑family home and access improvements on Lots 113 and 114 at the end of Lewis Street, within the Single Family IV zoning district. About 5,820 sq ft of the work lies within wetland buffer zones, including 1,559 sq ft in the 25‑ to 50‑ft zone and 4,261 sq ft in the 50‑ to 100‑ft zone. The hearing will be held via Zoom and in‑person at the Council Chambers, 355 East Central Street, and the public may comment.

zoningwetlandshousingpublic-hearingconservation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, February 12, 2026 at 7:07 PM on a Notice of Intent filed by Norman Hill of Land Planning, Inc., North Grafton, MA on behalf of Tony Marinella of Lewis Street Realty, LLC, Franklin, MA. The applicant is proposing to construct a new single family home along with access improvements to the lot. Approximately 5,820 Square Feet (SF) of proposed work is within the 100-foot Buffer Zone to Bordering Vegetated Wetlands (BVW), of which approximately 1,559 SF is within the 25- to 50-foot Buffer Zone to BVW and 4,261 SF is within the 50- to 100-foot Buffer Zone to BVW. The Project is located at the end of Lewis Street, Map 298, Lots 113 and 114, within the Single Family IV Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to access the meeting. All records and files for this project can be viewed at the Conservation Office located on the first floor of the Franklin Municipal [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026

Benjamin Franklin Classical Charter Public School

Board of Trustees to hold new trustee elections

The Board of Trustees will meet virtually to conduct new trustee elections and review a school calendar presentation. The meeting includes updates from the Executive Director, Head of School, and various committees. The session will conclude with an executive session.

educationgovernanceschool-boardelections
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOL February 12th BOARD OF TRUSTEES MEETING Thursday, February 12, 2026 7-10pmVirtual MeetingGoogle Meet joining infoVideo call link: meet.google.com/ovq-sxxk-eheOr dial: ‪(US) US‬)‪+1 413-276-7715PIN: 960522951===================================7:00Call to Order 7:05Open Comment Period7:10Review and vote on meeting minutes from 1/8/26 meeting 7:15 ED Update7:35HOS Update7:40 Faculty Rep Update7:45BFEF Update7:55New Trustee Elections8:00School Calendar Presentation8:05Prospective Counsel Presentations9:05Committee Updates-DEIB-Facilities-Finance-Governance-HR-Mission9:30Task List9:35Adjourn to Executive Session10:00 Executive Session AdjournmentThe scheduled times as listed are approximate.
Thu Feb 12, 2026

Municipal Affordable Housing Trust

Trust to discuss Subsidized Housing Inventory and finance update

This meeting includes a trust finance update, approval of January 8 meeting minutes, and discussions on trust history and the Subsidized Housing Inventory (SHI). No votes or decisions are specified.

affordable-housingfinancemeetingsubsidized-housing-inventorytrust
✓ Decidido: Trust unanimously approved prior meeting minutes

The Franklin Town Municipal Affordable Housing Trust approved the minutes from the January 8, 2026 meeting. The board then adjourned the February 12, 2026 meeting. No other formal actions or approvals were recorded.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda February 12, 2026 Virtual 2pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Municipal Affordable Housing Trust Fund will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: Feb 12, 2026 02:00 PM Eastern Time Topic: Franklin Municipal Affordable Housing Trust Fund Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/89339667291 Phone one-tap: (312) 626-6799. Meeting ID: 89339667291 1. Trust Finance Update 2. Meeting Minutes a. January 8, 2026 3. New Business/Old Business a. Trust History Discussion b. SHI Discussion
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Meeting Minutes February 12, 2026 Call to order: Zoom Meeting called to order at 2:04pm by Chair Chris Vericker. Trust Members present were: Chair Chris Vericker, Member Kimberly Mu-Chow, Secretary Susan Younis, Member Mark Minnichelli and Town Administrator/Member Jamie Helen. Additional attendees were Planning & Community Development Director Morena Zelaya. Meeting Minutes: Minutes from January 8, 2026: have been presented for review and approval. Minnichelli made a motion to approve the minutes. Younis seconded. Vote: Sue Younis: yes, Chris Veriker: yes, Jamie Hellen: yes, Kim Mu-Chow: yes, Mark Minnichelli: yes. Update on financial condition of the Trust: Called on by Chris Veriker Morena Zelaya, Director of Planning and Community Development- provided update As of November 26, 2025: current balance is: $1,116,679.53. $500,000 has been set aside for Franklin Ridge Senior project. Three requisitions have been made to date: (1st) requisition for $98,404, (2nd) for $72,434, (3rd) for $38,923. Those have been paid out. There is currently an additional requisition that has been signed off on but not paid out to date. The Trust portion is $27,013. Veriker: My question for Jon Juhl going forward is, I know we have a $500,000 allocation, how does that get distributed and how/when is the Trust stepping up? Contex [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026

Cultural District Committee

Cultural District Committee reviews grant status and plans for May beautification

The Franklin Cultural District Committee will discuss updates on the MCC FY2026 Cultural District Investment Grant, district initiative timelines, and ambassador assignments. The committee will also hear from the Director of Arts on a Fairy/Beautification brainstorm for May and a World Cup 2026 update. Additionally, the 250th Anniversary Celebration Committee will provide an update. No voting items are listed, making this primarily an informational and planning meeting.

cultural-districtgrantsartsworld-cupanniversaryfranklin-ma
✓ Decidido: Committee approved the January 15, 2026 meeting minutes

The Cultural District Committee approved the minutes from the January 15, 2026 meeting with no amendments. No other votes or decisions were taken at this meeting. The next committee meeting is scheduled for March 12, 2026.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee Meeting Thursday, February 12, 2026, 7:00 pm Franklin Historical Museum, 80 West Central St., Franklin AGENDA A. Welcome B. Review and Approval of the Meeting Minutes o January 15, 2026, Cultural District Meeting C. Updates from Cultural District Chair, John LoPresti o MCC FY2026 Cultural District Investment Grant Status o FCD Cultural District Initiatives Timelines o District Initiative Ambassador Assignments o MCC future funding D. Updates Department of Arts, Culture & the Creative Economy, Cory Shea, Director o Fairy/Beautification Brainstorm for May o World Cup 2026 Update E. 250th Anniversary Celebration Committee, Roberta Trahan, Cultural District Representative o Update Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include: Items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/Feedback Adjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: February 3, 2026 Posted: Sent to Town Clerk on February 5, 2026
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Cultural District Committee Meeting Minutes | February 12, 2026 Meeting Name: Cultural District Committee Meeting Date: February 12, 2026 Time: 7:00-9:00 pm Location: Franklin Historical Museum Chairperson: John LoPresti Secretary: Katherine Botelho 1. Call to Order ● Time: 7:01 p.m. ● Chairperson: John LoPresti ● Attendance: ○ Present Members: ■ John LoPresti ■ Pandora Carlucci ■ Peter Rochat ■ Roberta Trahan ■ Patrick Conlon ■ Sue Cass ■ Katherine Botelho ■ Absent Members: ■ None ○ Guests/Other Attendees: ■ Cory Shea, Director of Arts, Culture and the Creative Economy ■ Maxwell Morrongiello, Franklin Town Council ■ Gino Carlucci, Sons & Daughters of Italy ■ Mitzi Gousie, Franklin Public Library ■ Margaret Munson, Franklin Art Association ■ Alan Earls, Franklin Historical Commission 2. Approval of Previous Meeting Minutes ● Minutes from January 15, 2026 ○ Approved: Yes ○ Amendments: No 3. Agenda Items from February 12 Meeting: a. Updates from the Chairperson ● Chairman LoPresti confirmed that all of the MCC grants funds will be used for specific initiatives approved by the committee. Those initiatives include marketing funds for Porch Fest. He reported that one long term goal is for more displays of outdoor art. ● LoPresti asked vice-chairman Carlucci to report on planned cultural weekends. She stated the weekends will provide opportunities to experience more than one event per weekend. Funds will be used for wayfindi [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026

Conservation

Conservation Commission reviews site plans for King Street and Lewis Street

The Conservation Commission is meeting to review Notice of Intent (NOI) applications and site plans for several properties. The body will also consider requests for minor buffer zone activities.

conservationzoningland-useenvironmental-protection
✓ Decidido: Commission approved tree removal at 912 Washington Street

The Conservation Commission approved the Minor Buffer Zone Activity to remove dangerous trees at 912 Washington Street with a unanimous 7‑yes vote. The commission also voted to continue the Notice of Intent for the Nicholas Drive/Prospect Street culvert repair to February 26, 2026, unanimously. A similar unanimous continuation was approved for the Symphony Drive/Tanglewood Estates project to the same date. The NOI for the 670 King Street garage project was also continued to February 26, 2026 with a 7‑yes vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Revised Conservation Agenda Documents: 2-42-2026 REVISED CONSERVATION AGENDA PDF 670 King Street Documents: 2026 NOI APPLICATION 670 KING STREET.PDF 2026-01-27 SITE PLAN 670 KING STREET.POF 25110PROJDESC.POF . Lewis Street Documents: LEWIS STREET NOI SITE PLAN.POF NOI APPLICATION - LEWIS STREET.POF 4. Minor Buffer Zone Activities Documents: 76 PLAIN STREET MBZA - TREE REMOVAL POF MBZA APPLICATION 912 WASHINGTON NEW.PDF 5. Discussions Documents: BP_FRANKLIN_MA_CP-1_01-29-26 PDF BP_FRANKLIN_MA_CP-1_GRADING_01-29-26.PDF
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520-4906 1 Town of Franklin Conservation Commission February 12, 2026 Meeting Minutes As stated on the agenda, this meeting is available to be attended in person and via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or citizens can participate by using the Zoom link provided on the agenda. This meeting will be held in the Town Council Chambers on the Second Floor of the Municipal Building for citizens wishing to attend in person. Commencement Chair Mark LePage called the above-captioned meeting to order this date at 7:00 PM as a remote/virtual/in-person meeting. Members in attendance: Mark LePage, Lui Puga, Michael Rein, Richard Johnson, Roger Trahan, Nicole Chiaramonte (via Zoom), Matthew Stoltz. Absent: None. Also present: Breeka Li Goodlander, Director of Conservation (via Zoom); Tyler Paslaski, Administrative Staff. Note: Documents presented to the Conservation Commission are on file. SCHEDULING None. GENERAL BUSINESS Minor Buffer Zone Activities: 912 Washington Street Ms. Hallie Whitman (via Zoom) said they are requesting to take down some trees that are dangerous to people and structures. She said she included more photos to the application. She showed on the screen and reviewed photos of the trees to be removed. She said they are all labelled on the bottom. [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 11, 2026

Town Council

Council to review FY27 budget forecast and vote on capital plan

The Franklin Town Council will discuss the revised FY27 budget model and five-year fiscal forecast, including presentations from the Town Administrator and School Superintendent. The Council will also vote on resolutions to transfer free cash to stabilization accounts and approve the FY26 Capital Plan and Capital Enterprise Funds. A modification of Shaw's Supermarkets' liquor license at 255 East Central St. is on the agenda. No public hearings are scheduled.

budgetcapital-planfiscal-forecastfree-cashliquor-licenseveteranstown-council
✓ Decidido: Town Council approves Shaw’s liquor license officer change and tables prior minutes

The council voted unanimously to table the January 21, 2026 meeting minutes until March 4, 2026. It also voted unanimously to approve a modification of the Section 15 Retail Package Store Wine & Malt Beverages license for Shaw’s Supermarkets at 255 East Central St., changing officers and directors. No other actions were taken.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet February 11, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #849 1778 3849 & Link: https://us02web.zoom.us/j/84917783849 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING February 11, 2026 A meeting of the Town Council was held on Wednesday, February 11, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Jane Callaway-Tripp, Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Michael LeBlanc, Stephen Malloy, Max Morrongiello, Kenneth Ojukwu. Councilors absent: None. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Julie McCann, Operations Manager. Note: Documents presented to the Town Council are on file and provided in the online meeting packet. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:00 PM. He called for a moment of silence. All recited the Pledge of Allegiance. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number on the agenda. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided on the agenda. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on rep [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 11, 2026

Historical Commission

Franklin Historical Commission to discuss exhibit planning and hosting procedures

The Historical Commission will meet to review hosting procedures and plan exhibits. The body will also receive updates on the Tri-County Bell Stand and the addition of revolution stories to KiASK.

historymuseumcommunity-eventsarchives
✓ Decidido: Historical Commission unanimously adopts new Hosting Procedures

The commission unanimously approved the minutes from the January 14, 2025 meeting. Commissioners adopted the draft Hosting Procedures packet after a motion by Brandon Carrico and a second by Jan Prentice, with a unanimous vote. The meeting was then adjourned by unanimous vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin MassachusettsHistorical CommissionAgenda, Weds., Feb. 11, 2026, 6:00 pm Meeting at the Museum, 80 W. Central StAPPROVAL OF MINUTES – Jan 14, 2025CITIZENS COMMENTS: PRESENTATIONS: none (Dean Business School will present at March meeting)FFHM REPORT: SUBCOMMITTEE REPORTS: TREASURER: COMMUNITY PRESERVATION COMMITTEE: FRANKLIN 250 UPDATEARCHIVIST UPDATEREGULAR BUSINESS:Assession and DeassessionsExhibit PlanningOLD AND NEW BUSINESS:Update on Tri-County Bell StandRevolution stories being added to KiASKReview and Discuss Hosting Procedures DocumentDiscuss continuing updates to exhibits….Upcoming Friends Annual MeetingSchool Horace Mann Committee Starting Up this MonthMusic Programs for 2026 (Edison phonograph expertise?)Upcoming events into 2026-7. Ideas?COMMISSIONERS COMMENTS:ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Meeting Minutes, February 11, 2025, 6:00 pm Commission Members Present: Alan Earls, Phyllis Malcolm, Randy LaRosa, Jan Prentice, Scott Mason, Will Lee, Brandon Carrico, Associate Member Mary O’Leary, Archivist Rowan Lowell. Members of the Public Present: Deb Pellegri APPROVAL OF MINUTES: The minutes from January 14, 2025 were unanimously approved. CITIZENS COMMENTS: None. PRESENTATIONS: None. FFHM REPORT: Debbie commented that she and the Friends want to attend more Commission meetings. She expressed that she loved the new lobby layout, but that the gift shop was not doing well and that the Friends are in debt this year. Debbie presented a detailed financial report for the Friends. SUBCOMMITTEE REPORTS: ● TREASURER: Phyllis reported that the account is down to $3100. ● COMMUNITY PRESERVATION COMMITTEE: No new business. ● FRANKLIN 250TH UPDATES: Alan reported that ● ARCHIVIST UPDATE: Rowan reported that one of the volunteers is helping to scan photos of old municipal anniversary celebrations in Franklin. Rowan has also been working on updating the exhibit pages on the museum websites as more items get catalogued. Rowan has been working on exhibit timeline updates and is moving slower than usual due to verifying conflicting dates on certain items. The GIS department is working on a StoryMap of Franklin’s development from 1690 to the modern day. OLD AND NEW BUSINESS: ● Tri-County is innovating a way t [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 10, 2026

Bi-County Collaborative

Board to interview finalist for Executive Director position

The Board of Directors will interview Dr. Amy Berdos for the Executive Director position. The meeting is scheduled for February 10, 2026, at the Johnson School Board Room.

board-meetinghiringbudgetfranklin-town
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BOARD OF DIRECTORS MEETING February 10, 2026 2:30 Johnson School Board Room Agenda ** Parking is available at VFW, Front Loop or in the lot across from the school. If you park in the lot across the street from Johnson School, please DO NOT park in the last 3 rows. You may park in any Van or Visitor or other spot. Please DO NOT Park Behind the Building!!** 1. Executive Director Finalist Interview (Vote Required) - Dr. Amy Berdos, Board Chair Dr. Jennifer Parson, Board Vice-Chair Adjourn Future Meetings: Board of Directors Meeting: Thursday, March 12, 2026 - Second Read of FY27 Budget
Tue Feb 10, 2026

