The Boring PartsFederalLocal · USLocal · Canada

Afton, Minnesota

Recent Afton City Council topics include planning & zoning, roads & infrastructure, development projects, resolutions & ordinances, contracts & procurement, budget & taxes.

Topics found in recent meetings

Recent Afton meeting summaries, agendas, and minutes

Get Afton meeting alerts

One email when Afton posts a new agenda or minutes. Free, unsubscribe anytime.

Development activity

Housing units permitted — US Census Building Permits Survey
20259 housing units ($10.4M)

Recent meetings

Tue Jul 21, 2026

City Council

City Council reviews June 2026 financial statements

The Afton City Council will review the June 2026 financial reports. The agenda includes the Balance Sheet, Statement of Changes in Fund Balances, and the Revenue and Expenditures report for the General Fund. No prominent transactions were noted for the month.

financebudgetaccountingfundsreporting
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
07-21-2026 City Council Regular Meeting Supplemental Packet City of Afton — Financial Reports /B June 2026 Ref Description Pages A. | Balance Sheet Al to A2 B. | Statement of Changes in Fund Balance: Year to Date Bi to B2 C. | Statement of Revenue and Expenditures: General Fund Summary plus Detail Cito C11 for All Other Funds D. | Detail Statement of Revenue and Expenditures: General Fund Only Dito D8 E. ; #550, 560 & 600 Summary of Special Activity & MN Investment Funds - YTD El F. | #550 Detail of General Special Activity Funds - YTD F1 to F2 G. | #560 Detail of Other Special Activity Funds - YTD G1 H. | #115 Building and Land Fund: YTD Detail H1 |. | #410 Sanitary Sewer Utility Oper Fund: LTD Summary & YTD Detail (Exp Only) | [1 to [3 J. | #120 Street Improvement Fund: YTD Detail J1 K. | #122 Bridge & Culvert Fund: YTD Detail Ki L. | #200 Park Reserve Fund — YTD Detail L1 M. | #725 2014A & #726 2017B Road Bond Debt Serv Funds: Five Year Summary Mi N. | #805 City Infra-Structure Imp Fund: LTD Summary & YTD Detail Ni to N2 O. | #806 PFA Loans: LTD Summary & YTD Detail O1 to 02 P. | #808 2020A Disposal System Bond Debt Serv Funds: LTD Summary Pi Q. | #809 2021A Condemnation Debt Svc Fund: LTD Summary & YTD Detail Qi to O2 R. | #810 City Dock Fund: YTD Detail by Account R1 S. | General Fund Streets, Rehab and Public Works: YTD Detail Si to $3 T. | Customer Receipts & Other Deposits — Current Month Tito T3 U. | Building Inspection Fees — YTD Ui to U4 Prepared by Lethert, S [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 21, 2026

City Council

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
07-21-2026 City Council Regular Meeting Second Supplemental Packet Meeting Date July 21, 2026 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: July 21, 2026 Re: Remus Park Vegetation Restoration Project City of Afton 3033 St. Croix Tri, P.O. Box 219 Afton, MN 55001 Several months ago, Elissa Thompson of the Washington Conservation District applied for a grant to enable a project at Remus Park to increase biodiversity, food, and forage for wildlife, and convert the monoculture of Brome grass to more diverse native vegetation. (Please see the attached project materials), The grant application was approved for funding. However, the grant includes a match from the city to fund the annual maintenance of the vegetation. This cost is between $3,400 and $5,500 per year. Staff is requesting direction from the Council regarding whether to move forward with the grant and project with the annual maintenance cost. COUNCIL ACTION REQUESTED: Motion regarding the grant for the vegetation restoration project at Remus Park. Ron Moorse From: Elissa Thompson « 7 Sent: Monday, July 20, 2026 12: 36 PM To: Ron Moorse Cc: Sven Risom Subject: FW: Afton Utility Project Attachments: Estimate_1024_from_The_Land_Stewards_LLC.pdf; Remus Park Estimate_LandbridgeEco2026.pdf; Remus Afton Bid Table_Edge 2026.pdf Ron, BWSR has approved the Remus Park project on their end. Is this something the city is still interested in pursuing [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 21, 2026

City Council

Council to consider Bed & Breakfast permit, zoning variances, and ordinance drafts

The Afton City Council will review a Conditional Use Permit for a Bed and Breakfast at 13885 44" Street South (Resolution 2026-34). It will also continue discussion of a variance and minor subdivision for 3403 Pennington Avenue South, and consider draft ordinance amendments on accessory building size and aircraft take‑offs/landings. Additional items include engineering updates, a final plat for Afton Farms/Longview Farms, a tree donation for Town Square Park, and renewal of a retirement compensation plan.

zoningplanningordinancesengineeringfinancepublic-input
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY COUNCIL AGENDA AFTON CITY COUNCIL CHAMBERS 3033 St. Croix Trail South TUESDAY, July 21, 2026 7:00 P.M. Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. The meeting can be viewed live using the following livestream link: https://vimeo.com/event/6026095 1. CALL TO ORDER 2. PLEDGE OF ALLEGIANCE 3. ROLL CALL Mayor Palmquist Council Member Nelson Council Member Ross Council Member Wroblewski Council Member Perkins 4. APPROVAL OF AGENDA A. Approval of the Agenda for the City Council Meeting of July 21, 2026 - 5. APPROVAL OF MINUTES A. Minutes of the June 16, 2026 City Council Meeting- 6. PUBLIC INPUT Citizens may share their comments or concerns on any issue that is a responsibility or function of the Afton City Council, whether or not the issue is on the Agenda. Persons who wish to address the Council must fill out a Comment Card before the meeting begins and give it to the City Administrator or Council Chair. The Council Chair will request you to come to the podium, state your full name and address and present your comments. You are encouraged to limit your presentation to no more than 3 minutes. The Council Chair reserves the right to limit an individual’s presentation if it becomes redundant, repetitive, overly argumentative, or if it is not relevant to an issue that is part of the City of Afton’s responsibilities. The Council Chair may also limit the number of individual presentations to accommodate the sch [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 13, 2026