School Committee

FY27 Budget Open Hearing, remote participation policy considered

The Franklin School Committee holds an open hearing on the Fiscal Year 2027 budget, considers adopting a policy for remote participation in meetings, and discusses a letter to the state legislature supporting Chapter 70 funding for arts and music. Several gifts and field trip requests are also up for approval.

budgetschoolspolicyarts-fundingremote-participationgiftsfield-tripsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee February 10, 2026 Municipal Building – Council Chambers 6:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/81704498273?pwd=Imh0HxL8M1ontDijxS7xk9tPjazeao.1 Passcode:971393 Join via audio: +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 719 359 4580 US +1 720 707 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026

School Committee

Community Relations Subcommittee to finalize mission statement and review engagement metrics

This is a meeting of the Franklin School Committee's Community Relations Subcommittee. They will discuss finalizing the mission statement, receive an overview of JGPR, review website usage metrics, and get a quarterly community engagement update including newsletter planning. The meeting is virtual only.

school-committeecommunity-relationssubcommitteemission-statementjgprwebsite-metricscommunity-engagementnewsletter
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Community Relations Sub Committee February 9, 2026 6:30 PM Virtual Only Join from PC, Mac, iPad, or Android: https://usO6web.zoomus/j/89986892198?pwd=ETZASLIvROtLjIE3fxbbZPbOWEgRZS. | Passcode:632815 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +] 309 205 3325 US +1 312 626 6799 US (Chicago) +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US AGENDA "The listing of matters is those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." Finalize Mission Statement JGPR Overview Website Usage Metrics Quarterly Community Engagement Update Newsletter Planning eoee¢ ®
Mon Feb 9, 2026

Legal Notices

Planning Board to hear Grillo Estates 2-lot subdivision at 70 Daniels Street

The Franklin Planning Board will hold a public hearing on February 9, 2026, for the Grillo Estates definitive subdivision application. The proposal creates a 2-lot subdivision with a drainage easement and stormwater utilities at 70 Daniels Street in the Rural Residential II Zoning District. The hearing is in the Town Council Chambers and remotely.

planning-boardpublic-hearingsubdivisionzoningrural-residentialfranklin-madrainagestormwater
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By-Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, February 9, 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Definitive Subdivision application titled “Grillo Estates” prepared by G W Site Solutions, Blackstone, MA, and submitted to the Department of Planning & Community Development on January 16, 2026, by Dan Grillo, Norfolk, MA. The property is located in the Rural Residential II Zoning District (Assessors Map 232 Lots 45, 47, and 48) at 70 Daniels Street. The applicant is proposing to construct a 2-lot subdivision with a drainage easement and associated stormwater utilities. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Copies of the plan and supporting documentation may be reviewed in the Department of Planning & Community Development during regular office hours as well as on the Franklin Planning Boar [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026

Housing Authority

Franklin Housing Authority to review marketing and accessibility plans

The Board of Commissioners will review operational reports and financial statements. The meeting includes discussions on housing marketing strategies and the completion of water lines for 101164. The board will also address language access, fair housing, and minority goal plans.

housinginfrastructurefair-housingbudget
✓ Decidido: Board approved new rent rates and moved $150,000 to reserve

The Franklin Housing Authority Board approved new rent amounts for five houses. It also moved $150,000 to the reserve fund and approved staff bonuses totaling $3,750. Additional approvals included January 2026 accounts payable, Capital One charges, and several program and insurance agreements.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing Authority Peter L. Brunelli Community Center 1000 Central Park Terrace Franklin, MA 02038 Regular Meeting of the Board of Commissioners February 9, 2026 4:30 PM AGENDA  Chairman requests all cell phones to be silenced  Roll Call  Rick Shaw – CPA  Minutes  Minutes of the Regular Meeting January 12, 2026  Accounts Payable  Accounts Payable for January 2026  Capital One Charges for January 2026 -- $1053.06  Director of Facilities Report  Director Report  Operating Statements – December 2025  Community Preservation Committee (CPC) Update – Commissioner Feeley  Correspondence  Thank you, Card  Norfolk HA Update – Managing Agency  Laundry Room/Office Project construction, laundry room 100% complete, office almost complete.  Norfolk delinquency  Old Business  None  New Business  Houses Marketing Strategy  101164 Water Lines – Certificate of Substantial Completion (CSC) & Certificate of Final Completion (CFC)  Insurance  Language Access Plan  Fair Housing Marketing Plan  Reasonable Accommodation/Modification Plan  Franklin Housing Authority Minority Goal  Executive Session  Adjournment
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Housing Authority Peter L. Brunelli Community Center Regular Meeting Minutes February 9, 2026 The Regular Meeting of the Franklin Housing Authority took place at the Peter L. Brunelli Community Center located on Central Park Terrace. Chairman George A. Danello called the meeting to order at 4:30 PM. © ROLLCALL Members Present Members Absent George A. Danello, Chairman Christopher K. Feeley, Vice Chairman Andrew M. Kepple, State Appointee Christopher Lennon, Tenant Board Member Jennifer Knight-Levine, Commissioner © Others Present Nayda Sanchez Delesus, Executive Director Brian Drainville, Director of Facilities Candice Day, Administrative Assistant Rick Shaw, Fee Accountant © RICK SHAW -CPA «= Discussion to move $100,000 to reserve now then in June or July to move $100,000. Motion is made by Commissioner Feeley, second by Commissioner Kepple to move $150,000 to reserve now. All in favor. So voted. Motion is made by Commissioner Feeley, second by Commissioner Kepple to add Staff Bonus Resolution to agenda. Alll in favor. So voted. "Discussion to give staff $750 bonus each (Candice, Carole, Frank, Mike & Elio), discussion by Fee Accountant regarding giving staff bonuses. Motion is made by Commissioner Feeley, second by Chairman Danello to approve the bonus for 5 of the staff members totaling $3,750.00. All in favor. So voted. MINUTES Motion is made by Commissioner Feeley, second by Commissioner Kepple to approve the Minutes of the Regular Meeting of Januar [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026

Planning Board

Public hearings on three subdivision plans

The Planning Board will hold public hearings on definitive subdivision plans for 47 Partridge Street (Donovan Estates), Symphony Drive (Tanglewood Estates II), and 70 Daniels Street (Grillo Estates). The board will also discuss future zoning amendments, consider road acceptance for J. Victor Lane, and review an extension request for 55 Constitution Blvd.

zoningsubdivisionpublic-hearingroadsplanning
✓ Decidido: Planning Board approves J. Victor Lane road acceptance, holds $1,000 bond

The Board approved the acceptance of J. Victor Lane roadway and retained $1,000 for Registry of Deeds filing (5‑0). It also continued discussion of future zoning amendments to Feb. 23, 2026 (5‑0) and granted a two‑year extension for the 55 Constitution Boulevard project (5‑0). Meeting minutes for Dec. 15, 2025 and Jan. 12, 2026 were approved (5‑0), and three subdivision items were either continued or waived (each 5‑0).

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet February 9, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/87981024401 or call on your phone at 312-626-6799, meeting #87981024401. PUBLIC HEARINGS 1. 47 Partridge Street (Donovan Estates) – Definitive Subdivision Definitive Subdivision Plans – Revised Correspondence 2. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision TO BE CONTINUED 3. 70 Daniels Street (Grillo Estates) – Private Definitive Subdivision Definitive Subdivision Plans Correspondence GENERAL BUSINESS: A. Discussion: Future Zoning Amendments B. Road Acceptance: J. Victor Lane C. Extension: 55 Constitution Blvd D. Meeting Minutes: December 15, 2025 & January 12, 2026 This agenda is subject to change. The next meeting of the Planning Board is scheduled for February 23, 2026.
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board February 9, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, 2nd floor, Council Chambers, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk; Mark Mucciarone; Eric Steltzer; William Lee, associate member. Members absent: None. Also present: Amy Love, Town Planner (via Zoom); Michael Maglio, Town Engineer; Steven Lee, BETA Group; Matthew Crowley, BETA Group (via Zoom); Tyler Paslaski, Administrative Staff. Note: Documents presented to the Planning Board are on file. GENERAL BUSINESS A. Discussion: Future Zoning Amendments Chair Rondeau said this is out of the MBTA acceptances that the towns have to meet. He said Ms. Love and Morena Zelaya, Director of Planning & Community Development, wanted to be here to give descriptions of the changes. They asked that we continue this to the next meeting. Ms. Love suggested the February 23, 2026, meeting. Motion to Continue the Zoning Amendments to February 23, 2026. Rondeau. Second: Mello. Vote: 5-0 (5-Yes; 0-No). B. Road Acceptance: J. Victor Lane Ms. Love reviewed this is to accept the roadway, and it would be a recommendation to the Tow [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 5, 2026

Zoning Board of Appeals

Zoning Board of Appeals meeting cancelled for Feb 5, 2026

The Franklin Zoning Board of Appeals will not hold its scheduled meeting on February 5, 2026. No business will be conducted. The next meeting is set for February 19, 2026.

cancellationzoning-board
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING February 5 , 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR February 19 , 2026
Thu Feb 5, 2026

Franklin Commission on Disability

Commission on Disability reviews accessibility updates and Strawberry Stroll plans

The Franklin Commission on Disability will review and consider final approval of resource descriptions, discuss accessibility improvements across town, and plan for the upcoming Strawberry Stroll event. New business includes a flyer review and approval of updated expectations for the commission.

disabilityaccessibilitycommission-on-disabilityeventsstrawberry-strolltrainingfranklin
✓ Decidido: Commission verifies Disability Resources Document and accepts prior minutes

The commission voted to accept the minutes from the January 8, 2025 meeting. A unanimous vote verified that the Disability Resources Document is complete and ready for public distribution. No other substantive actions were decided at this meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Meeting Agenda Date: February 5, 2026 Time: 4:00pm Location: Senior Center, 10 Daniel McCahill St, Franklin, MA 02038 *Please note: we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance Call to Order ● Approve previous meeting minutes ● Announcements from the Chair ○ AAB Non-Compliance Letter ● Public Comments ● Old Business: ○ Resources: check descriptions and consider final approval ○ Accessibility in Franklin: add more locations and events ○ Education Goal: Training Schedule - review ○ Event Goal: Plan for Strawberry Stroll ● New Business: ○ Flyer review ○ Approve updated expectations ○ Accessibility improvement updates ● Next Meeting: (Subject to Change) Adjourn meeting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
64) Franklin Commission on Disability Meeting Minutes Date: February 5, 2026 Location: Senior Center, 10 Daniel McCahill Street, Franklin MA Members Present: Alison Rheaume, Randy Jay, Lauren Sanford, Michael Furilla, Cheryl Fisher, Gus Brown Members Absent: Kelly Quinlan Meeting Called to order by Alison Rheaume, Chairperson, at 4:00 pm e Past Minutes: A motion was made and carried to accept the minutes of the January 8, 2025 meeting. Accepted e Chair announcements: o Mary O'Neill has resigned from the Commission. o Status of Town of Franklin, Non-Compliance Letters e Public Comments: o Announcement of the conveyance of an agreement on the importance of the Massachusetts Architectural Access Board objectives and requirements. Mark Dempsey, MetroWest Center for Independent Living e Old Business: 1. Discussion on the completion status of the Disability Resources Document - vote unanimously passed to verify completion and ready for public distribution 2. Discussion on the Disability Accessibility Document - members to gather locations under specific assigned categories 3. Discussion on the education goals for commission members and completed Training Resources Document. 4. Discussion on the Commission on Disability goals and objectives. e New Business: 1. Completion and acceptance of the Commission on Disability flyer. 2. Approval of Commission expectations. 3. Updates on Town of Franklin accessibility improvements - resume next meeting 4. Discussion of lighting [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 5, 2026

Bi-County Collaborative

Board to approve minutes and first read of FY27 budget

The Joint Board of Directors will vote to approve minutes from November and January, review employee changes and enrollment, and receive a first read of the fiscal year 2027 budget.

budgetminutespersonnelfinanceeducation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
JOINT BOARD OF DIRECTORS & OPERATING COMMITTEE MEETING February 5, 2026 9:00-10:30 Johnson School Media Center Agenda ** Parking is available at VFW, Front Loop or in the lot across from the school. If you park in the lot across the street from Johnson School, please DO NOT park in the last 3 rows. You may park in any Van or Visitor or other spot. Please DO NOT Park Behind the Building!!** 1. Approval of Minutes - Mrs. Jeanne Sullivan, Executive Director a. Board of Directors Meeting, November 20, 2025 (Vote Required) b. Board of Directors Meeting, January 6, 2026 (Vote Required) c. Budget Subcommittee, January 6, 2026 (Vote Required) d. Budget Subcommittee, January 26, 2026 (Vote Required) 2. Executive Director Update - Mrs. Jeanne Sullivan, Executive Director a. Employee Appointments/ Resignations/ LOA (Vote Required) b. Enrollment i. Current Enrollment / Referrals c. Program Highlights d. Collaborative Shoutouts 3. Business Office Updates - Ms. Holly Buttrick, Director of Finance & Operations & Mrs. Jeanne Sullivan, Executive Director a. Facilities b. FY26 Financial Overview c. FY27 Budget (First Read) 4. Other 5. Routine Matters a. Approval of Payroll Warrants b. Approval of Bill Warrants Adjourn Future Meetings: Board of Directors Meeting: Thursday, March 12, 2026 - Second Read of FY27 Budget
Wed Feb 4, 2026

Board of Health

Board of Health will discuss Women’s Health Expo and vaccine guidelines

The Franklin Board of Health will hold a public meeting to discuss several health topics, including a Women’s Health Expo, Massachusetts Department of Public Health pediatric vaccine guidelines, updated information on the Vaccines for Children program, and the use of acetaminophen by pregnant women. The meeting will also include reports from the Metacomet shared‑service grant on a regional health agent and a public health nurse. No formal decisions are indicated on the agenda.

healthwomen's-healthvaccinespediatricpublic-healthmeeting
✓ Decidido: Board approved prior minutes and adjourned the meeting

The Board of Health approved the January 7, 2026 meeting minutes with a 2‑0 vote. No formal actions were taken on the Women’s Health Expo, vaccine guidelines, or acetaminophen discussions. The meeting was then adjourned at 5:38 p.m. with a 2‑0 vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet February 4, 2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. meet.google.com/xpo-rhzg-niv (US) +1 929-238-0193 PIN: 866 199 929# ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. January 7, 2026 NEW BUSINESS a. Women’s Health Expo discussion b. MDPH pediatric vaccine guidelines c. Vaccines for Children updated info [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
BOH MEETING MINUTES February 4, 2026 In attendance: Chair Kim Mu-Chow; Member, Diane Daddario; Cathleen Liberty, Director; Ginny McNeil, Health Agent; Alicia Sullivan,Public Health Nurse; Guests: Steve Sherlock CALL TO ORDER: ► Chair Mu-Chow called the meeting to order at 5:00 pm. CITIZENS COMMENTS: ► APPROVAL OF MINUTES: ►January 7, 2026 ►MOTION to Approve the January 7, 2026 meeting minutes Kim Mu-Chow. SECOND by Daddario. No discussion. ►ROLL CALL VOTE: Mu-Chow-YES; Daddario-YES►VOTE: Yes-2, No-0-Abstain 0 NEW BUSINESS Women’s Health Expo Discussion Director Liberty noted that the event for 2026 is having a Women’s Health Expo at the NE Chapel in the spring. The event will host multiple vendors relating to women’s health and are hoping to have a mammogram van at the event that gives free mammograms. MDPH Pediatric vaccine guidelines Public Health Nurse Sullivan noted that the Massachusetts Department of Public Health has issued evidence-based childhood immunization recommendations . The state continues to recommend the full routine pediatric vaccination schedule endorsed by the American Academy of Pediatrics (AAP), rather than adopt the recent changes issued by the Centers for Disease Control and Prevention (CDC) . Recreational camp immunizations were discussed too. Vaccines for Children updated information on vaccine management discussion There was much discussion thereby regarding vaccines for children and re-enrollment in the [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 4, 2026