Meeting

Afton committee discusses telecom expansion and funding

The Communications Task Force met to discuss Comcast's Mn BEAD funding and Afton's build-out plan, a Washington County monopine tower, and potential future fiber-to-the-home providers.

communicationstelecomfiberbead-fundingcellularinfrastructure
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
07-13-2026 Communications Task Force Committee Meeting Supplemental Packet Communications Committee Meeting Minutes Monday, June 29, 2026 1) Comcast a. Meghan Shea from Comcast met with the committee to discuss the Mn BEAD funding and Afton Build out plan b. Estimated completion date is 3 years from now. c. No exact build out map to date d. Yung will act as liaison to Comcast 2) Washington County monopine. a. Possible cellular additions to the tower. b. Existing height is incompatible with cellular build out. c. The county is not driving the concept of cellular build out. d. Verizon, ATT, and T-mobile were contacted by the county 3) Discussion on bringing in two fiber to the home providers for next meeting.
Mon Jul 13, 2026

Parks Committee

City considers forming a 501(c)(3) nonprofit to support parks

The Parks Committee will review a proposal to create a separate 501(c)(3) public charity that would solicit private donations for the city’s parks department. The memorandum outlines the legal structure, required IRS classifications, and potential concerns such as organizational independence, conflicts of interest, and compliance with disqualified‑person rules. The committee will consider whether to proceed with forming the supporting organization and how to address the identified issues.

parksnonprofittax-exemptgovernancedonations
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
07-13-2026 Parks Committee Meeting Supplemental Packet [= FELHABER LARSON ATTORNEYS AT LAW MEMORANDUM TO: Tom Radio FROM: Chad W. Breitenfeldt DATE: June 22, 2026 RE: ay Creation of a 501(c)(3) for Purposes of Maintaining and Expanding Parks General Overview The City is considering forming a 26 U.S.C. Section 501(c)(3) public charity to solicit and receive private donations for the benefit of the City's parks department. However, the City is concerned that the costs, significant steps, and ongoing regulations associated with forming a 501(c)(3) may not exceed the benefits of soliciting direct donations to the City instead. The City’s concerns are warranted as the costs, steps, and regulations associated with forming a 501 (c)(3) are substantial and laid out below. Thus, the City’s decision will likely rest on how substantial the rise in donations is forecasted to be if a 501(c)(3) is formed. Question Presented May the City form a separate 26 U.S.C. Section 501(c)(3) public charity to solicit and receive private donations for the benefit of the City's parks department, and if so, what are possible concerns the City should consider and have any other cities done this before? Short Answer Yes. The City can form a separate Section 501(c)(3) organization to facilitate donations for its parks department if the organization is organized and operated for charitable purposes and is structured to qualify as a public charity rather than a private foundation. The most appr [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 8, 2026

Meeting

Heritage Commission will receive updates on Township Hall project and grant applications

The Heritage Preservation/Design Review Commission will hear updates on the Township Hall Project, including its federal nomination, grant status, and clean‑out progress. The commission will also receive a status update on the MNHS Legacy Grant application and an update on the HPC Scavenger Hunt planned for Strawberry Fest.

heritage-preservationgrantstown-hallcommunity-eventshistoric-preservation
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
HERITAGE PRESERVATION/DESIGN REVIEW COMMISSION MEETING AGENDA Wednesday, July 8, 2026 6:00 P.M. 3033 St. Croix Trail Afton, MN 55001 AGENDA 1. CALL TO ORDER 2. ROLL CALL Chair Thomas Vice Chair Livingston Commissioner Vujovich Commissioner Vermeland Commissioner Huelster 3. APPROVAL OF AGENDA A. Approval of Agenda for July 8, 2026 meeting 4. APPROVAL OF MINUTES A. Minutes of the May 13, 2026 Meeting 5. BUSINESS A. Township Hall Project 1. Federal Nomination 2. Grants 3. Update Regarding the Clean-out of the Town Hall B. MNHS Legacy Grant Application Update C. HPC Scavenger Hunt at Strawberry Fest - Update A quorum of the City Council or Other Commissions may be present to receive information. AA Heritage Preservation Commission Wednesday, May 13, 2026, 6:00 P.M. MINUTES . CALL TO ORDER - 6:05 PM ROLL CALL Chair Thomas — Yes Vice Chair Livingston — Yes . Commissioner Vujovich - No . Commissioner Vermeland - Yes Commissioner Huelster — Yes moOp> . APPROVAL OF AGENDA A. Approval of the Agenda for the April 8, 2026 meeting - Huelster- 1st, Thomas ~ 2nd; passed . APPROVAL OF MINUTES A. Approval of the Minutes of the March 11, 2026 meeting - Livingston - 1st, Huelster - 2nd; BUSINESS A. Design Review for Rental House at 15965 32nd Street - paint color, doors, etc. i. The applicant and owner, Dave Jarvis, attended and explained the proposed work to be done to the house. ii. The proposed siding paint color is Sherwin Williams Porpoise (SW7047). The trim and rafter [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

Planning Commission

Planning Commission will consider a CUP for a bed‑and‑breakfast at 13885 44" St S.