Town Council

Council to adopt amendment to its procedures manual

The Franklin Town Council will vote on Resolution 26-08 to amend its Procedures Manual. The meeting also includes approval of the December 17, 2025 minutes, discussion of 2026‑2027 council‑administrator goals, and presentations on regional strategic planning. An executive session is scheduled to consider the purchase, exchange, lease, or value of former Davis‑Thayer and Parmenter elementary schools and other potential property.

governanceproceduresminutesstrategic-planningpropertyexecutive-session
✓ Decidido: Town Council approves December 2025 meeting minutes unanimously

The council voted 9-0 to approve the minutes from the December 17, 2025 meeting. No other formal actions—such as appointments, proclamations, or license transactions—were taken; the remainder of the meeting consisted of updates and discussions on the school budget, senior‑center events, and strategic‑planning considerations.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet February 4, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #885 5431 3626 & Link: https://us02web.zoom.us/j/88554313626 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING February 4, 2026 Link to FranklinTV YouTube Recording: 2/4/2026 Town Council Meeting A meeting of the Town Council was held on Wednesday, February 4, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Jane Callaway-Tripp, Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Michael LeBlanc, Stephen Malloy, Max Morrongiello, Kenneth Ojukwu. Councilors absent: None. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Mark Cerel, Town Attorney; Julie McCann, Operations Manager. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:00 PM. He called for a moment of silence. All recited the Pledge of Allegiance. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number on the agenda. To particip [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 4, 2026

Cultural Council

Franklin Cultural Council discusses FY26 grants and event planning

The Franklin Cultural Council will hold its regular meeting, discussing updates on FY26 grants and planning for several community events including A-Wreath-of-Franklin, the Strawberry Stroll, and the Harvest Festival. The financial update has been postponed until February 25th. The council will also address the Horace Mann District Initiative and a proposal for sealing the Lady Bugs Art.

cultural-councilgrantseventsplanningartsstrawberry-strollharvest-festivalfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Cultural CouncilWednesday, February 4, 2026Meeting AgendaDate: Wednesday, February 4, 2026Time: 7 PMLocation: Franklin Municipal Building Training Room (3rd floor) 1.Welcome John Ristaino2.Financial UpdatePostponed until February 25th 3.FY26 Grants UpdateJohn Ristaino & All4.Franklin Culture Updates Cory Shea5.A-Wreath-of-Franklin Debrief and 2026 Planning John Ristaino, Cory Shea & AllThemeMarketBusinessesEvents/EntertainmentNew Committee Organization ProposalDate SelectionTheme Selection Proposal6.Horace Mann District InitiativeJohn Ristaino7.FY26 Grants ReceptionAllDateScopeEntertainmentVenue8.Strawberry Stroll Planning All9.Harvest Festival PlanningAll10.Sealing the Lady Bugs ArtJohn Ristaino & Cory Shea11.Promoting the Importance of Arts & Culture in FranklinAll12.Topics for Future Meetings All13.AdjournAll
Tue Feb 3, 2026

School Committee

School Committee to vote on moving healthcare expenses to town benefits

The School Committee will consider a motion to move School Health Insurance, Medicare, and Long-Term Disability expenses and associated funding from the School Department to the Town Benefits Department. This is the only action item on the special meeting agenda.

healthcarebudgetschool-committeeinsurance
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools Franklin School Committee School Committee Special Meeting February 3, 2026 Virtual Only 6:00 PM Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89499821469?pwd=644NgBrni9TBTAnpJO38Kw3KHXkz9k.1 Passcode:786795 Join via audio: +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 689 278 1000 US +1 719 359 4580 US +1 720 707 2699 US (Denver) +1 253 205 0468 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." 1) Call to Order 2) Discussion/Action Items a) School Healthcare Vote I recommend approval to move the School Health Insurance, Medicare, and Long-Term Disability expenses and associated funding from the School Department 300 to the Town Benefits Department 910 as detailed. 3) Adjournment
Sun Feb 1, 2026

Franklin's 250th Anniversary Celebration Committee

250th committee to discuss fundraising letter, pledge sheet

The Franklin 250th Anniversary Celebration Committee's Budget and Fundraising Subcommittee will meet virtually to discuss a fundraising letter and a pledge sheet. No votes or decisions are on the agenda; the meeting is largely procedural.

anniversarybudgetfundraisingcommittee
✓ Decidido: Committee approved revised pledge sheet for full committee review

The subcommittee unanimously approved the minutes from the January 18, 2026 meeting. It also approved presenting a revised pledge sheet with updated dates to the full committee. No other motions were voted on during this session.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Budget and Fundraising February 1,, 2026 7:30 PM Meeting will be held virtually via Zoom A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: https://zoom.us/j//974000 8?pwd=s¥9secLgitanU ZWPiGuzqYN3Mh4 > Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. > All speakers will be required to state their full name and street address before commenting Agenda 1. Announcements from the chair 2. Approval of minutes 3. Report of subcommittee members 4, Discussions: e fundraising letter e Pledge sheet 5. Agenda items for next meeting 6. Adjourn
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin 250" Anniversary Budget Subcommittee Meeting Minutes February 1, 2026 7:30 PM 1. Call to Order The meeting was called to order at 7:36 PM. 2. Attendance Members Present: Belcher, Brennan, Brunelli, Keras, Joyce 3. Announcements The Chair reported no announcements. 4, Approval of Minutes The Committee reviewed the minutes from January 18, 2026. + Motion to approve by Keras Seconded by Joyce Vote: Unanimous approval CURRENT AGENDA ITEMS 5. Business Outreach & Tracking Proposal to create a spreadsheet to track business outreach, including business name, mailing address, and phone number. Discussion included outreach to businesses in the industrial park. Recommendation to notify subcommittee members of meetings with businesses; suggested inclusion under “Announcements from the Chair.” Recommendation to organize spreadsheet with two tabs: o Pledges from large companies o Donations from small businesses Brunelli will initiate the spreadsheet. 6. Fundraising Materials ® A fundraising letter needs to be developed. Existing pledge agreement form reviewed. Brennan will draft a fundraising letter template for committee review. Suggestions for fundraising materials include: o Listing planned events through 2028 with general descriptions o Including a statement that primary funding will come from private donations o Providing a basic budget and target goal to inform donors how funds will be used o Developing sponsorship tiers (e.g., Gold, Silver levels) [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 29, 2026

Conservation

✓ Decidido: Commission approved the 444 East Central Street permit and closed its hearing

The Conservation Commission voted 6‑yes, 0‑no, 0‑absent, 1‑abstain to close the public hearing for 444 East Central Street and then approved its Notice of Intent with the same vote. They also voted to continue the Nicholas Drive/Prospect Street culvert repair hearing to Feb 12 2026. Later, the commission closed and approved the NOI for 1199 West Central Street by a 7‑yes, 0‑no, 0‑absent vote.

📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520-4906 1 Town of Franklin Conservation Commission January 29, 2026 Meeting Minutes As stated on the agenda, this meeting is available to be attended in person and via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or citizens can participate by using the Zoom link provided on the agenda. This meeting will be held in the Town Council Chambers on the Second Floor of the Municipal Building for citizens wishing to attend in person. Commencement Chair Mark LePage called the above-captioned meeting to order this date at 7:00 PM as a remote/virtual/in-person meeting. Members in attendance: Mark LePage, Lui Puga, Michael Rein, Richard Johnson, Roger Trahan, Nicole Chiaramonte, Matthew Stoltz. Absent: None. Also present: Breeka Li Goodlander, Director of Conservation (via Zoom); Tyler Paslaski, Administrative Staff. Note: Documents presented to the Conservation Commission are on file. SCHEDULING None. PUBLIC HEARINGS Public Hearing – NOI – 444 East Central Street Chair LePage said the last time they left off, there were two discussion points around special conditions. Mr. A.J. Alevizos, applicant TAG Central LLC, Mr. Chris Frattaroli of Goddard Consulting, and Mr. Carlton Quinn of Allen & Major Associates (via Zoom) addressed the Commission. Mr. Frattaroli said aside fr [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 27, 2026

Massachusetts Strategic Health Group

Massachusetts Strategic Health Group board meeting notice only

This is a notice of a meeting of the Massachusetts Strategic Health Group board. No agenda items are listed; the meeting is scheduled for January 27, 2026, at Medway Town Hall. The agenda is to follow.

healthboard-meetingprocedural
✓ Decidido: Board approved Jan 6, 2026 meeting minutes unanimously (8‑0)

The board voted to approve the open‑session minutes from the January 6, 2026 meeting, with an 8‑0 vote. No other actions were decided; discussion of a GLP‑1 management program was postponed to the February agenda. The meeting was adjourned unanimously.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
MA SSACHUSETTS Strategic Health Group Abington Grafton Northbridge Templeton CRPC Medway NRSD Webster DCRSD Merrimac Salisbury Franklin MURSD SEBRSD NOTICE OF MEETING Massachusetts Strategic Health Group Board Meeting Tuesday, January 27, 2026, at 1:00 PM Medway Town Hall 155 Village Street, Medway MA 02053 NOTICE ONLY - AGENDA TO FOLLOW
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
MASSACHUSETTS Strategic Health Group 1 Abington Grafton Northbridge Templeton CRPC Medway NRSD Webster DCRSD Merrimac Salisbury Franklin MURSD SEBRSD Massachusetts Strategic Health Group Open Session Meeting Minutes – January 27, 2026 A meeting of the Massachusetts Strategic Health Group was held on Tuesday January 27, 2026 in Medway Town Hall, 155 Village Street, Medway, MA 02053, and via remote participation on Microsoft Teams. 1. Attendance - Board Members Present: Richard LaFond - Town of Webster, Lindsay Grasso - Town of Abington, Steven Lamarche - Dudley-Charlton RSD, Karen Bratt - Town of Franklin, Mary Lauria - Town of Grafton, Michael Boynton - Town of Medway, Adam Gaudette - Town of Northbridge, Victoria Nakis - Valley Trust. Kevin Paicos - NFP, Ken Lombardi - NFP, Sheryl Strother - NFP, Eric Avrumson - NFP. Board Members Absent: Mendon Upton RSD, Narragansett RSD, Spencer-East Brookfield RSD, Town of Templeton RSD. Chairman LaFond called the meeting to order at 1:00 p.m. There was no executive session today. 2. Acceptance of the Open Session Meeting Minutes from January 6, 2026 - Motion to approve the open session meeting minutes from January 6, 2026 made by Mr. Boynton, seconded by Mr. Lamarche. Roll call vote: Town of Abington – yes, Dudley-Charlton RSD – yes, Town of Franklin - yes, Town of Grafton - yes, Town of Medway - yes, Town of Northbridge - yes, Valley Trust – yes, Town of Webster – yes. Motion passed [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 27, 2026

School Committee

School Committee to review Superintendent's FY27 budget proposal

The Franklin School Committee will hear the Superintendent's Recommended FY27 Budget as a guest presentation and vote on several policy and financial items. They will consider adopting Policy IHAIA on Middle School Pathway Exploration and setting the ECDC 2026-27 tuition rate. Discussion items include the monthly financial report and school healthcare. The consent agenda includes acceptance of gifts totaling $2,760.72 and $6,000 in scholarships, along with field trip approvals.

budgeteducationpolicytuitiongiftsfield-tripshealthcare
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee January 27, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair ~ Vision Statement ~ The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89647004718?pwd=cRz0LLFSaGKq3UN9grtUtoz2ZObMNb.1 Passcode:854179 Join via audio: +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 386 347 5053 US +1 507 473 4847 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026

Legal Notices

Franklin to consider zoning amendments on use regulations and lot requirements

The Franklin Planning Board will hold a public hearing on January 26, 2026, followed by the Town Council on February 4, 2026, to consider two amendments to Chapter 185 of the Zoning By-Laws. Amendment 26-946 revises the Use Regulations Schedule (Attachment 7), adjusting permitted uses across various districts, including multifamily housing. Amendment 26-947 revises the Schedule of Lot, Area, Frontage, Yard and Height Requirements (Attachment 9), changing minimum lot dimensions and setbacks.

zoningpublic-hearingplanning-boardtown-councilby-law-amendmentsland-usedevelopment-standardsmultifamily-housing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, January 26, 2026 at 7:00 PM, and the Franklin Town Council will hold a public hearing on Wednesday, February 4 at 6:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, to consider amending Chapter 185 of the Code of the Town of Franklin. ZONING BY-LAW AMENDMENTS 26-946: That Chapter 185 of the Code of the Town of Franklin is hereby amending §185, Attachment 7, Use Regulations Schedule Part VI. 26-947: That Chapter 185 of the Code of the Town of Franklin is hereby amending §185, Attachment 9, Schedule of Lot, Area, Frontage, Yard and Height Requirements. The exact wording and detail of the proposed By-Law amendments, including additions, deletions to §185, as well as the updated Schedule documents, can be found attached to this hearing notice. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Greg Rondeau, Chairman Robert Dellorco, Chair Franklin Planning Board Franklin Town Council December 19, 2025 Page 1 of 5 SPONSOR: Town Administration TOWN OF FRANKLIN ZONING BY- [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026

Agricultural Commission

Agricultural Commission to discuss Earth Day 2026 and farmer interviews

The Agricultural Commission will meet to discuss the Earth Day 2026 event and interviews with local farmers for future storyboards. The body will also review an introduction to “More Farm than Fancy” Farm.

agriculturecommunity-eventsland-usefarming
✓ Decidido: No substantive decisions recorded at the Franklin Agricultural Commission meeting

The commission reviewed agenda items such as approving the January 5 minutes, introducing the “More Farm than Fancy” farm, discussing farmer interviews, planning an Earth Day 2026 event, and providing updates on the town administrator meeting and landowner information. No votes, approvals, denials, or other formal actions were documented in the minutes.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 1/26/2026 7:00pmA NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded.ZOOM MEETING DETAILS: Topic: Ag Com Time: Jan 26, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/85610699797 Meeting ID: 856 1069 9797 One tap mobile +16469313860,,85610699797# US +13017158592,,85610699797# US (Washington DC) Participants will be automatically muted upon entry but can un-mute themselves by pressing*6 Participants joining by phone will be able to listen to the meeting and speak when l. Approval of the minutes from January 5, 2026 meeting ll. New Business: A. Introduction to “More Farm than Fancy” Farm. B. Interviews with Franklin Farmers, for Future Storyboards C. Earth Day 2026 Event lll. Old Business:A. 2026 meeting with Town Administrator-B. Info for Owners of 5+ Acres of Land in Franklin- Respectfully Submitted, Marian Szymanski
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 1/26/2026 7:00pmA NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded.ZOOM MEETING DETAILS: Topic: Ag Com Time: Jan 26, 2026 07:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://us02web.zoom.us/j/85610699797 Meeting ID: 856 1069 9797 One tap mobile +16469313860,,85610699797# US +13017158592,,85610699797# US (Washington DC) Participants will be automatically muted upon entry but can un-mute themselves by pressing*6 Participants joining by phone will be able to listen to the meeting and speak when l. Approval of the minutes from January 5, 2026 meeting ll. New Business: A. Introduction to “More Farm than Fancy” Farm. B. Interviews with Franklin Farmers, for Future Storyboards C. Earth Day 2026 Event lll. Old Business:A. 2026 meeting with Town Administrator-B. Info for Owners of 5+ Acres of Land in Franklin- Respectfully Submitted, Marian Szymanski
Mon Jan 26, 2026

Library Board of Directors

Library Board to approve patron survey, discuss strategic planning

The Franklin Public Library Board of Directors will meet to discuss strategic planning, including approving a patron survey and reviewing staff visioning session results. They will also discuss revenue generation ideas. The meeting includes public comment, approval of minutes, and board reports.