The commission will hold public hearings on two Conditional Use Permit applications: one for a bed‑and‑breakfast at 13885 44" St S and another for an arts and crafts studio and retail business at 3343 St. Croix Trail South. It will also consider a variance and minor subdivision request to split the property at 3403 Pennington Avenue South into one additional lot. New business includes draft ordinance amendments to increase the maximum size of storage sheds to 300 sq ft and to address take‑offs and landings of aircraft in the city.

zoningdevelopmenthousingland-useordinances
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PLANNING COMMISSION AGENDA June 29, 2026 7:00 pm Afton City Council Chambers 3033 St. Croix Trail Afton, MN 55001 Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. The meeting can be viewed live using the following livestream link: https://vimeo.com/event/6001692 AGENDA CALL TO ORDER - PLEDGE OF ALLEGIANCE — OATH OF OFFICE — Lauren Froelich ROLL CALL - a) Sally Doherty b) Kris Kopitzke (Chair) c) Justin Sykora d) Christian Dawson e) Doug Parker f) Kuchen Hale g) Chris Bursack h) Kate McGinn i) Lauren Froelich 5. APPROVAL OF AGENDA — 6. APPROVAL OF MINUTES — A. June 1, 2026 Meeting Minutes 7. REPORTS AND PRESENTATIONS — none 8. PUBLIC HEARINGS -— A. Conditional Use Permit Application for a Bed and Breakfast at 13885 44" Street South B. Variance and Minor Subdivision Application to Subdivide the Property at 3403 Pennington Avenue South to Create One Additional Lot 9. NEW BUSINESS — A. Draft Ordinance Amendment Language Regarding Accessory Buildings B. Draft Ordinance Amendment Language Regarding Take-offs and Landings of Aircraft in Afton 10. OLD BUSINESS - A. Update on City Council Actions — Council Highlights from the June 16, 2026 Council meeting - attached. 11. ADJOURN — A quorum of the City Council or Other Commissions may be present to receive information. ep S 6A CiTy OF AFTON DRAFT PLANNING COMMISSION MINUTES June 1, 2026 The meeting was held in-person, participation via Zoom was not available. 1. CALL [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

Meeting

Task force will discuss Comcast representative's input on internet connectivity

The Internet Connectivity Task Force will hold its regular meeting, approve the agenda and minutes, recap the previous meeting, and hold a discussion with a Comcast representative about broadband service options. No formal decisions or votes are listed on the agenda.

internet-connectivitybroadbandtask-forcediscussiontelecom
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Internet Connectivity Task Force Committee Meeting Monday, June 29, 2026 2:00 P.M. 3033 St. Croix Trail Afton, MN 55001 AGENDA 1. CALL TO ORDER 2. ROLL CALL ______ Petra Brokken ______ Craig Engwall ______ Doug Hlavacek ______ Michael Smith ______ Jake Solberg ______ Yung Yip 3. APPROVAL OF AGENDA A. Approval of Agenda for June 29, 2026 meeting 4. APPROVAL OF MINUTES A. Minutes of the June 15, 2026 Meeting 5. BUSINESS A. Recap Past Meeting B. Comcast Representative Discussion
Tue Jun 16, 2026

City Council

City Council to consider deer hunting rifle regulations

The City Council is meeting to discuss potential changes to the use of rifles for deer hunting. A resident has submitted a request for the city to maintain current regulations for safety reasons.

huntingpublic-safetyregulations
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
06-16-2026 City Council Regular Meeting Second Supplemental Packet Jenny Moore From: Valerie Stoehr Sent: Tuesday, June 16, 2026 11:46 AM To: Jenny Moore Subject: Input for tonight's city council meeting Hello, This is Valerie Stoehr of ' | plan to be at tonight's city council meeting, but just in case I'm unable to be there | want to submit my comments this way as well. Here's my input in the format of the public comment request form: City of Afton Public Comment Request Form Please be aware that your comments will be part of the public record of the meeting. The Chair reserves the right to limit public comment should content become repetitive or argumentative. Individual presentations may be limited to accommodate the number of people who wish to speak. (Please print) Name: Valerie Stoehr Address: %. Request: (please check one) EXII wish to speak at the meeting. [_] I want to submit written comments only. (Please continue comments on back of paper if needed.) Thank you for the city's attention to the issue of potential changes to using rifles for deer hunting. Especially for safety reasons, I encourage the city to keep the regulations for hunting as they are now rather than allow rifles. I live in the Old Village, and I need to take care when I take walks in the fall because hunting grounds are right next to the boundaries of the Old Village.
Mon Jun 15, 2026

City Council

Afton’s fire levy share rises $57,813 in 2027 budget proposal

The City Council will hear Fire Chief Rob Corey and District Accountant Nicole Runge present the proposed 2027 Lower St. Croix Valley Fire District budget. The proposal calls for a $130,000 (14.54%) increase in the overall fire district levy and a $57,813 (15.46%) increase in Afton’s share. Council members will discuss the budget items and consider ways to reduce the projected increase. Fire Board members will attend, with Kevin Johnson joining remotely.

budgetfirelevytaxespublic-safetyfinancecouncil
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Fe NM me CITY COUNCIL WORK SESSION AGENDA June 15, 2026 4:30 PM. CALL TO ORDER ROLL CALL APPROVAL OF AGENDA -— June 15, 2026 Council Work Session CITY COUNCIL BUSINESS A. 2027 Proposed Fire Department Budget ADJOURN 4A City of Afton 3033 St. Croix Tri, P.O. Box 219 Meeting Date June 15, 2026 Afton, MN 55001 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: June 11, 2026 Re: 2027 Proposed Fire Department Budget The purpose of the discussion regarding the Fire District budget is to enable Fire Chief Rob Corey to explain the key items affecting the budget, to obtain feedback from Afton’s Fire Board members regarding the budget and to enable the Council to ask questions to clarify the key items affecting the budget and any opportunities to reduce the proposed budget increase. Afton’s Fire Board members will attend the work session; Kevin Johnson will attend remotely. Budget and Levy Overview The proposed Lower St. Croix Valley Fire District Budget is attached, along with a one-page budget outline from Fire Chief Rob Corey and Fire District Accountant Nicole Runge listing the items most impacting the budget. The proposed budget reflects an increase in operating expenses of $129,697, or 16.4% . This requires a $130,000 or 14.54% increase in the amount of funding needed from the five cities. The cost allocation formula results in an increase of $57,813 or 15.46% in the funding needed from Afton. Memo May 13, 20 [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 10, 2026

Meeting

Public Works Committee to discuss trail erosion and bridge issues

The Public Works Committee is meeting to discuss speed limits and infrastructure concerns. The body will review trail erosion, pavement cracking, and the Putnam Bridge.

roadstrailsinfrastructurepublic-works
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Public Works Committee Meeting Wednesday, June 10, 2026 1:30 PM 3033 St. Croix Trail Afton, MN 55001 Agenda - Revised 1. Call to Order 2. Committee Business A. Speed Limits on Valley Creek Trail, 42nd Street and Oakridge Trail South B. Valley Creek Trail Shoulder Erosion and Warranty Items C. Afton Creek Preserve Cracking at North End Approaching Odell D. Putnam Bridge 3. Adjournment
Mon Jun 8, 2026

Parks Committee

Committee to review Herreid Park draft and discuss park funding

The Afton Parks Committee will review the draft plan for Herreid Park that was postponed from the May meeting. It will also hear the current Park Dedication Fund balance of $391,901 and consider a donation request. Additional items include a continued discussion of the park donation policy, the 2026‑2027 priority parks focus, and a proposal for a modest neighborhood park on the Aftonwood parcel.

parksfinanceplanningcommunitydonationsdevelopment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
— sae a City of Afton Parks Committee Meeting Monday, June 8, 2026 6:00 PM | an Due to technical issues, remote participation via Zoom will not be available for this meeting. 1. Call to Order 2. Roll Call - 3. Approval of Agenda 4. Approval of Minutes A. Minutes of the May 11, 2026 Parks Committee Meeting 5. Business Park Dedication Fund Balance Donation Request Review Herreid Park Draft — Elissa Thompson (Moved from May Meeting) Park Donation Policy Continued - Angela Priority Parks Focus 2026/2027 — Trees Cut Down/Replant, Trails, Native Planting, etc. e Herreid Park Steamboat/Carver Park Town Square Park Remus Park Meadow Ridge e Levee Plantings F. Park Request from Aftonwood Neighborhood 6. Adjournment BoOw> City of Afton Parks Committee Meeting Minutes Monday, May 11, 2026 6:00 PM Attendees: Lori Swanson, Grant Jenson, Bob Dickie, Angela Tangen, Julie Stenberg Zeidel Council Member Annie Perkins, Public Works Ken Johnson Call to Order The meeting was called to order at 6:00 by Lori Swanson Approval of Minutes from April 13, 2026 meeting Approved by Angela, seconded by Julie Business A. Park Dedication Fund Balance $391,593 B. Review Herreid Park Draft — Elissa Thompson (moved to June meeting) C. Naming Ideas for Herreid Park — Wild Meadow Park D. NEW Park Donation Fund Policy - A new concept was presented by Angela, the proposed idea has merit but need additional discussion June meeting). The committee agreed to continue with current Park Donation Pol [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 2, 2026

City Council

NRGC discusses Kelle’s Creek bank stabilization and floodplain restoration

The Natural Resources and Groundwater Committee will review updates on several ongoing projects, including the Kelle’s Creek bank stabilization and floodplain forest restoration in Steamboat and Carver Parks, the 2025 Resilient Communities Project, and land rehabilitation west of City Hall. The committee will also receive reports on regional trail plans, well‑testing for nitrates and coliform bacteria, and upcoming natural‑resources outreach activities. No formal approvals are scheduled; the meeting is for information sharing and planning.

natural-resourcesgroundwaterparkstrailswater-qualityland-rehabilitation
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
—— a ae City of Afton Natural Resources and Groundwater Committee (NRGC) Meeting Tuesday, June 2, 2026 5:00 PM Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. Agenda 1. Call to order 2. Roll call: David Husebye, Susan Loomis, Kim Myhers, Elissa Thompson, Petra Brokken, Scott Hafner and Sven Risom 3. Approval of Agenda for June 1, 2026 meeting and additional agenda items proposed by members. 4. Approval of Minutes of the May 5, 2026 meeting. 5. Old Business i) Kelle’s Creek Bank Stabilization and Floodplain Forest Restoration in Steamboat and Carver Parks — Kim and Elissa ii) 2025 Resilient Communities Project — Sven iii) Land Rehabilitation Project on City Property West of City Hall and City Entryway - Elissa iv) Regional Trails — Sven 1) Battle Creek to St. Croix River 2) Stillwater to Afton v) Well Testing for Nitrates and Coliform Bacteria in 2026 - Dave vi) Natural resources awareness program 1) Newsletter/Afton Naturalist - Sven a) Organizations b) Invasive species topics vii) NRGC items for Afton’s monthly newsletter 1) Prescribed burns - 2) Mosquito PSA - Petra 3) Bird House 4) Replanting After Invasives Removal 5) Plantings List for May 2026 Plantings in Steamboat Park and West of City Hall viii) | NRGC Management Organization update 1) Washington Conservation District — Elissa 2) South Washington County Watershed District — Kim 3) Middle St. Croix Water Management Organization — Susan [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 1, 2026

Meeting

Planning Commission approved Use Permit for arts & crafts studio at 3343 St. Croix

The commission held a public hearing and voted to recommend approval of a Conditional Use Permit for an arts & crafts studio and retail business at 3343 St. Croix Trail South. The commission also reviewed a draft ordinance amendment to increase the maximum size of storage sheds from 160 to 300 square feet and remove the door‑size cap, and agreed to forward the draft to the Planning Commission for feedback. Staff presented a draft amendment concerning aircraft take‑offs and landings, noting concerns and a recommendation to prohibit them, but no action was taken.