librarystrategic-planningsurveysrevenueboard-of-directors
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Library Board of Directors MeetingJanuary 26, 20267:00 PMMeeting RoomAgenda1.Call to Order2.Public CommentPatrons are welcome to express their views for up to three minutes on a matter that is not on the agenda but relates to library concerns. The Board will not engage in a dialogue or comment on a matter raised during public comments. The Library Board will give remarks appropriate consideration and may ask the Library Director to review the matter.3.Approval of Minutes4.Report of Board members5.Library Director’s ReportDiscussionoStrategic planningApprove patron surveyStaff visioning session – ResultsSOAR worksheetoRevenue generation ideas6.Agenda items for next meeting. February 23, 20267.Adjourn
Mon Jan 26, 2026

Planning Board

Planning Board meeting cancelled due to weather

The Franklin Planning Board meeting scheduled for January 26, 2026, was cancelled due to weather. The agenda included public hearings on two zoning amendments (26-946 and 26-947) and general business items such as a presentation by the Town Attorney, road acceptance for J. Victor Lane, and approval of prior meeting minutes.

cancellationweatherplanning-boardzoningfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet January 26, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/88354277065 or call on your phone at 312- 626-6799, meeting #88354277065 *CANCELLED DUE TO WEATHER* PUBLIC HEARINGS 1. Zoning Amendment 26-946 §185 Attachment 7, Use Regulations Schedule Part IV 2. Zoning Amendment 26-947 §185 Attachment 9, Schedule, Lot, Area, Frontage, Yard and Height Requirements GENERAL BUSINESS: A. Presentation: Town Attorney, Mark Cerel B. Road Acceptance: J. Victor Lane C. Meeting Minutes: December 15, 2025 & January 12, 2026 This agenda is subject to change. The next meeting of the Planning Board is scheduled for February 9, 2026.
Mon Jan 26, 2026

Recreation Advisory Board

Recreation Advisory Board reviews fields, programs, and Fletcher Fund updates

The Franklin Recreation Advisory Board will meet to discuss updates on fields and playgrounds, recreation programs, and the Fletcher Fund. The agenda consists of routine business including approval of minutes, public comments, and old/new business. No specific decisions or dollar amounts are listed; the meeting appears procedural.

recreationfieldsplaygroundsparksprogramsfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
RECREATION ADVISORY BOARD MEETING JANUARY 26, 2026 7:00PM 235 WACHUSETT ST. FRANKLIN, MA 02038 AGENDA: 1) CALL TO ORDER 2) APPROVAL OF MINUTES 3) PUBLIC COMMENTS 4) FIELDS AND PLAYGROUNDS 5) RECREATION PROGRAM UPDATE 6) FLETCHER FUND UPDATE 7) NEW BUSINESS 8) OLD BUSINESS 9) DISCUSSION 10) NEXT MEETING 11) ADJOURN WAYNE SIMARRIAN, CHAIRMAN
Fri Jan 23, 2026

School Committee

Committee reviews and selects its members for the next term

The Horace Mann Legacy Sub Committee will call the meeting to order, review and choose committee members, and discuss next steps for its work. No other agenda items are listed.

educationschool-committeegovernance
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Horace Mann Legacy Sub Committee January 23, 2026 8:00 AM Municipal Building - 3rd Floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/82110300092?pwd=DyG58U8JnjJoDJxJikgyYkuFysiVvH.1 Passcode:246874 Join via audio: +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law." ● Call to Order ● Review & Selection of Committee Members ● Discussion of next steps
Thu Jan 22, 2026

Legal Notices

ZBA to hear variance request for attached ADU

The Zoning Board of Appeals will hold a public hearing on January 22, 2026, to consider a variance request for a property at 23 September Drive. The applicant seeks to build an attached ADU with a garage that is 15.5 feet from the required 40-foot setback.

zoningvariancehousingadupublic-hearing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin Zoning Board of Appeals FRANKLIN ZONING BOARD OF APPEALS PUBLIC HEARING NOTICE Notice is hereby given that the Town of Franklin Zoning Board of Appeals will hold a public/remote hearing on January 22, 2026 at 7: 30 pm via Zoom Platform. Please go to Franklinma.gov t o view meeting access under ZBA Agenda. Time : 7:3 0 pm Applicant: Timothy and Jenny McGee Address of Subject Property : 23 September Drive (Map 324 , Lot 003 ) Zoning District: RR I Petition Type: Variance Zoning B y-Law Sections: 185 Attachment 9 Schedule of Lot, Area, Frontage, Yard and Height Requirements Reason for Denial : Applicant is seeking to construct an attached ADU with a garage that is 15.5 ’ from the right side yard setback where 40 ’ is required. The building permit is denied without a variance from the ZBA An Appeal from the decision of the Board of Appeals may be made by any person aggrieved pursuant to MGL Chap. 40A, Section 17 as amended, within twenty (20) days after the date of the filing of the notice of decision with the City Clerk . All records and files for this project can be viewed in the Building Department on the 1 st floor of the Franklin Municipal Building during regular business hours. Franklin Zoning Board of Appeals: (508) 520-4926. Any person or organization so wishing will be afforded the opportunity to be heard. The hearing is accessible to persons with physical disabilities.
Thu Jan 22, 2026

Zoning Board of Appeals

McGee ADU variance request on 23 September Drive

The Zoning Board will consider a variance request from Timothy and Jenny McGee to build an attached accessory dwelling unit with a garage only 15.5 feet from the required 40‑foot side‑yard setback on 23 September Drive. The board will also hear a request to extend a comprehensive permit for 237 Pleasant Street and will hold an executive session on litigation strategy for Vertex Towers LLC. The meeting includes routine announcements and approval of prior minutes.

zoningvarianceadupermitslitigation
✓ Decidido: ZBA elects new officers and tables pending meeting minutes

The Zoning Board of Appeals elected Ginelle Lang as chair, Jennifer Williams as vice chair, and Isabella Carter as clerk, each by a 3‑0 vote. The board approved the December 18, 2025 minutes without a recorded vote. The December 23, 2025 minutes were tabled for consideration at the next meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Zoning Board Of Appeals Agenda January 22, 2026, 7:30 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers and Zoom Platform A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citize ns are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call -in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM DETAILS: ID # 955 5934 9180 & Link: https://zoom.us/j/95559349180 All participants will be automatically muted upon joining the meeting. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted.  All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2. APPROVAL OF MINUTES December 18, 2025 December 23, 2025 3. TOPIC a. 7:30PM : 23 September Drive – Timothy and Jenny McGee Applicant is seeking to construct an attached ADU with a garage that is 15.5’ from the right side y [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 553-4856 Fax: (508) 520-4906 1 Town of Franklin Zoning Board of Appeals Thursday, January 22, 2026 Meeting Minutes Building Commissioner Gus Brown called the above-captioned meeting held in the Town Council Chambers, second floor of the Franklin Municipal Building, 355 E. Central Street, and online via the Zoom platform to order this date at 7:30 PM. Members in attendance: Ginelle Lang, Chair; Jennifer Williams, Vice Chair; Isabella Carter, Clerk; Joseph Halligan, Associate; Meghan Whitmore, Associate. Members absent: None. Also in attendance: Casey Thayer, Administrative Assistant; Gus Brown, Building Commissioner; Mark Cerel, Town Attorney. Mr. Brown said there are two new members of the ZBA who were voted in/ratified by the Town Council at their meeting last night. He said the members need to do an election of officers for chair, vice chair, and clerk. Jennifer Williams nominated Ginelle Lang as chair of the ZBA. Isabella Carter seconded the nomination. Ms. Lang accepted the nomination Vote: 3-0 (3-Yes; 0-No). Unanimous by the Board. Ginelle Lang nominated Jennifer Williams as vice chair of the ZBA. Isabella Carter seconded the nomination. Ms. Williams accepted the nomination. Vote: 3-0 (3-Yes; 0-No). Unanimous by the Board. Ginelle Lang nominated Isabella Carter as clerk of the ZBA. Jennifer Williams seconded the nomination. Ms. Carter accepted the nomination. Vote: 3-0 (3-Yes; 0-No). Unanimous by the Board. The followi [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 22, 2026

Gatra Regional Public Meeting

GATRA holds public meeting for feedback and updates

This is a routine GATRA regional public meeting with no specific decisions or proposals on the agenda. The meeting will include updates on past feedback and future plans, followed by public comment on GATRA services.

public-transitregional-transportationpublic-meetinggatratransitmassachusetts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
P U B L I C M E E T I N G T H U R S D A Y , J A N U A R Y 2 2 , 2 0 2 6 2 : 3 0 P M - 3 : 3 0 P M 8 0 0 - 4 8 3 - 2 5 0 0 W W W . G A T R A . O R G R E G I O N A L P A R T I C I P A T E V I A A L I V E S T R E A M A T T H E F O L L O W I N G L O C A T I O N S : A T T L E B O R O C O U N C I L O N A G I N G 2 5 S M A I N S T A T T L E B O R O , M A C E N T E R F O R A C T I V E L I V I N G 4 4 N O O K R O A D P L Y M O U T H , M A G A T R A B U S T E R M I N A L F I R S T F L O O R C O N F E R E N C E R O O M 1 0 O A K S T , T A U N T O N , M A C A N ' T A T T E N D T H E M E E T I N G ? F E E D B A C K A B O U T G A T R A S E R V I C E S C A N B E G I V E N I N T H E F O L L O W I N G W A Y S : C A L L 8 0 0 - 4 8 3 - 2 5 0 0 E M A I L I N F O @ G A T R A . O R G M E S S A G E U S O N F A C E B O O K O R I N S T A G R A M @ G A T R A T R A N S I T A G E N D A I T E M S W I L L I N C L U D E : UPDATE ON FEEDBACK FROM PAST MEETINGS UPDATE ON ANY FUTURE PLANS OTHER TOPICS AS NEEDED COMMENTS ACCEPTED FROM THE PUBLIC ABOUT GATRA’S SERVICES F R A N K L I N S E N I O R C E N T E R 1 0 D A N I E L M C C A H I L L S T F R A N K L I N , M A M A R S H F I E L D C O U N C I L O N A G I N G 2 3 0 W E B S T E R S T M A R S H F I E L D , M A WAREHAM COUNCIL ON AGING 48 MARION RD WAREHAM, MA R E M O V E A F T E R 1 / 2 3 / 2 5 I f y o u n e e d a t r a n s l a t i o n o f a n y t h i n g y o u s e e h e r e o r y o u n e e d i n f o r m a t i o n o n h o w t o r i d e G A T R A s e r v i c [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 22, 2026

Franklin's 250th Anniversary Celebration Committee

Franklin 250th Anniversary Committee to finalize FY26 budget

The committee will meet to finalize the FY26 budget and discuss community engagement strategies. The agenda includes reports from the communication and events subcommittees and a proposal to invite a guest speaker.

anniversary-celebrationbudgetcommunity-engagementcommittee-meeting
✓ Decidido: Committee approves FY26 budget and sets plans for 250th anniversary events

The committee approved the minutes from Dec. 18, 2025. It elected Julie Cornoni as chair and Alan Earls as vice chair of the communication subcommittee, decided to keep the logo in‑house, and chose a Wix site with an online‑store option. The FY26 budget was approved and $755 of unallocated funds was designated as a deposit for the gala. The group also agreed to invite Dave Clifton as a guest speaker at the February meeting.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Agenda January 22, 2026 7:00 PM Meeting will be held at the Franklin Municipal Building - 3rd Floor Training Room 355 East Central Street with hybrid option A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom.. ZOOM DETAILS: ID # 97400088938 & Link: , j 4 = > Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. . > All speakers will be required to state their full name and street address before commenting Agenda 1. ANNOUNCEMENTS FROM THE CHAIR 2. APPROVAL OF MINUTES a. December 18, 2025 3. SUBCOMMITTEE REPORTS a. Communication b. Events 4. FY26 BUDGET FINALIZATION a. Budget/Fundraising Subcommittee b. Committee deliberation 5. INVITING A GUEST SPEAKER a. Dave Clifton, chair of both Sharon 250 and Easton 300 celebrations 6. COMMUNITY ENGAGEMENT STRATEGY 7. FUTURE AGENDA ITEMS & MEMBER COMMENTS 8. ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Minutes January 22. 2026 7:00 PM The meeting was held at the Municipal Building Training Room, E Central Street, with Ali Rheaume participating by Zoom. Appointees/members present: Robert Brown, Matt Keras , Charleen Belcher, Roberta Trahan, Jayson Joyce, Alan Earls, Maureen Brennan Participating remotely: Lynn Pickhover, Ali Rheaume, The Meeting came to order at approximately 7 pm ANNOUNCEMENTS FROM THE CHAIR • APPROVAL OF MINUTES 1. The minutes of Dec. 18, 2025 were approved. • SUBCOMMITTEE REPORTS 1. Communication Alan Earls reported that the subcommittee elected Julie Cornoni chair and Alan Earls vice chair/clerk. There was a final review of the comm/branding part of the budget, including a decision to keep the logo in house (Rheaume and Cornoni will tackle). In March they will provide a draft to the full committee, leaving April for tweaks and May for a ‘soft launch’ and to order logo products. The sub committee agreed to use a Wix site and explore online store options. Constant contact will be adopted with a single "Seat" to be shared by the sub committee. Reviewed brand discovery survey and found it to be a good start for further branding work. Earls will work on a general plan and cadence for media release and communication with townspeople. 2. Events. Trahan, Belcher, Brown, Joyce, Mulligan and Pellegri had first meeting ideas included: • Ringing of church bells, 250 times on March 2 [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 21, 2026

Town Council

Town Council to vote on cannabis licensing and social equity policy

The Town Council will consider amendments to the cannabis licensing local approval process and social equity policy. The meeting also includes a town infrastructure overview and a budget update for FY27.

cannabisbudgetinfrastructurezoninglibrary
✓ Decidido: Town Council approved minutes and appointed two ZBA members

The council approved the January 7, 2026 meeting minutes with a vote of Yes‑8, No‑0, Absent‑1. Councilors appointed Isabella Carter to the Zoning Board of Appeals to finish a term expiring in 2026. They also appointed Ms. Williams to the ZBA to finish a term through June 30, 2028. No other substantive actions were recorded.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet January 21, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #837 6897 1986 & Link: https://us02web.zoom.us/j/83768971986 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING January 21, 2026 Link to FranklinTV YouTube Recording: 1/21/2026 Town Council Meeting A meeting of the Town Council was held on Wednesday, January 21, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Jane Callaway-Tripp, Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Stephen Malloy, Max Morrongiello, Kenneth Ojukwu. Councilors absent: Michael LeBlanc. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Mark Cerel, Town Attorney; Julie McCann, Operations Manager. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:00 PM. He called for a moment of silence. All recited the Pledge of Allegiance. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number on the agenda. To participate i [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026

Design Review Commission

Design Review to discuss convenience store at 12 Main Street and potential bylaw revisions

The Design Review Commission will discuss a proposed convenience store at 12 Main Street (new business), approve meeting minutes from December 16, 2025, and hold a discussion on potential bylaw revisions.

design-reviewconvenience-storebylaw-revisionsfranklin-ma
✓ Decidido: Design Review Commission approves 12 Main Street sign package