zoningplanningpermitsordinanceaviation
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AFTON 1 APPROVED PLANNING COMMISSION MINUTES June 1, 2026 2 3 The meeting was held in-person, participation via Zoom was not available. 4 5 1. CALL TO ORDER – Chair Kris Kopitzke called the meeting to order at 7:00 pm. 6 7 2. PLEDGE OF ALLEGIANCE 8 9 3. OATH OF OFFICE -Lauren Froelich 10 11 4. ROLL CALL – Present: Doug Parker, Justin Sykora, Kris Kopitzke, Kate McGinn, Kuchen Hale, Christian 12 Dawson. Absent was Chris Bursack and Sally Doherty. A quorum was present. 13 ALSO IN ATTENDANCE – City Administrator Ron Moorse, Council Member Stan Ross, City Planner 14 Emily Herald. 15 16 5. APPROVAL OF AGENDA – 17 Motion/Second Bursack/Parker to approve the agenda for the June 1, 2026 Planning Commission 18 meeting. Passed 6-0. 19 20 6. APPROVAL OF MINUTES – 21 Motion/Second Parker/Sykora to approve the minutes of the May 4, 2026 Planning Commission 22 meeting. Passed 4-0-2 (Froelich, Bursack abstain) 23 24 7. REPORTS AND PRESENTATIONS 25 None 26 27 8. PUBLIC HEARINGS 28 A. Conditional Use Permit Application to Allow the Former Barber Shop Building at 3343 St. Croix 29 Trail South to be Used as an Arts and Crafts Studio and Retail Business 30 Chair Kopitzke opened the public hearing at 7:05 PM. 31 Emily Herold, City Planner, provided a summary of the application: The applicant intends to pour, package, 32 cure, store and sell handcrafted candles that are handmade by the business owner. The applicant is also 33 requesting periodic re [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 1, 2026

Planning Commission

Planning Commission hears Conditional Use for arts studio at 3343 St. Croix Trail

The Afton Planning Commission will hold a public hearing on a Conditional Use Permit to convert the former Barber Shop at 3343 St. Croix Trail into an arts and crafts studio and retail business. The commission will also consider draft ordinance amendment language on accessory building size limits for lots under 5 acres and draft amendment language on aircraft take‑offs and landings in Afton. An update on City Council actions from the May 19, 2026 meeting will be presented.

zoningplanningdevelopmentordinancepublic-hearingland-use
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of Afton PLANNING COMMISSION AGENDA June 1, 2026 7:00 pm Afton City Council Chambers 3033 St. Croix Trail Afton, MN 55001 Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. The meeting can be viewed live using the following livestream link: https://vimeo.com/event/5942468 AGENDA CALL TO ORDER - PLEDGE OF ALLEGIANCE — OATH OF OFFICE — Lauren Froelich ROLL CALL - a) Sally Doherty b) Kris Kopitzke (Chair) c) Justin Sykora d) Christian Dawson e) Doug Parker f) Kuchen Hale g) Chris Bursack h) Kate McGinn i) Lauren Froelich 5. APPROVAL OF AGENDA — 6. APPROVAL OF MINUTES — A. May 4, 2026 Meeting Minutes 7. REPORTS AND PRESENTATIONS — none 8. PUBLIC HEARINGS -— A. Conditional Use Permit Application to Allow the Former Barber Shop Building at 3343 St. Croix Trail South to be Used as an Arts and Crafts Studio and Retail Business 9. NEW BUSINESS — A. Draft Ordinance Amendment Language Regarding Accessory Buildings B. Draft Ordinance Amendment Language Regarding Take-offs and Landings of Aircraft in Afton 10. OLD BUSINESS - A. Update on City Council Actions — Council Highlights from the May 19, 2026 Council meeting - attached. 11. ADJOURN — A quorum of the City Council or Other Commissions may be present to receive information. Pye INO a SCOMNODNRWNHADOANDOAW Na NNNNNNND NOORWN=s i) © WWWWN ON AOO WOWWWWW OANDOaR ankRARARAAAAL -=OCOANDaARWN=AO 6A CITY OF AFTON DRAFT PLANNING COMMISSION MINUTES May 4, 2026 The m [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026

City Council

Afton City Council to discuss rezoning, contracts, and public safety

The Afton City Council will meet to approve routine claims and transfers, discuss a proposed rezoning for a 94-acre property, and consider a contract extension for waste services. The meeting will also include reports on public safety and infrastructure.

city-councilrezonecontractpublic-safetyroadswasteplanning
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1. 2 City of Aft om CITY COUNCIL AGENDA AFTON CITY COUNCIL CHAMBERS 3033 St. Croix Trail South TUESDAY, May 19, 2026 7:00 P.M. Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. The meeting can be viewed live using the following livestream link: https://vimeo.com/event/5911109 CALL TO ORDER - PLEDGE OF ALLEGIANCE 3. ROLL CALL Mayor Palmquist Council Member Nelson Council Member Ross Council Member Wroblewski Council Member Perkins 4. APPROVAL OF AGENDA A. Approval of the Agenda for the City Council Meeting of May 19, 2026 - 5. APPROVAL OF MINUTES A. Minutes of the April 21, 2026 City Council Meeting- B. Minutes of the April 27, 2026 City Council Work Session Meeting- C. Minutes of the May 11, 2026 City Council Work Session Meeting- 6. PUBLIC INPUT Citizens may share their comments or concerns on any issue that is a responsibility or function of the Afton City Council, whether or not the issue is on the Agenda. Persons who wish to address the Council must fill out a Comment Card before the meeting begins and give it to the City Administrator or Council Chair. The Council Chair will request you to come to the podium, state your full name and address and present your comments. You are encouraged to limit your presentation to no more than 3 minutes. The Council Chair reserves the right to limit an individual’s presentation if it becomes redundant, repetitive, overly argumentative, or if it is not relevant to [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026

Meeting

Council approved a plat and conditional use for 4 lots on 94 acres at 10th St.

The Afton City Council adopted Resolution 2026-28 to approve a preliminary plat for four lots on a 94‑acre parcel at the east end of 10th Street, and Resolution 2026-29 to approve a conditional use permit for shared driveways on the same parcel. The council also approved a draft amendment increasing allowed shed size to 300 sq ft. It awarded the 2026 micro surface road project to Fahrner for $249,000 and extended the solid‑waste contract with Highland Sanitation for one year, now ending June 30, 2027. Finally, the council revised the Minnesota Paid Leave Policy premium contributions to .44% for employees and .22% for the city.

zoningdevelopmentroadscontractspaid-leaveplanning
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Regular Meeting Minutes 5 6 May 19, 2026 7 Afton City Hall 8 3033 St. Croix Trail 9 Afton, MN 55001 10 7:00 P.M. 11 12 1. THE MEETING WAS CALLED TO ORDER by Mayor Palmquist at 7:00 pm 13 14 2. THE PLEDGE OF ALLEGIANCE – was recited. 15 16 3. ROLL CALL: Council Members Randy Nelson, Stan Ross, Lucia Wroblewski, Annie Perkins & Mayor 17 Palmquist. A quorum was present. 18 ALSO PRESENT: City Administrator Ron Moorse, Planning Commission Chair Kris Kopitzke, City 19 Planner Emily Herold, City Engineer Tyler Hastings, City Attorney Tom Radio. 20 21 4. APPROV AL OF AGENDA – 22 Add items 9b5 “security at garage on stagecoach” and 9c8 “screening at solar farm” 23 Motion/Second Ross/Palmquist to approve the agenda for the May 19, 2026 Regular City Council 24 meeting with addition of items above. Passed 5-0. 25 26 5. APPROV AL OF MINUTES 27 A. Minutes of the April 21, 2026 City Council Meeting- 28 B. Minutes of the April 27, 2026 City Council Work Session Meeting 29 C. Minutes of the May 11, 2026 City Council Work Session Meeting 30 Motion/Second Palmquist/Ross to approve the minutes of the April 21, April 27 and May 11 City 31 Council Meeting and Work Sessions. Passed 5-0. 32 33 6. PUBLIC INPUT – 34 Jeff Walker, Indian Tr, asked a question about the proposed plat showing area of houses and area of 35 conservation. Who is holder of co [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 13, 2026

Meeting

Heritage Preservation Commission to review design requests for two properties

The Heritage Preservation/Design Review Commission will consider exterior modifications for a rental house and a wellness building. The body will also discuss historical markers, the Township Hall project, and a historic farmhouse on 45th Street parkland.

historic-preservationdesign-reviewzoninggrantsparkland
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of Afton. eee HERITAGE PRESERVATION/DESIGN REVIEW COMMISSION MEETING AGENDA Wednesday, May 13, 2026 6:00 P.M. 3033 St. Croix Trail Afton, MN 55001 AGENDA ™ CALL TO ORDER 2. ROLL CALL Chair Thomas Vice Chair Livingston Commissioner Vujovich Commissioner Vermeland Commissioner Huelster 3. APPROVAL OF AGENDA A. Approval of Agenda for May 13, 2026 meeting 4. APPROVAL OF MINUTES A. Minutes of the April 8, 2026 Meeting 5. BUSINESS A. Design Review for Rental House at 15965 32™ Street - paint color, doors, etc. B. Design Review for 3185 St. Croix Trail Life Wellness Building 4-Season Porch C. House Historical Markers 1. Putnam House/Red House 2. Asa Tracy House (Kathy’s) D. Township Hall Project 1. Federal Nomination 2. Grants E. Village Online Walking Tour — Phase 2 F. Valley Creek Driving Tour — Grant Application G. Historic Farmhouse on 45" Street Parkland A quorum of the City Council or Other Commissions may be present to receive information. City of Afton 3033 St. Croix Trl, P.O. Box 219 Afton, MN 55001 Meeting Date May 13, 2026 Heritage Preservation Commission Memo To: Design Review/Heritage Preservation Commission Members From: Ron Moorse, City Administrator Date: May 7, 2026 Re: Design Review for Rental House Improvements at 15965 32" Street Attached are materials for the design review regarding the exterior paint color and replacement of doors for the small rental house at 15965 32"4 Street, SA CITY OF AFTON DESIGN REVIEW APPLICATION Owner Address [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026

City Council

Council will review the University of Minnesota draft report on neighborhood trails

The council will examine the University of Minnesota Capstone Team draft report on the neighborhood trails planning process, focusing on pages 1‑5 and the executive summary. Discussion will cover the draft vision, public‑engagement recommendations, and a suitability analysis tool. Staff may also begin a conversation about next steps, such as continuing the Greenway Corridors Working Group or forming a standing committee. The City Administrator will provide general project updates.