The commission voted 4‑0 to approve the sign package for 12 Main Street. It also approved the December 16, 2025 meeting minutes by a 4‑0 vote and then adjourned the session with a 4‑0 vote. No other formal actions were taken.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Design Review Commission Sam Williams , Chair Andrew Pratt, Vice-Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda January 20, 2026 Virtual Meeting 7pm Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Board will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided below. When: Jan 20, 2026 07:00 PM Topic: Design Review Commission Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/88378631160 Phone one-tap: 1-301-715-8592, Meeting ID: 883 7863 1160# 1. New Business a. 12 Main Street- Franklin Convenience Store 2. Meeting Minutes a. December 16, 2025 3. New Business/Old Business a. Discussion on potential bylaw revisions
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
DRAFT Tel: (508) 520-4907 Fax: (508) 520-4906 Town of Franklin Design Review Commission Tuesday, January 20, 2026 Meeting Minutes Vice Chair Andrew Pratt called the above-captioned meeting to order this date at 7:07 PM, as a remote access virtual Zoom meeting. This meeting was recorded. The following is stated on the agenda: Pursuant to Chapter 2 of the Acts of 2025, this meeting of the Design Review Commission will be conducted via remote participation. Citizens are encouraged to attend via the Zoom platform using the information provided on the agenda. Members in attendance: Chair Sam Williams (joined at 7:16 PM), Vice Chair Andrew Pratt, Derek Darvish, Kyle Galvin, Associate Priya Natarajan. Members absent: Associate James Bartro. Also present: Morena Zelaya, Director of Planning & Community Development. NEW BUSINESS: a. 12 Main Street - Franklin Convenience Store Mr. Rocco Cavallaro of Cavallaro Signs explained the signs. He said they have the projecting sign over the main door and letters on the fascia. The rear door has a sign. There is a photo showing the windows and small window stripes at the very bottom. He said he thinks they have the footage okay. He said they are trying to find the paint to block out some of the unusual areas that are odd colors to paint over. He said the signs would not be lit. He said they may like to do that in the future. Mr. Pratt confirmed lighting is not in this sign package. Motion: To Approve t [Excerpt truncated on this listing page; use the official record for the full text.]
Sun Jan 18, 2026

Franklin's 250th Anniversary Celebration Committee

Subcommittee to finalize FY26 budget for 250th anniversary

The Budget and Fundraising Subcommittee of Franklin's 250th Anniversary Celebration Committee will meet virtually to vote on a chair, assign a minute taker, and finalize the FY26 budget after incorporating feedback from the full committee.

budgetfundraisinganniversaryfranklin
✓ Decidido: FY26 $50K budget approved by unanimous vote

The Franklin 250th Anniversary Budget Subcommittee approved the $50,000 FY26 budget with a 4‑0 vote. The town administrator confirmed that any unspent funds must be allocated by the end of the fiscal year and cannot be carried over. The committee also confirmed it has dedicated storage space on town property. The meeting was adjourned with a 4‑0 vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Budget and Fundraising January 18, 2026 5:30 PM Meeting will be held virtually via Zoom https://us05web.zoom.us/j/87445797395?pwd=W4GAzrIRkW7FvSE2WhNRg6S9oCWCfz.1 Meeting ID: 874 4579 7395 Passcode: ZAw282 Join instructions https://us05web.zoom.us/meetings/87445797395/invitations?signature=t-F-gpeO_rOeJ8E6zxFuXRpedPNWC29SdSQJTIwcMB0 A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. Agenda 1. VOTE ON CHAIR 2. DETERMINE MINUTE TAKER 3. FINALIZE FY26 BUDGET a. Incorporate feedback from committee meeting b. Discussion 4. ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin 250th Anniversary Budget Subcommittee Sunday January 18, 2026 5:30 PM Meeting Called to Order at 5:33 PM • 4 members present (Joyce, Belcher, Brennan and Brunelli), 3 absent. Agenda Items 1. Finalize 50K FY26 Budget • Discussion of whether any amount could be carried over in an escrow-like account. According to town administrator and counsel for town, unable to carry over. Must be allocated by end of fiscal year. • Joyce walks through current budget allocations and the amount left to allocate. • Discussion of including more money towards the initial deposit for fundraising gala. • Suggestion that if more money was put towards to the cost of gala, possibility of more attendees if they know that cost of tickets is going to support fundraising for future events. • Discussion of whether there is enough allocated for accessibility portion of the budget. Suggestion for using additional funds that are later raised as we have a better understanding of the nature of the events and what is necessary for each event. • Question of whether to use some funding to rent storage space. Joyce states that it is confirmed by Town Administrator that committee has dedicated storage space on town property. • Discussion of allocation of funds related to merchandise. Suggestion to increase funds related to merchandise. • Discussion related to the cost of website design and hosting. • Joyce allocates outstanding funds in accordance with above-captioned s [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Jan 16, 2026

Council on Aging

Council on Aging to accept $21,726 estate donation, seat new board member

The Franklin Council on Aging will vote on accepting a $21,725.73 donation from the Bob Catalano Estate, welcome new board member Kit Brady, and discuss committee assignments and 2026 calendar. Committees will report on budget, bylaws, housing, and program updates.

council-on-agingdonationboard-memberscommitteessenior-centerfranklin-massachusetts
✓ Decidido: Council of Aging approved prior minutes and considered moving meetings to Wednesdays

The council approved the minutes from the November 12, 2025 meeting (motion by Kim Mu‑Chow, seconded by Roberta Trahan). A motion was introduced to shift the Council of Aging meetings from Fridays at 1 PM to Wednesdays at 11 AM (motion by Kim Mu‑Chow, seconded by Beth Sawyer). The board decided to add a ten‑hour administrative support position for Social Services. No vote counts were recorded for these actions.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Council on Aging Meeting Agenda January 16, 2026 1:30 PM Meeting will be held at the Franklin Senior Center 10 Daniel McCahill Street, Franklin, MA 02038 1. Call to order; 1:30 p.m. 2. Minutes of last meeting 3. Citizen’s Comments 4. Correspondence ● Bob Catalano Estate Donation: $21,725.73 5. Director’s Report 6. Chairman’s Comments ● Welcome: New Board Member, Kit Brady 7. FOFE Liaison Report 8. Old Business 9. New Business ● COA Board Meeting Time; 2026 Calendar ● Committee Membership (tabled from October Agenda) ○ New: Staff Appreciation? ● Board Picture 10. Committee Reports (tabled from October Agenda) ● Budget Committee ○ Set Meeting once committees are finalized ● Bylaw Committee ○ Review finalized Senior Center Policies & Procedures ○ Updating COA Binder ● Expo Committee ● Housing Committee ○ Invite new housing director to come speak to board in January ● Nominating Committee ● Program Committee ● Supportive Day Committee 11. Comments 12. Agenda for Next Meeting 13. Adjournment Next Meeting: To Be Determined
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Council of Aging Amended Minutes January 16, 2026 Franklin Senior Center Members Present: Phyllis Malcolm (Vice Chair), Faith Flaherty (Secretary), Kit Brady, Jim Lane, Beth Sawyer, Kim Muchow, Tina Powderly, Roberta Trahan Excused: Lyn O’Brien (Chair) Meeting presided by Vice Chair–Phyllis Malcolm. Also Present: Sarah Amaral (Director), Casity Cheng (Deputy Director, Representatives from FOFE, one citizen visitor Called to Order: 1:30 PM Minutes of November 12, 2025 December COA meeting was cancelled due to the Senior Center closing early. Approved Motion: Kim Mu-Chow Second: Roberta Trahan Citizen’s Comments: None Correspondence: The Director expressed sincere gratitude to the estate of Robert Catalano for the estate donation of $ 21, 725.73. Director’s Report: ● The Director thanked the Board members for their attendance at Town Meetings. People do take notice and it is recommended that we continue. Attached are the schedules for future Town Meetings and Finance Committee Meetings. The Town Council has been invited to come to the Senior Center. Also attached are the scheduled monthly hours for the Council to be held at the Senior Center. ● There is new staff restructuring for the Senior Center. It will be announced to the public on February 7th. ● Budget meetings are coming up. All capital requests can be [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026

Legal Notices

Public hearing on subdivision with wetland buffer work on Symphony Drive

The Franklin Conservation Commission will hold a hybrid public hearing on a Notice of Intent for a proposed two-lot subdivision with a single-family dwelling at the end of Symphony Drive. The project involves approximately 14,560 square feet of work within the 100-foot buffer zone to isolated vegetated wetlands. The hearing will be conducted both in person and via Zoom.

conservationwetlandssubdivisionpublic-hearingzoninghousing
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520 4906 Town of Franklin Conservation Commission Town of Franklin Conservation Commission Pursuant to Massachusetts General Laws Ch. 131, s.40 (Wetlands Protection Act), the Franklin Conservation Commission will hold a Hybrid Public Hearing on Thursday, January 15, 2026 at 7:05 PM on a Notice of Intent filed by William Buckley, Jr. of Bay Colony Group, Inc., Foxborough, MA on behalf of Cypress Real Estate Development, LLC, Foxborough, MA. The applicant is proposing to construct a single-family dwelling in a new two-lot subdivision. Approximately 14,560 Square Feet (SF) of proposed work is within the 100-foot Buffer Zone to Isolated Vegetated Wetlands (IVW), of which approximately 2,638 SF is proposed within 25- to 50-foot Buffer Zone to BVW and 11,922 SF is within the 50- to 100-foot Buffer Zone to BVW. The Project is located at the end of Symphony Drive, Map 218, Lot 20, within the Rural Residential I Zoning District. The hearing will provide an open forum for the discussion. This meeting will be done remotely via the “ZOOM” platform and “In-person” in the Council Chambers of the Municipal Building, 355 East Central Street. Residents can visit the Town Website (www.franklinma.gov) and click on the Town Calendar for up to date information on how to access the meeting. All records and files for this project can be viewed at the Conservation Office located on the first floor of the Franklin Municipal Building [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026

Conservation

Conservation Commission reviews variance and NOI for 1199 West Central Street

The Franklin Conservation Commission will hear multiple Notices of Intent (NOI) and a variance request for 1199 West Central Street. Also on the agenda are an NOI for 80 Spring Street, a stormwater review for Symphony Drive/Tanglewood Estates, and minor buffer zone activity applications for 860 West Central Street and 912 Washington Street. All items involve wetland or buffer zone regulations.

conservationwetlandsbuffer-zonenotice-of-intentvariancestormwater
✓ Decidido: Commission approves sign buffer zone, restoration plan and prior minutes

The Conservation Commission voted unanimously to approve the Minor Buffer Zone Activity for a new sign at 860 West Central Street. It also approved the Restoration Plan for 444 East Central Street, with six votes in favor and one abstention. Additionally, the commission adopted the meeting minutes from December 4 and December 11, 2025, each by a 7‑yes vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
1. 7:00Pm. Revised Conservation Agenda Documents: 1-15-2026 CONSERVATION AGENDA REVISED 1-13-2026.PDF 2. 1199 West Central Street Documents: 1199 WEST CENTRAL STREET NOI PEER REVIEW 2025-12-30. PDF 2026-01-08 REVISED PLANS 1199 WEST CENTRAL STREET PDF REVISED EROSION AND SEDIMENT CONTROL PLAN.POF RESPONSE TO PEER REVIEW 2.PDF 2026-01-08 REQUEST FOR VARIANCE. PDF 3. 80 Spring Street Documents: 8757 - PEER REVIEW RESPONSE LETTER POF 8757-NOI PLAN_REV1 STAMPED 20251219. PDF 80 SPRING ST NOI REVIEW 2025-12-04. PDF 4, Symphony Drive/Tanglewood Estates It Documents: 2026 NOI APPLICATION TANGLEWOOD ESTATES.POF 25-0108 STORMWATER 20251222. PDF 25-0108B DEFINITIVE PLAN 20251222 PDF 5. Minor Buffer Zone Activity Documents: MBZA APPLICATION 860 WEST CENTRAL STREET.PDF 912 WASHINGTON STREET MBZA APPLICATION. PDF
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Tel: (508) 520-4929 Fax: (508) 520-4906 1 Town of Franklin Conservation Commission January 15, 2026 Meeting Minutes As stated on the agenda, this meeting is available to be attended in person and via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or citizens can participate by using the Zoom link provided on the agenda. This meeting will be held in the Town Council Chambers on the Second Floor of the Municipal Building for citizens wishing to attend in person. Commencement Chair Mark LePage called the above-captioned meeting to order this date at 7:00 PM as a remote/virtual/in-person meeting. Members in attendance: Mark LePage, Lui Puga, Michael Rein, Richard Johnson, Roger Trahan, Nicole Chiaramonte, Matthew Stoltz. Absent: None. Also present: Breeka Li Goodlander, Director of Conservation (via Zoom); Tyler Paslaski, Administrative Staff. Note: Documents presented to the Conservation Commission are on file. SCHEDULING None. GENERAL BUSINESS Minor Buffer Zone Activities: 860 West Central Street Mr. Patrick Downing said he and his wife are the owners of GlenPharmer Distillery. He said he submitted an MBZA application to erect a new sign. He said Mine Brook is in the area. He reviewed the photos that were provided in the meeting packet. He said there is currently a sign; they would be moving it lit [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026

Cultural District Committee

Committee to review FY2026 grant status and assign district ambassadors

The Franklin Cultural District Committee will review the status of the MCC FY2026 Cultural District Investment Grant, discuss additional 2026 initiatives, and assign a grant recipient and district initiative ambassadors. Updates will include the A-Wreath-of-Franklin event and a World Cup configuration item. The meeting also covers approval of December 2025 minutes and any unfinished or new business.

cultural-districtgrantsartseventsfranklin-maminutes-approvalcommittee-update
✓ Decidido: Committee allocated $4,800 of MCC grant for artsy boxes and World Cup events

The Cultural District Committee approved the minutes from the December 11, 2025 meeting. It voted to allocate $1,000 to restore the artsy boxes and $3,800 to fund World Cup‑related events, with four members voting in favor and one abstaining. No other motions were decided.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Cultural District Committee MeetingThursday, January 15, 2026, 6:30pmFranklin Senior Center, 10 Daniel McCahill St., Franklin AGENDAA.Review and Approval of the Meeting Minutes - oDecember 11, 2025, Cultural District Meeting B.Updates from Cultural District Chair, John LoPrestioMCC FY2026 Cultural District Investment Grant StatusoDiscuss additional 2026 District initiativesoFCD Investment Grant Portal (timing or if needed based on district initiativesoAssignment of Grant Recipient and District Initiative AmbassadorsC.Department of Arts, Culture & the Creative Economy Updates, Cory Shea oA-Wreath-of-Franklin, overviewoWorld Cup Configuring 25 Unfinished Business (Voting if applicable). Unfinished business is a category of business that includes items that were not completed in a previous meeting. This can include: Items that were on the agenda but were not discussed because the meeting ended. Items that were being discussed when the meeting ended. Items that were postponed to the current meeting. New Business (Voting if Applicable) Member Round Table (updates, not voting) Any other Updates/Feedback Adjournment Agenda Prepared By: John LoPresti, Cory Shea, Pandora Carlucci Date of Preparation: January 5 and 6, 2026Posted: Sent to Town Clerk on January 9, 2026 for posting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Cultural District Committee Meeting Minutes | January 15, 2026 Meeting Name: Cultural District Committee Meeting Date: January 15, 2026 Time: 6:30-8:30 pm Location: Franklin Senior Center Chairperson: John LoPresti Secretary: Katherine Botelho 1. Call to Order ● Time: 6:32 p.m. ● Chairperson: John LoPresti ● Attendance: ○ Present Members: ■ John LoPresti ■ Pandora Carlucci ■ Peter Rochat ■ Roberta Trahan ■ Katherine Botelho ■ Absent Members: ■ Patrick Conlon ■ Sue Cass ○ Guests/Other Attendees: ■ Margaret Munson, Franklin Art Association ■ Cory Shea, Director of Arts, Culture and the Creative Economy 2. Approval of Previous Meeting Minutes ● Minutes from December 11, 2025 ○ Approved: Yes ○ Amendments: No 3. Agenda Items from January 12 Meeting: a. Updates from the Chairperson ● Chairman LoPresti reported that the MCC grant contract has been received and the committee could now move forward with the previously funded initiatives totaling $10,188. He offered two options for the remaining funds of $4,812. One would be to call for artists and the other to update the artsy boxes and allocate funds for soccer activities related to the World Cup. ● Member Trahan suggested that the remaining funds were not sufficient to provide grants and that they be used to restore the artsy boxes and fund soccer related activities which would involve the current cultural district partners. ● LoPresti provided an update on previously agreed up [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026

Charles River Pollution Control District (CRPCD)

CRPCD to review NPDES permit appeal and approve warrants

The Charles River Pollution Control District will discuss an update on the 2025 NPDES Permit Appeal and review reports from the engineer and executive director. The board will also vote on the approval of Warrant 26-07.

sewerenvironmental-permitsbudgetwater-pollution
✓ Decidido: Board approved $402,292.55 O&M warrant for the district

The commissioners approved Warrant #26-07 covering operating and maintenance costs of $402,292.55 with a unanimous vote. They also unanimously approved the minutes from the December 11 and December 22, 2025 meetings. The meeting was then adjourned by unanimous vote.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Charles River Pollution Control District Franklin · 1973 · Medway 66 Village Street · Medway · Massachusetts · 02053 MONTHLY MEETING JANUARY 15, 2026 at 3:00 P.M. CONFERENCE ROOM AGENDA 1. Update on 2025 NPDES Permit Appeal 2. Approval of Warrant 26-07 a) O & M $ XXX,XXX b) Capital $ XXX,XXX 3. Engineer’s Report 4. Executive Director’s Report a) Sewer Connections (December 2025) Franklin Storage Units 30 gpd b) NPDES Permit Compliance Report (December 2025) 5. Public Comment 6. Approval of Minutes from the December 11, 2025 Monthly Meeting and the December 22, 2025 Meeting 7. Anticipated Topics for the Thursday, February 12, 2026 Monthly Board Meeting at 3:00 pm a) Update on FY 2027 Budget Estimate
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
CHARLES RIVER POLLUTION CONTROL DISTRICT 66 Village Street, Medway, MA 02053 Minutes from January 15, 2026 Monthly Meeting - 3:03 p.m. The meeting was held in the John McCahill Conference Room at the District’s treatment facility. In attendance were Chairman David C. Formato, District Commissioners Ted Kenney, Douglas M. Downing, Wolfgang Bauer and Mark Cataldo, Executive Director Elizabeth Taglieri, Engineer Kristen Mucciarone and Executive Secretary Barbara W. Maffeo. Also in attendance were Ellen Rosenfeld representing the Town of Millis Select Board, Peter Pelletier, Director Medway Department of Public Works, Jesse Riedle, Director Bellingham Department of Public Works and Sean Harrington, Assistant Director Bellingham Department of Public Works. Vice Chairman Kenney called the meeting to order. Chairman Formato joined the meeting at 3:15 p.m. and took the chair. Item #1 was deferred awaiting the Chairman. The following attachments were presented during the monthly meeting and are on file at the District with the approved minutes. e Year to Date O & M Budget versus Actual July - December 2025); e O&M Budget Prior Year Comparison (July 2024 - December 2024 vs July 2025 - December 2025); e Septage Revenue Prior Year Comparison (July 2024 - December 2024 vs July 2025 - December 2025); e Sewer connections (December 2025); e Overview of FY 2026 Spending dated January 15, 2026; e Copy of Credit Card Expenses Statement for Harbor One Credit Card-Elan Financial dated December [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 14, 2026

Board of Assessors

Board will consider entering executive session to discuss confidential tax matters

The Franklin Board of Assessors will first vote to approve minutes from five prior meetings held between August 2025 and December 2025. It will then review motor vehicle excise tax abatements and related letters, personal property abatements and letters, and real estate abatements, exemptions, ATB appeals, and letters. Finally, the Board will consider a motion to go into executive session to discuss confidential abatements, exemptions, and property income and expense disclosures.

board-of-assessorsminutestax-abatementsexecutive-sessionreal-estatemotor-vehiclepersonal-property
✓ Decidido: Board presented valuation data; no decisions were made

The Board of Assessors presented general income valuation information and overlay account data to the Finance Committee. The meeting consisted mainly of questions and answers. No approvals, denials, or other actions were recorded.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF ASSESSORS MEETING AT FRANKLIN MUNICIPAL BUILDING, COUNCIL CHAMBER, 355 EAST CENTRAL STREET, FRANKLIN, MASSACHUSETTS WEDNESDAY, JANUARY 14, 2026 AT 6:00 PM AGENDA The following is a list of matters reasonably anticipated by the Chair that may be discussed. Not all items may be discussed and other related items not listed may be raised for discussion to the extent permitted under Massachusetts General Law. A. APPROVAL OF MINUTES: Regular & Executive Sessions of August 18, 2025, October 20, 2025, November 5, 2025, November 19, 2025 and December 3, 2025. B. ADMINISTRATION, OLD BUSINESS AND NEW BUSINESS (any matters not otherwise in a specific category below). 1. Meeting with the Finance Committee at 6:00 PM. C. MOTOR VEHICLE EXCISE 1. MV Excise Tax Abatement Denials. 2. MV Monthly Letters. D. PERSONAL PROPERTY 1. PP abatements. 2. PP Monthly Letters. E. BOAT EXCISE F. REAL ESTATE 1. RE Abatements, Exemptions & ATB Appeals. 2. RE Monthly Letters. G. EXECUTIVE SESSION 1. I move that the Board vote to go into Executive Session under Purpose 7 to discuss and vote on matters that are confidential in accordance with law, such as, but not limited to abatements and exemptions (MGL Ch. 59, Sec. 60), or property income & expense disclosures (MGL Ch. 59, Sec 52B). Following Executive Session, the Board will return to Open Session.
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
MINUTES OF THE BOARD OF ASSESSORS MEETING – JANUARY 14, 2026 THE BOARD OF ASSESSORS MET AT THE FRANKLIN MUNICIPAL BUILDING, COUNCIL CHAMBER, 355 EAST CENTRAL STREET, FRANKLIN, MASSACHUSETTS ON WEDNESDAY, JANUARY 14, 2026 AT 6:00 РM. MEMBERS: CHRIS FEELEY, CHAIRMAN – present DAN BALLINGER, CLERK – not present CHERYL HANLY, MEMBER - present STAFF: KEVIN W. DOYLE, DIRECTOR OF ASSESSING - present A. APPROVAL OF MINUTES - Minutes of the Regular & Executive Sessions were not available.B. ADMINISTRATION: OLD BUSINESS & NEW BUSINESS 1. The Board assembled to present general income valuation information and data about the overlay accounts at this Finance Committee meeting. A series of questions from the committee members and responses from the Board predominated this meeting. The written valuation and overlay materials were later provided to the committee members through their chair. С. MOTOR VEHICLE EXCISE D. PERSONAL PROPERTY Е. BOAT EXCISE F. REAL ESTATЕ G. EXECUTIVE SESSION 1. There was no Executive Session at this meeting on January 14, 2026. Board adjourned, agreeing to meet again on Monday, March 30, 2026. Respectfully submitted, Rein Doyle M Kevin W. Doyle, Director of Assessing Board Approval: .y chuye Handy l Bhln
Wed Jan 14, 2026

Historical Commission

Historical Commission to review lighting, hoop at former church

The Franklin Historical Commission will review Habitat for Humanity's request for exterior lighting and a basketball hoop at the former Old South Meeting House. It will also discuss exhibit planning, possible acquisitions and deaccessions, and plans for a short Horace Mann film. Other topics include updates on the Tri-County Bell Stand and a new museum payment system using UniPay and QR codes.

historic-preservationhabitatold-south-meeting-housemuseumhorace-mann
✓ Decidido: Historical Commission unanimously approves exhibit procedure and deaccessions

The commission unanimously approved the December 10, 2025 minutes. It accepted a new exhibit procedure and the changes to the Old Congregational Meeting House, both by unanimous vote. The commission also voted unanimously to deaccession a large paper cutter, an old television, and red TJ Maxx display cabinets. The meeting was adjourned unanimously at 7:03 PM.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin MassachusettsHistorical CommissionAgenda, Weds., Jan. 14, 2026, 6:00 pm Meeting at the Museum, 80 W. Central StAPPROVAL OF MINUTES – Dec. 10, 2025CITIZENS COMMENTS: PRESENTATIONS: none.FFHM REPORT: SUBCOMMITTEE REPORTS: TREASURER: COMMUNITY PRESERVATION COMMITTEE: FRANKLIN 250 UPDATEARCHIVIST UPDATEOLD BUSINESS:Update pm Tri-County Bell StandUpdate on Kerri Bertone we now have processes for museum to ‘earn’ money including direct link to UniPay and a secure QR code. Thanks to Rowan for taking on these additional responsibilities.Thanks to everyone, especially Scott (and as always, Jan) for putting in extra hours during school vacation weekThanks to Brandon for opening up on Thursday evenings.Revolution stories being added to KiASKNEW BUSINESS: Review Habitat approvals for former Old South Meeting House Lighting and B-ball hoopReview and Discuss Exhibit Planning DocumentDiscuss continuing updates to exhibits….Discuss possible assessions and deassessions.Hoping to develop short Horace Mann film from public domain resources in time for May 4Chris Flynn also working on film about MannCoordinating with Schools and Jayson Joyce to better celebrate MannMusic Programs for 2026Working with Rowan on Future Planning and Procedures documentary1-2 Tax Workoff Volunteers for 2026Bus tour this coming week (Could we do something monthly?)Upcoming events into 2026COMMISSIONERS COMMENTS: ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Town of Franklin Massachusetts Historical Commission Meeting Minutes, January 14, 2026 , 6:00 pm Commission Members Present: Alan Earls, Phyllis Malcolm, Jan Prentice, Scott Mason, Will Lee, Brandon Carrico, Archivist Rowan Lowell APPROVAL OF MINUTES: The minutes from December 10, 2025 were unanimously approved. CITIZENS COMMENTS: None. PRESENTATIONS: None. FFHM REPORT: No members present. The Commission is going to meet with the Friends of the Museum to request $3,498 at the meeting February 8th. SUBCOMMITTEE REPORTS: ● TREASURER: No new business. ● COMMUNITY PRESERVATION COMMITTEE: No new business. ● FRANKLIN 250TH UPDATES: The 250th Committee got lots of ideas from the originator of the Easton and Sharon 300th Anniversary Committees. ● ARCHIVIST UPDATE: Rowan has been working to update the website with more current exhibits and an online donation portal. Patty Howe is helping Rowan digitize more Chilson photographs. Scott suggested that every commission member came up with an exhibit for the next meeting. Rowan put forward a new exhibit procedure, which was accepted as presented by the Commission. Scott made the motion to accept, seconded by Jan. The vote to accept was unanimous. OLD BUSINESS: ● Alan reached out to the teacher at Tri-County who is coordinating the bell stand. He reported that work was in progress. ● Alan thanked Scott for his work on the exhibit and to Jan for working during the school vacation. He also thanked Brandon for keepi [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 14, 2026

Finance Committee

Finance Committee to review FY2026 capital funds and stabilization resolutions

The Finance Committee will discuss the FY2026 Capital Improvement Book and analyze FY2025 expenditures and revenues by department. The body will also consider resolutions regarding stabilization, capital, and enterprise funds.

budgetcapital-improvementfinancetown-administration
✓ Decidido: Finance Committee approved December 10, 2025 minutes

The Finance Committee met on January 14, 2026 at the municipal building. The committee approved the minutes from the December 10, 2025 meeting by unanimous voice vote. No other motions were voted on; the remainder of the meeting consisted of presentations and discussion on property assessment, tax rates, water and sewer capacity, fire and police staffing, and school enrollment.

📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Finance Committee Meeting Agenda & Meeting Packet Wednesday, January 14, 2026 6:00 PM Franklin Municipal Building 355 East Central Street, 2nd Floor Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #854 4616 9405 & https://us02web.zoom.us/j/85446169405 Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda 1. Call to Order 2. Public Comments - Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Finance Committee Meeting Minutes Wednesday, January 14, 2026 6:00 PM Franklin Municipal Building, Council Chambers, 355 East Central Street A meeting of the Finance Committee was held on Wednesday, January 14, 2026 at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Members Present George Conley, Chair, Natalie Riley, Vice Chair, Lauren Nagel, Clerk, Christopher Diaz, John Barnes, Ryan Lavorgna, Shannon Nealon, Jen D’Angelo Member not Present Bill Batchelor Agenda 1. Call to Order SUMMARY: George Conley, Finance Committee Chair, called the January 14th meeting of the Finance Committee to order at 6:00 PM. VOTE(S): [NONE] 2. Public Comments - Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Finance Committee cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Finance Committee may ask town staff to review the matter. Nothing herein shall prevent the town staff from correcting a misstatement of fact. SUMMARY: Steve Sherlock, resident of 13 Magnolia Drive and community infor [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026

School Committee

School Committee to set ECDC tuition rates for 2026-27

The Franklin School Committee will vote on the 2026-27 tuition rate for the Early Childhood Development Center and approve the FHS Program of Studies. Other action items include a first reading of a middle school pathway exploration policy and approval of a Galapagos Islands field trip. Consent agenda items cover multiple student trips and gift acceptances.

educationschool-committeetuitioncurriculumfield-tripspolicygifts
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin School Committee January 13, 2026 Municipal Building – Council Chambers 7:00 P.M. Meetings are recorded by Franklin TV and shown on Comcast channel 11 and Verizon channel 29 Any individual who also wishes to record this meeting must notify the Chair Vision Statement The Franklin Public Schools will foster within its students the knowledge and skills to find and achieve satisfaction in life as productive global citizens. Members of the public are welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Webinar feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak during the Citizen’s Comments portion of the agenda will be able to raise their hand to be recognized by the Chair. The webinar host will invite the attendee to unmute for comment. Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89815697830?pwd=ibCgCqWY1dn4aTDVawNq2CCnJLJ9P5.1 Passcode:773585 Join via audio: +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US A G E N D A “The listing of m [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026

Franklin's 250th Anniversary Celebration Committee

Subcommittee to plan Franklin's 250th anniversary celebration

The 250th Anniversary Celebration Committee will meet to elect a chair, approve minutes, and review budget items and brand materials for the upcoming celebration.

anniversarybudgetcommitteecommunicationsplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
250th Anniversary Celebration Committee Subcommittee on Communications Agenda January 13, 2026 5:30 PM Meeting will be held virtually via Google Meet A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person and hybrid via Zoom. GOOGLE MEET WEBINAR DETAILS: htips://meet.google.com/qeo-fmej-iez > Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. > All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. > All speakers will be required to state their full name and street address before commenting Agenda 1. ELECT SUBCOMMITTEE CHAIR a. Upon election, Chair appoints someone to take minutes for the subcommittee. 2. APPROVAL OF MINUTES a. December 16, 2025 3. BUDGET LINE ITEMS a. Final look at branding and website line items in the FY26 Budget Sheet 4. BRAND DISCOVERY SUMMARY a. Review the Brand Discovery response summary b. Prepare discussion for General Committee on 01/22/26 5. ADJOURN
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
250th - Communications Subcommittee MeetingVia ZoomTuesday, January 13, 2026 · 5:30 – 6:30pmThe meeting came to order at 5:30 with Juli Cornoni, Alan Earls, and Ali Rheaume present.- Elect Officers. – Subcommittee Chair-- Ali Rheaume nominated Cornoni, Earls seconded. There was no discussion, Cornoni was approved unanimously.Cornoni indicated she would appreciate an assistant and nominated Earls as Vice Chair/Clerk. This was seconded and voted unanimously.* The chair requested a last look at the budget before submission which became a discussion about needed deliverables such as a logo and the best ways to get there. The upshot was agreement to keep the logo ‘in house’ with development to be led by Cornoni and Rheaume. Community (adult and student) can be engaged for future specific design help (e.g. a design for a totebag image)* A timeline for development was discussed working back from Strawberry Stroll, June 12. March will be draft reveal to full committee. April will be for tweaks. May ‘soft launch’ and order logo products.* Basic approach identified in budget to using a Wix site was endorsed, with the committee planning on doing much of the work.Online store details to be worked out* CRM/Emailing system. Rheaume strongly endorsed ConstantContact from her experience. Will likely fund one user.* Brand Discovery Survey discussed briefly. General consensus is that it represents a good breadth of views and concerns about F250- Review Brand Discovery Summary*Earls to work on [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026

School Committee

School Committee Policy Subcommittee to review remote participation and facility rentals