trailsplanningparks-recreationcommunity-engagementcity-council
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
a oN Bb City Of. “Afton CITY COUNCIL WORK SESSION AGENDA May 11, 2026 4:30 PM CALL TO ORDER ROLL CALL APPROVAL OF AGENDA — May 11, 2026 Council Work Session CITY COUNCIL BUSINESS A. Neighborhood Trails Planning Process - University of Minnesota Capstone Team Draft Report B. City Administrator Updates ADJOURN 4A City of Afton 3033 St. Croix Trl, P.O. Box 219 Meeting Date May 1 1, 2026 Afton, VIN 55001 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: May 7, 2026 Re: Neighborhood Trails Planning Process - University of Minnesota Capstone Team Draft Report The University of Minnesota Capstone Team will present their final report to the Council regarding a neighborhood trails planning process. Here is a link to the report on the city’s website: https://aftonmn.gov/vertical/sites/%7B255148F5-88B9-45F6-9726- DD95D24AA11D%7D/uploads/Capstone Team Draft Report Spring 2026.pdf Staff recommends that the Council focus on reviewing pages 1-5, which include a broad overview of key elements, and the Executive Summary. The presentation will highlight a draft Vision for the project, recommendations from the Public Engagement Plan and the Suitability Analysis, a tool designed to help the City determine the suitability of areas for potential trails. There will also be time for Council feedback and discussion. In addition, if time permits, staff would like to initiate a discussion regarding next steps, including how the ne [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026

Parks Committee

Committee will review Herreid Park draft and consider naming ideas

The Afton Parks Committee will discuss the current balance of the Park Dedication Fund, which is $391,593. It will review the draft plan for Herreid Park presented by Elissa Thompson and hear naming suggestions for the new park. The committee will also consider the Park Donation Policy related to a donation from Mark and Barbara Russo for Dave Clymer.

parksfinancenamingdonationpolicy
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Parks Committee Meeting Monday, May 11, 2026 6:00 PM Due to technical issues, remote participation via Zoom will not be available for this meeting. 1. Call to Order 2. Roll Call - 3. Approval of Agenda > Approval of Minutes A. Minutes of the April 13, 2026 Parks Committee meeting 5. Business A. Park Dedication Fund Balance B. Review Herreid Park Draft — Elissa Thompson C. Naming Ideas for Herreid Park D. Park Donation Policy 6. Adjournment 4A Parks Committee Meeting Minutes Monday, April 13, 2026 6:00 PM Call to Order ~ 6:03 pm Roll Call - Todd Housker, Grant Jensen, Julie Stenberg Zeidel, Lori Swanson, Bob Dickie Afton Staff: Ken Johnson, City Council: Annie Perkins. Approval of Agenda - Approved by Grant and Bob Approval of Minutes A. Minutes of the March 2026 Parks Committee meeting approved by Grant, seconded by Todd Business A. Park Dedication Fund Balance $390,396 B, Reviewed Sketch Plan. (with Claire Stickler, City and Developer) for a 4-Lot Subdivision of a 94.4 Acre Property at the East End of 10th Street - Committee all agreed the plan was well thought out for each parcel/open space. C, Park Bench Donation Policy. Park Donation from Mark & Barbara Russo for Dave Clymer — Move to May meeting/Angela to provide. D. Naming Ideas for Herreid Property. Susan Herreid joined the committee with ideas for possible names for the new park on 45" street. Susan focused was on celebrating the heritage of who lived on the land; Scandinavian, Norwegian and Native Ame [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026

Meeting

University of Minnesota team presents draft neighborhood trails report

The Afton City Council approved the work‑session minutes from the previous meeting. Council members heard a draft final report from the University of Minnesota Capstone Team on a neighborhood trails planning process. No other updates or actions were taken before the council adjourned.

city-councilminutesplanningtrailsuniversity
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Work Session Minutes 5 May 11, 2026 6 Afton City Hall 7 3033 St. Croix Trail 8 Afton, MN 55001 9 10 4:30 P.M. 11 1. THE MEETING WAS CALLED TO ORDER at 4:30 p.m. by Mayor Palmquist. 12 13 2. ROLL CALL: Mayor Palmquist and Council Members Nelson, Ross, Wroblewski and Perkins. A Quorum 14 was present. Also present was City Administrator Ron Moorse. 15 16 3. Motion/Second: Ross/Wroblewski. To approve the agenda for the May 11 , 2026 City Council Work 17 Session. Roll Call, All Ayes, passed 5-0-0. 18 19 4. CITY COUNCIL BUSINESS 20 21 A. Neighborhood Trails Planning Process – University of Minnesota Capstone Team Draft Report 22 The University of Minnesota Capstone Team presented their draft final report regarding a neighborhood trails 23 planning process. 24 B. City Administrator Updates 25 There were no City Administrator updates. 26 27 5. ADJOURN 28 Motion/Second: Nelson/Ross. To adjourn at 5:56 p.m. Roll call: All ayes, passed 5-0-0. 29 30 Respectfully submitted by: 31 32 33 Ronald J. Moorse, City Administrator 34 35 36 Approved by Council on May 19, 2026 (check one): Presented: _______________ Amended: _______________ 37 38 Mayor Bill Palmquist Date: _________________ 39
Tue May 5, 2026

City Council

NRGC will set up 2026 well testing for nitrates and coliform bacteria

The Natural Resources and Groundwater Committee will discuss updates on several ongoing projects, including bank stabilization, floodplain restoration, and regional trail plans. Members will review the schedule and logistics for 2026 well testing for nitrates and coliform bacteria, with kits to be distributed in May and sample collection on June 9 and 16. Additional items include land‑rehabilitation planting dates and content for the monthly newsletter.

natural-resourceswater-qualityfloodplaintrailsland-rehab
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
ee City of Afton Natural Resources and Groundwater Committee (NRGC) Meeting Tuesday, May 5, 2026 5:00 PM Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. Agenda 1. Call to order 2. Roll call: David Husebye, Susan Loomis, Kim Myhers, Elissa Thompson, Petra Brokken, Scott Hafner and Sven Risom 3. Approval of Agenda for May 5, 2026 meeting and additional agenda items proposed by members. 4. Approval of Minutes of the April 7, 2026 meeting. 5. Old Business i) Kelle’s Creek Bank Stabilization and Floodplain Forest Restoration in Steamboat and Carver Parks — Kim and Elissa ii) 2025 Resilient Communities Project — Sven iii) Land Rehabilitation Project on City Property West of City Hall and City Entryway - Elissa iv) Regional Trails —- Sven 1) Battle Creek to St. Croix River 2) Stillwater to Afton v) Well Testing for Nitrates and Coliform Bacteria in 2026 - Dave vi) Natural resources awareness program 1) Newsletter/Afton Naturalist - Sven a) Organizations b) Invasive species topics vii) NRGC items for Afton’s monthly newsletter 1) Buckthorn removal and post removal re-vegetation — above 2) Prescribed burns - Scott 3) Mosquito PSA — Petra 4) Bird House 5) Replanting After Invasives Removal viii) NRGC Management Organization update 1) Washington Conservation District — Elissa 2) South Washington County Watershed District - Kim 3) Middle St. Croix Water Management Organization — Susan 4) Valley Branch Water [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 4, 2026