The Policy Subcommittee will discuss several policy revisions and new items. The meeting includes a review of the Middle School Pathway Exploration and discussions on online fundraising and facility rental policies.

educationschool-policyfacility-rentalsfundraising
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN SCHOOL COMMITTEE Policy Subcommittee Meeting DATE: 1/13/26 TIME: 6:00 – 7:00 pm Members of the public are now welcome to attend committee meetings in person. Additionally, in an effort to ensure citizen engagement, citizens will be able to continue to view the public meeting using Zoom. We will use the Zoom Meeting feature. You may view the meeting with the link or phone numbers below. Participants wishing to speak will be able to raise their hand to be recognized by the Chair. The meeting host will invite the attendee to unmute for comment. Location: Municipal Building 3rd floor Training Room Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/82186822065?pwd=VnbPMLyoWfGCwoX6bkGTmyLBlBBbPd.1 Passcode:925526 Join via audio: +1 646 931 3860 US +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A “The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may, in fact, be discussed, and other items not listed may also be brought up for discussion to the extent permitted by law.” I. Attendance - II. Review of Minutes III. Overview of Policies & Procedures IV. Approved Policies A. none V. Discussion of Policies sent to School Committee A. IHAIA - Middle School Pathway Exploration VI. Policy Revi [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

Housing Authority

Board will consider a new Management Agreement for Norfolk Housing Authority

The Franklin Housing Authority Board will hold a public hearing on the 2026 Annual Plan and review the minutes from the December 8, 2025 meeting. They will receive reports on accounts payable, operating statements, and updates from the Community Preservation Committee and Norfolk Housing Authority. New business includes a Management Agreement for Norfolk, a policy change request, a health insurance incentive, and a staff bonus.

housingfinancecontractshealth-insurancestaffpublic-hearingupdates
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Housing AuthorityPeter L. Brunelli Community Center 1000 Central Park TerraceFranklin, MA 02038Regular Meeting of the Board of CommissionersJanuary 12, 20264:30 PMAGENDAChairman requests all cell phones to be silencedRoll Call Public Hearing 2026 Annual PlanMinutesMinutes of the Regular Meeting December 8, 2025Accounts PayableAccounts Payable for December 2025Capital One Charges for December 2025 -- $0.00Director of Facilities ReportDirector Report Operating Statements – November 2025Community Preservation Committee (CPC) Update – Commissioner Feeley CorrespondenceNone Norfolk HA Update – Managing AgencyLaundry Room/Office Project construction, laundry room 100% complete, office started 2-New maintenance staff started, tenants excited for new change Norfolk delinquency Old BusinessSafety Consultation Services – provided by Worcester Housing Authority. Received response from insurance not going forward with service.2026 Regular Meeting ScheduleNew BusinessManagement Agreement for NorfolkPolicy Change request On-CallHealth Insurance IncentiveStaff BonusAdjournment
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Franklin Housing Authority Peter L. Brunelli Community Center Regular Meeting Minutes January 12, 2026 The Regular Meeting of the Franklin Housing Authority took place at the Peter L. Brunelli Community Center located on Central Park Terrace. Chairman George A. Danello called the meeting to order at 4:30 PM. © ROLL CALL Members Present Members Absent George A. Danello, Chairman Christopher K, Feeley, Vice Chairman Andrew M. Kepple, State Appointee Christopher Lennon, Tenant Board Member Jennifer Knight-Levine, Commissioner © Others Present Nayda Sanchez Delesus, Executive Director Brian Drainville, Director of Facilities Candice Day, Administrative Assistant Helen Cherry, Tenant Eleanor Thompson, Tenant © Public Hearing 2026 Annual Plan Motion is made by Commissioner Feeley, second by Commissioner Lennon to go into Public Hearing to discuss Annual Plan. All in favor. So voted. * Discussion was made by Brain Drainville and Nayda Sanchez DeJesus regarding Annual Plan and upcoming projects. One tenant asked about the windows at Winter Street (667-04), it was explained that project is on our Annual Plan. Motion is made by Commissioner Feeley, second by Commissioner Lennon to end Public Hearing. All in favor. So voted, © MINUTES Motion is made by Commissioner Feeley, second by Commissioner Kepple to approve the Minutes of the Regular Meeting of December 8, 2025. Allin favor. So voted. ACCOUNTS PAYABLE Motion is made by Commissioner Feeley, second by Commissioner Kepp [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

Planning Board

Planning Board to hold public hearings on two subdivision plans

The Franklin Planning Board will hold public hearings regarding subdivision applications for 47 Partridge Street and Symphony Drive. The board will also address endorsements and forms for Lot 2 Forge Parkway and the Uncas Ave Extension.

zoningsubdivisionsland-useplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD Agenda & Meeting Packet January 12, 2026 Meeting will be held at the Municipal Building 2nd floor, Council Chambers, 355 East Central Street 7:00 PM All citizens are welcome to attend the meeting in person at the Town Hall or dial into the meeting using the provided phone number (Cell phone or Landline Required) OR citizens can participate by copying the link (Phone, Computer, or Tablet required). Please click on the link https://us02web.zoom.us/j/83579616301 or call on your phone at 312- 626-6799, meeting #83579616301. PUBLIC HEARINGS 1. 47 Partridge Street (Donovan Estates) – Definitive Subdivision 2. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision - Initial Definitive Subdivision Plan Application and Correspondence GENERAL BUSINESS: A. Endorsement: Lot 2 Forge Parkway B. Partial Form H: Uncas Ave Extension This agenda is subject to change. The next meeting of the Planning Board is scheduled for February 9, 2026.
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Planning Board January 12, 2026 Meeting Minutes Chair Gregory Rondeau called the above-captioned meeting held in the Municipal Building, 2nd floor, Council Chambers, 355 East Central Street, Franklin, MA, to order this date at 7:00 PM. The public had the option of attending the meeting live at the Town Hall or dialing into the meeting using the provided phone number or participating by copying the provided link. Members in attendance: Gregory Rondeau, Chair; Jay Mello, Vice Chair; Christopher Stickney, Clerk; Mark Mucciarone; Eric Steltzer (via Zoom); William Lee, associate member. Members absent: None. Also present: Amy Love, Town Planner; Michael Maglio, Town Engineer (via Zoom); Steven Lee, BETA Group (via Zoom); Matthew Crowley, BETA Group (via Zoom). PUBLIC HEARINGS 1. 47 Partridge Street (Donovan Estates) – Definitive Subdivision Ms. Love said the Planning Board had a 90-day decision for this which would expire at the end of the month. She said they gave us an extension until March 31, 2026, and that has been filed with the town clerk. They are requesting continuation. She recommended February 9. Motion to Continue 47 Partridge Street (Donovan Estates), Definitive Subdivision, to February 9, 2026. Rondeau. Second: Mello. Roll Call Vote: Rondeau-YES; Mello-Yes; Stickney-YES; Mucciarone- YES; Steltzer-YES. Vote: 5-0 (5-Yes; 0-No). 2. Symphony Drive (Tanglewood Estates II) - Private Definitive Subdivision - Initial Motion to Waive the readi [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

School Committee

School Committee sets 2026 goals and engagement strategy

The Franklin School Committee Community Relations Sub Committee will meet virtually to establish mission statements, set 2026 goals, and brainstorm engagement activities. The meeting agenda lists these items as anticipated topics for discussion.

school-committeecommunity-relationsgoalsvirtual-meeting
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Franklin Public Schools - Franklin School Committee Community Relations Sub Committee January 12, 2026 6:30 PM Virtual Only Join from PC, Mac, iPad, or Android: https://us06web.zoom.us/j/89121391608?pwd=nGegLW6nVs7u9tZUjon7XXOMc1BKqm.1 Passcode:704911 Join via audio: +1 301 715 8592 US (Washington DC) +1 305 224 1968 US +1 309 205 3325 US +1 312 626 6799 US (Chicago) +1 646 558 8656 US (New York) +1 646 931 3860 US +1 386 347 5053 US +1 507 473 4847 US +1 564 217 2000 US +1 669 444 9171 US +1 689 278 1000 US +1 719 359 4580 US A G E N D A "The listing of matters are those reasonably anticipated by the Chair which may be discussed at the meeting. Not all items listed may in fact be discussed and other items not listed may also be brought up for discussion to the extent permitted by law." ● Establish Mission Statement / 2026 Goals ● 2026 Engagement & Activity Brainstorming ● Newsletter Planning
Mon Jan 12, 2026

Legal Notices

Public hearing on Tanglewood Estates II Symphony Drive Extension

The Franklin Planning Board will hold a public hearing to consider a definitive subdivision application for the Tanglewood Estates II Symphony Drive Extension. The proposal, submitted by Cypress Real Estate Development, LLC and prepared by Bay Colony Group, Inc., seeks to extend Symphony Drive and create a two‑lot subdivision with stormwater utilities in the Rural Residential I district. The hearing will take place on Monday, Jan 12, 2026 at 7:00 PM in the Town Council Chambers, with remote attendance available.

zoningplanningsubdivisionroadshousingpublic-hearingdevelopment
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN PLANNING BOARD PUBLIC HEARING NOTICE In accordance with the Town of Franklin Zoning By -Laws, the Franklin Planning Board will hold a public hearing at the Town Hall (and can also be attended remotely) on Monday, January 12, 2026 at 7:00 PM in the Town Council Chambers of the Franklin Municipal Building, 355 East Central Street, for a Definitive Subdivision application titled “Private Definitive Plan of Land in Franklin, MA Tanglewood Estates II Symphony Drive Extension” prepared by Bay Colo ny Group, Inc., Foxborough, MA, and submitted to the Department of Planning & Community Development on December 23, 2025, by Cypress Real Estate Development, LLC, Foxborough, MA. The property is located in the Rural Residential I Zoning District (Assessors Map 218 Lot 020) beyond the end of the Symphony Drive cul -de-sac. The applicant is proposing to extend the roadway at the end of Symphony Drive and construct a 2 -lot subdivision with associated stormwater utilities. Please note: This will be your only written notice of this public hearing. Should the Planning Board vote to continue this Public Hearing, the date and time will be posted on the Planning Board’s website under Agendas. Please contact the Department of Planning & Community Development at (508) 520-4907 if you require further information or if you need to make arrangements to provide translation services for the hearing impaired, or for persons with language barriers. Copies of the plan and sup [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026

Benjamin Franklin Classical Charter Public School

Charter school board to vote on December meeting minutes

The Benjamin Franklin Classical Charter Public School Board of Trustees is meeting primarily for updates and committee reports. The only action item is a vote to approve the minutes from the December 11 meeting.

schooleducationboard-of-trusteesgovernance
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BENJAMIN FRANKLIN CLASSICAL CHARTER PUBLIC SCHOOL January 8th BOARD OF TRUSTEES MEETING Thursday, January 8, 2026; 7-10pm In Person-BFCCPS Google Meet joining info meet.google.com/dpt-ypip-qrd Video call link: Or dial: (US) 1 414-909-5071 PIN: 327 335 126# 7:00 Call to Order 7:05 Open Comment Period Ti . | ; = 7:10 Review and vote on meeting minutes from 12/11 meeting 7:15 ED Update = 7:45 HOS Update 8:00 Faculty Rep Update 8:15 BFEF Update 8:45 Committee Updates -DEIB -Facilities -Finance -Governance -HR -Mission 9:00 Task List 9:15 Adjourn The scheduled times as listed are approximate.
Thu Jan 8, 2026

Legal Notices

Public hearing on two National Grid pole petitions

The Town Administrator will hold a public hearing on January 8, 2026, at 12:30 p.m. to consider two pole petitions from National Grid. One petition proposes installing two new joint-use poles on Chestnut Street; the other proposes a mid-span pole on Grove Street. Citizens may attend in person or via Zoom.

public-hearingutilitiespolesnational-gridfranklin-ma
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITIONS (2) PUBLIC HEARING January 8, 2026, 12:30pm 1. Pole Petition Plan #31195514: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. CHESTNUT STREET National Grid proposes to install 2 new JO Poles on Chestnut Street. ● New Pole #7-50 approximately 20 ft. Northeast of Pole #7 ● New Pole #7-51 approximately 40 ft. Northwest of new Pole # 7-50 2. Pole Petition Plan #31247634: Massachusetts Electric Company d/b/a National Grid GROVE STREET National Grid proposes to install a 50 ft. Class H1 Mid-span Pole between Pole #45-85 & #46-80 on Grove Street. ● New Pole #45-90 beginning at a point approximately 770 ft. North of the centerline of the intersection with Kenwood Circle, between Pole #45-85 and #46-80. In conformity with the requirements of Section 22 of Chapter 166 of the General Laws (Ter. Ed.) you are hereby notified that a Public Hearing will be held in theTraining Room on the third floor of the Municipal Building, 355 East Central Street, Franklin, MA, by the Town Administrator on Thursday, January 8, 2026 at 12:30 p.m. upon the two pole petitions attached to this notice and described above. All citizens are welcome to attend public meetings in person. Additionally, in an effort to maximize citizen engagement opportunities, citizens will also be able to participate remotely via [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026

Pole Petition Hearing

Town to weigh two utility pole installations on Chestnut and Grove Streets

The Franklin Pole Petition Hearing will consider two requests from National Grid (and Verizon for one) to install new utility poles. The proposals include two new joint poles on Chestnut Street and a mid-span pole on Grove Street. The meeting is a public hearing where residents can participate in person or via Zoom.

utilitiespolespublic-hearingnational-gridverizonfranklin
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLE PETITION HEARING AGENDA January 8, 2026 12:30 PM Pole Petition Hearing will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. Additionally, residents are also welcome to participate remotely via Zoom. ZOOM WEBINAR DETAILS: D # 891 8864 9327 & Link: https://us02web.zoom.us/j/89188649327 Call-In Phone Number: 1-929-205-6099, enter Meeting ID then # ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. Pole Petition Plan #31195514: Massachusetts Electric Company d/b/a National Grid & Verizon New England, Inc. CHESTNUT STREET National Grid proposes to install 2 new JO Poles on Chestnut Street. ● New Pole #7-50 approximately 20 ft. Northeast of Pole #7 ● New Pole #7-51 approximately 40 ft. Northwest of new Pole # 7-50 2. Pole Petition Plan #31247634: Massachusetts Electric Company d/b/a National Grid GROVE STREET National Grid proposes to install a 50 ft. Class H1 Mid-span Pole between Pole #45-85 & #46-80 on Grove Street. ● New Pole #45-90 beginning at a point [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026

Municipal Affordable Housing Trust

Planning Director to present new affordable housing resale process

The Municipal Affordable Housing Trust will meet to review new resale forms and processes. The body will also address meeting minutes and other new or old business.

affordable-housingplanningcommunity-development
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Agenda January 8, 2026 Hybrid In person & Virtual 2pm To all residents- this meeting is available to be attended in person at the 3rd Floor Meeting Room of the Town of Franklin Municipal Building or via the Zoom platform. In an effort to ensure citizen engagement and comply with open meeting law regulations, citizens will be able to dial into the meeting using the provided phone number, or residents can participate by using the Zoom link provided on the agenda. Zoom participants wishing to speak should use the ‘raise hand’ feature to indicate to the host that they wish to be allowed to unmute. When: Jan 8, 2026 02:00 PM Eastern Time Topic: Franklin Municipal Affordable Housing Trust Fund Meeting Join from PC, Mac, iPad, or Android: https://us02web.zoom.us/j/86915904926 Phone: (646)931-3860. Meeting ID: 86915904926 1. Presentation on new affordable housing resale forms and process by Morena Zelaya, Director of Planning & Community Development. 2. Meeting Minutes a. March 13, 2025 b. December 11, 2025 3. New Business/Old Business
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
DRAFT Municipal Affordable Housing Trust Christopher Vericker, Chair 355 E. Central St. Franklin, MA 02038 P. 508.555.5555 www.franklinma.gov Meeting Minutes January 8, 2026 In-person and zoom Meeting called to order at 2:08pm by Chair Chris Vericker. Trust Members present were: Chair Chris Vericker, Member Kimberly Mu-Chow, Vice-Chair Christopher Feeley, Secretary Susan Younis, Member Mark Minnichelli (newly appointed) and Town Administrator/Member Jamie Helen. Additional attendees were Planning & Community Development Director Morena Zelaya, and Shannon Nesbit, Franklin Veteran Service Officer Meeting Minutes: Minutes from March 13, 2025 : have been presented for review and approval. After a brief discussion and clarification points, Chris Feely made a motion to approve the minutes. Kim seconded. Vote: Sue Younis: yes, Chris Veriker: yes, Chris Feeley: yes, Jamie Hellen: yes, Kim Mu-Chow: yes Minutes from the December 11, 2025 : meeting have been presented for review and approval; Chris Feely made a motion to approve the minutes. Kim seconded. Vote: Sue Younis: yes, Chris Feely: yes, Chris Veriker: yes, Kim Mu-Chow: yes, Jamie Hellen: yes. Introduction: Recently appointed and sworn in prior to today’s meeting, Mark Minnichelli was formally introduced to the Board as its newest addition to the Municipal Housing Trust Board. Mark is a member of the BEN organization with the Town of Franklin. Mark shares a passion for afford [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026

Franklin Commission on Disability

Franklin Commission on Disability discusses accessibility and goals

The Commission on Disability is meeting to review action steps for education and event goals. Members will discuss resource documents and a noncompliance notice from the Architectural Access Board.

disability-servicesaccessibilitypublic-compliancecommunity-events
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Meeting Agenda Date: January 8, 2026 Time: 4:00pm Location: Senior Center, 10 Daniel McCahill St, Franklin, MA 02038 *Please note: we strive for a fragrance-free environment, so please avoid the use of any scented products while in attendance Call to Order ● Approve previous meeting minutes ● Announcements from the Chair ○ Meeting organization ○ Metrowest Center for Independent Living Open House: 1/21, 1-4pm (One Clarks Hill, Suite 200, Framingham, MA 01702) ● Public Comments ● Old Business: ○ COD Goals: Events, Education ■ Action steps for top two goals ■ Training schedule ○ Discussion about Resource document ■ Check what links and phone numbers members have provided ○ Discussion about “Accessibility in Franklin” Document ■ Add more locations ○ Massachusetts office on Disability (MOD) training schedule ○ Senior Center Tree: reflect on experience ● New Business: ○ New Architectural Access Board noncompliance notice ○ Flyer & Photo ● Next Meeting: (Subject to Change) ○ Approve documents for adding to website ○ Plan for Strawberry Stroll: Equipment, Date, Hours, etc. Adjourn meeting
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Meeting Minutes Date: January 8, 2026 Location: Senior Center, 10 Daniel McCahill Street, Franklin MA Members Present: Alison Rheaume, Randy Jay, Lauren Sanford, Kelly Quinlan, Michael Furilla Members Absent: Gus Brown, Mary O’Neill, Cheryl Fisher Meeting Called to order by Alison Rheaume, Chairperson, at 4:06 pm ● Past Minutes: ○ A motion was made and carried to accept the minutes of the Dec 4, 2025 meeting. Approved ● Chair announcements : ○ Organization: Verbiage. “Propose - Motion - Seconded” ○ Metrowest Center for Independent Living Open house: 1/21, 1-4 pm (One Clarks Hill, Suite 200, Framingham, MA 01702) ● Public Comments: ○ None ● Old Business: 1. Goals Discussion: a. Action steps : i. Example : Strawberry Stroll : Actions 1. Discuss items for table Discuss items for table 2. Register table 3. Schedule/Coverage 4. Do we want to sell/Fundraise? 5. Discuss hiring interpreter 2. Training Schedule: a. Work on links to videos and live trainings 3. Discussion about “Resource Document”: a. Telephone and links completed and categorized at the top b. Add mission statements to each contact c. Add education, grants, clothing/furniture, “EBT cards to culture” to proper categories, DMV placard resource (https://www.mass.gov/disability-plates-and-placards) 4. Discussion about “Accessibility in Franklin” document: a. Add locations, events and begin to add details to each 5. Senior Center Tree: Positive experience by all. Would parti [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026

Zoning Board of Appeals

No Zoning Board of Appeals meeting on Jan 8; next meeting Jan 22

The Zoning Board of Appeals will not hold a meeting on January 8, 2026. The next scheduled meeting is on January 22, 2026. No agenda items are listed for the cancelled meeting.

zoning-boardmeetingcancellation
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
Town of Franklin 355 East Central Street Franklin, MA 02038 Zoning Board of Appeals 508-553-4856 THERE WILL BE NO ZONING BOARD OF APPEALS MEETING January 8 , 2026. THE NEXT ZONING BOARD OF APPEALS MEETING IS SCHEDULED FOR January 22, 2026
Wed Jan 7, 2026

Town Council

Council to consider Friendly 40B policy, zoning amendments, and facilities report

The Franklin Town Council will vote on a Friendly 40B Policy resolution, refer two zoning bylaw amendments to the Planning Board, and accept a $2,470 gift for Veterans Services. A presentation on Town and School facilities is also scheduled. The Council will appoint Mark Minnichelli to the Municipal Affordable Housing Trust.

planningzoningaffordable-housingfacilitiesveteransappointmentsmunicipal-housing-trust
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN TOWN COUNCIL Agenda & Meeting Packet January 7, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID #829 1107 4306 & Link: https://us02web.zoom.us/j/82911074306 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. 1. ANNOUNCEMENTS FROM THE CHAIR a. This meeting is being recorded by Franklin TV and shown on Comcast channel 9 and Verizon [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
1 FRANKLIN TOWN COUNCIL MINUTES OF MEETING January 7, 2026 A meeting of the Town Council was held on Wednesday, January 7, 2026, at the Municipal Building, 2nd Floor, Council Chambers, 355 East Central Street, Franklin, MA. Councilors present: Jane Callaway-Tripp, Ted Cormier-Leger, Robert Dellorco, Gene Grella, Caroline Griffith, Michael LeBlanc, Stephen Malloy, Max Morrongiello, Kenneth Ojukwu. Councilors absent: None. Administrative personnel in attendance: Jamie Hellen, Town Administrator; Mark Cerel, Town Attorney. CALL TO ORDER: ►Chair Dellorco called the meeting to order at 6:02 PM. He called for a moment of silence. All recited the Pledge of Allegiance. ANNOUNCEMENTS FROM THE CHAIR: ►Chair Dellorco reviewed the following as posted on the agenda. A Note to Residents: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using the number on the agenda. To participate in the meeting remotely citizens may join a Zoom Webinar using the information p [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 7, 2026

Board of Health

Public hearing and vote on restricting tobacco product sales

The Board of Health will hold a public hearing and vote on proposed amendments to the Restricting the Sale of Tobacco Products Regulations. They will also discuss a blood pressure program at the library and the rising number of flu cases. The meeting includes approval of December 3, 2025 minutes and reports from regional health agents. Citizens may comment on non-agenda items.

healthtobaccoflupublic-healthregulationslibrarygrants
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
FRANKLIN BOARD OF HEALTH Agenda & Meeting Packet January 7, 2026 5:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 3rd Floor, Training Room A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. meet.google.com/oqp-csmi-pmh tel:+1-413-398-2727 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. _______________________________________________________________________________ 1. ANNOUNCEMENTS FROM THE CHAIR a. Chair to identify members participating remotely. 2 . CITIZEN COMMENTS a. Citizens are welcome to express their views for up to three minutes on a matter that is not on the agenda. In compliance with G.L. Chapter 30A, Section 20 et seq, the Open Meeting Law, the Board of Health cannot engage in a dialogue or comment on a matter raised during Citizen Comments. The Board of Health may ask the Director of Public Health to review the matter. APPROVAL OF MINUTES a. December 3, 2025 NEW BUSINESS a. Discussion of Blood Pressure program at the library b. Rising number of flu cases discussion PUBLIC HEARING a. Voting on R [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
BOH MEETING MINUTES January 7, 2026 In attendance: Chair Kim Mu-Chow, Vice Chair, Jeff Harris, Cathleen Liberty, Director; Ginny McNeil, Health Agent; Alicia Sullivan; Public Health Nurse, Kerry MacKay Guests: Steve Sherlock, (Via Google Meet) CALL TO ORDER: ► Chair Mu-Chow called the meeting to order at 5:00 pm. CITIZENS COMMENTS: ► APPROVAL OF MINUTES: ►December 3, 2025 ►MOTION to Approve the December 3, 2025 meeting minutes Harris. SECOND by Mu-Chow. No discussion. ►ROLL CALL VOTE: Mu-Chow-YES; Harris-YES►VOTE: Yes-2, No-0-Abstain 0 NEW BUSINESS Discussion of Blood Pressure program at the library Public Health Nurse Alisha discussed the Blood Pressure program at the library and noted that not many people are checking out the blood pressure kits. She noted that she will be distributing the flyer that she made to senior centers and ask to have it in the Franklin Senior Center newsletter to get more people to utilize the kits. Rising number of flu cases discussion There was much discussion about the rising flu cases compared to last year the numbers are significantly higher. Another children's vaccine clinic was also discussed due to the high number of pediatric cases in Franklin. Voting on Restricting the Sale of Tobacco Products Regulations Amendments ►MOTION from Kim-Mu-Chow that the retail tobacco permit holders within 500 feet of a school will be grandfathered in for existing and new applicants and for a new application for a r [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026

Police Station Building Subcommittee

Police Station Building Committee to discuss site selection and master plan

The committee will review recent open houses and a presentation on site selection and the updated master plan site plan. Members will also discuss future meeting dates and potential tours of other police stations.

policepublic-buildingssite-selectionplanning
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
POLICE STATION BUILDING COMMITTEE Agenda & Meeting Packet January 6, 2026 6:00 PM Meeting will be held at the Franklin Municipal Building 355 East Central Street - 2nd Floor, Council Chambers A NOTE TO RESIDENTS: All citizens are welcome to attend public meetings in person. To view the live meeting remotely, citizens are encouraged to watch the live stream on the Franklin Town Hall TV YouTube channel or the live broadcast on Comcast Channel 9 and Verizon Channel 29. To listen to the meeting remotely citizens may call-in using this number: 1-929-205-6099. To participate in the meeting remotely citizens may join a Zoom Webinar using the information provided below. Meetings are recorded and archived by Franklin TV on the Franklin Town Hall TV YouTube channel and shown on repeat on Comcast Channel 9 and Verizon Channel 29. ZOOM WEBINAR DETAILS: ID # 814 5465 8685 & Link: https://us02web.zoom.us/j/81454658685 ➢ Any participants who wish to speak during the webinar must enter their full name and email address when joining the webinar. ➢ All participants will be automatically muted upon joining the webinar. In order to speak, participants will need to select the “Raise Hand” function to request to be unmuted. ➢ All speakers will be required to state their full name and street address before commenting. Agenda: 1. Approval of Minutes a. August 27, 2025 2. Discussion: Review of the Open Houses (Chief Lynch) 3. Disc [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026

Bi-County Collaborative

Board to vote on executive director search committee makeup

The Bi-County Collaborative Board of Directors will vote on the composition of the Executive Director Screening Committee and on board representation on the Executive Director Search Committee. A focus group discussion on attributes for the next executive director is also scheduled. No fiscal or policy items are on the agenda.

educationspecial-educationboard-of-directorshiringexecutive-search
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
BOARD OF DIRECTORS MEETING January 6, 2026 8:30-9:15 Zoom Agenda Join Zoom Meeting https://bicounty-org.zoom.us/j/82631798726?pwd=XsdteHY458bOL1fNy1eER2ApTS0PxG.1 Meeting ID: 826 3179 8726 Passcode: 814782 1. Approval of Makeup of Executive Director Screening Committee (Vote Required) Proposed Makeup of Committee: 2-4 BOD Members 2-4 Operating Committee Members (Special Ed Admin) 2-4 BICO Central Office 1 BICO Program Director 2-4 BICO Program Staff (Teacher, Para, Counselor, BCBA, RBT, etc…) 2. Approval of Board of Director Representation on Executive Director Search Committee (Vote Required) 3. Board of Director Focus Group: “Attributes of Next Executive Director” Adjourn
Mon Jan 5, 2026

Agricultural Commission

Commission to plan 2026 meeting with Town Administrator, review outreach materials

The Franklin Agricultural Commission will hold an online meeting to approve minutes from November 2025, discuss a 2026 meeting with the Town Administrator, and review information for owners of 5+ acres of land. The agenda also includes reviewing a draft PowerPoint presentation and a brochure for the commission. No votes on ordinances, contracts, or funding are scheduled.

agriculturecommission-meetingoutreachpublic-informationtown-administrator
📄 De la agenda
Texto extraído del documento oficial de la agenda (extracción automatizada — puede contener errores).
~Franklin Agricultural Commission Agenda~ 1/5/2026 7:00pm A NOTE TO RESIDENTS: All Agricultural Commission meetings are held online only via the Zoom platform, and all are open to the public. Citizens are able to participate in the Zoom meeting by clicking the link provided below or by dialing the phone number provided below. All of our meetings will be recorded. ZOOM MEETING DETAILS: Topic: Ag Com Time: Jan 5, 2026 02:00 PM Eastern Time (US and Canada) Join Zoom Meeting https://usO2web.zoom.us/j/88922384518 Meeting ID: 889 2238 4518 One tap mobile +13092053325,,88922384518# US +13126266799,,88922384518# US (Chicago) Participants will be automatically muted upon entry but can un-mute themselves by pressing*6 Participants joining by phone will be able to listen to the meeting and speak when |. Approval of the minutes from November 24, 2025 meeting ll. New Business: A. 2026 meeting with Town Administrator B. Info for Owners of 5+ Acres of Land in Franklin- Ill. Old Business: A. Review the Preliminary Power Point presentation for the Commission. Here is the start to the Franklin Ag Com Power Point Presentation deck: https://docs.google.com/presentation/d/1pbeWryVD10A2mkMtUWvdU2SRMWH3AXLcbQ41LgRLt LU/edit?usp=sharing B. Review Information for the Agricultural Commission Brochure- https://docs.google.com/document/d/1c2vOkWjLmYkpz9GObSt70r3iLTHSp8M2cZdBeJEH058/edit?usp= sharing and https://docs.google.com/document/d/1KKAFWbXZnmc3KuHpRuFzUrvAjCCmXicxX/edit? usp=shar [Excerpt truncated on this listing page; use the official record for the full text.]
📄 De las actas
Texto extraído del documento oficial de actas (extracción automatizada — puede contener errores).
Agricultural Committee Meeting December Minutes - January 5, 2026 In Attendance: Franklin Agricultural Commission: Marian Szymanski , Benjamin Rousseau, Matt Stolz, and Jen Andersen Sweeney. Call to Order: The Meeting was called to order at 7:05 PM by Marian Szymanski Acceptance of the Minutes: The Minutes from our November 2025 Meeting were unanimously accepted. New Business: A. 2026 Meeting With Town Administrator: We agree that we would like to discuss the following topics with Franklin Town Administrator, Jamie Hellen: 1. Possible Agricultural Commission use of Schmidt’s Farm land. 2. Making Franklin a, “Right-to-Farm” Town 3. Creating a Town Canning Center Marian will contact Jamie’s Office and set a date. B. Tax Info for Owners of 5+ Acres: The Commission agreed to explore the possibility of hosting an informational event for property owners of 5+ acres of land. The event would involve explanations and question and answers with members of the Franklin Agricultural Commission and the town of Franklin’s Assessors Office. The event would be held live and on Zoom to make the information available to all of the large property owners. Invitations to this event would be sent on postcards. Marian will coordinate with Town Assessors Office Old Business: A. Review the Preliminary Agricultural Commission Power Point Presentation: The preliminary power point presentation was viewed and discussed by members of the Commission. Minor alterations were sugge [Excerpt truncated on this listing page; use the official record for the full text.]