Planning Commission

Planning Commission reviews 4‑lot subdivision of 94.4‑acre site on 10" St

The commission held public hearings on a variance request for an accessory building at 5698 Oakridge Court South and on a preliminary plat for a four‑lot subdivision of a 94.4‑acre property at the east end of 10" Street. It recommended denial of the Oakridge variance and recommended approval of the subdivision plat with conditions. New business included discussion of accessory‑building size rules for parcels under 5 acres and the City Council chambers audio/visual system. The commission also reviewed its policy for handling new substantive information submitted at meetings.

zoningsubdivisionvarianceland-useplanning-commissiondevelopment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of Afton PLANNING COMMISSION AGENDA May 4, 2026 7:00 pm Afton City Council Chambers 3033 St. Croix Trail Afton, MN 55001 Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. La 1 The meeting can be viewed live using the following livestream link: https://vimeo.com/event/5885755 AGENDA CALL TO ORDER - PLEDGE OF ALLEGIANCE — ROLL CALL - a) Sally Doherty b) Kris Kopitzke (Chair) c) Justin Sykora d) Christian Dawson e) Doug Parker f) Kuchen Hale g) Chris Bursack h) Kate McGinn APPROVAL OF AGENDA — APPROVAL OF MINUTES — A. April 6, 2026 Meeting Minutes REPORTS AND PRESENTATIONS — none PUBLIC HEARINGS — A. Preliminary Plat for a 4-lot Subdivision of a 94.4 Acre Property at the East End of 10" Street, with PID#s 05.028.20.44.0004, 05.028.20.43.0001, 08.028.20.11.0001 and 08.028.20.12.0002, and a Conditional Use Permit for Shared Driveways NEW BUSINESS — A. Accessory Building Sizes On Lots Less Than 5 Acres B. Council Chambers Audio/Visual System and Use of Microphones . OLD BUSINESS - A. Planning Commission Response When New, Substantive Information is Provided by an Applicant at a Planning Commission Meeting. B. Update on City Council Actions — Council Highlights from the April 21, 2026 Council meeting - attached. 0. ADJOURN — A quorum of the City Council or Other Commissions may be present to receive information. Fa a Ca a ea CO Ca CE CE OAONDNABRWNADOOANADOARW NY = NMNNNNNNNN NOORWN AO 2 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 4, 2026

Meeting

Planning Commission recommended approval of 4‑lot subdivision plat on 10th St S

The commission held a public hearing on a preliminary plat for a 94.4‑acre property at the east end of 10th Street, proposing four lots with shared private driveways. After discussion, the commission voted to recommend approval of the plat with conditions, including removal of public walking trail easements. The commission also considered options for accessory building size flexibility on lots under 5 acres and reviewed audio/visual upgrades for council chambers. No other reports or presentations were made.

zoningdevelopmentsubdivisionaccessory-buildingsaudio-visualplanning-commission
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AFTON 1 APPROVED PLANNING COMMISSION MINUTES May 4, 2026 2 3 The meeting was held in-person, participation via Zoom was not available. 4 5 1. CALL TO ORDER – Chair Kris Kopitzke called the meeting to order at 7:00 pm. 6 7 2. PLEDGE OF ALLEGIANCE 8 9 3. ROLL CALL – Present: Doug Parker, Justin Sykora, Kris Kopitzke, Kate McGinn, Kuchen Hale, Christian 10 Dawson. Absent was Chris Bursack and Sally Doherty. A quorum was present. 11 ALSO IN ATTENDANCE – City Administrator Ron Moorse, Council Member Stan Ross, City Planner 12 Emily Herald. 13 14 4. APPROVAL OF AGENDA – 15 Motion/Second Hale/McGinn to approve the agenda for the May 4, 2026 Planning Commission 16 meeting. Passed 6-0. 17 18 5. APPROVAL OF MINUTES – 19 Motion/Second Kopitzke/Parker to approve the minutes of the April 6, 2026 Planning Commission 20 meeting. Passed 6-0. 21 22 6. REPORTS AND PRESENTATIONS 23 None 24 25 7. PUBLIC HEARINGS 26 A. Preliminary Plat for a 4-lot Subdivision of a 94.4 Acre Property at the East End of 10th Street, with 27 PID#s 05.028.20.44.0004, 05.028.20.43.0001, 08.028.20.11.0001 and 08.028.20.12.0002, and a 28 Conditional Use Permit for Shared Driveways 29 Chair Kopitzke opened the public hearing at 7:03 PM. 30 Emily Herold, City Planner, provided a summary of the application: The subject area consists of four 31 parcels in north-central Afton all zoned Agricultural and totaling 94.4 acres in size. All four lots are 32 currently used as agricult [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026

City Council

Council to address deer hunting firearm rules and solid waste contract

The Afton City Council work session will discuss how to respond to the 2025 state law allowing rifles for deer hunting, including possible city ordinances and the formation of a deer‑management working group. Council members will also review the commercial solid waste and recycling contract with Highland Sanitation, which expires in June 2026, and consider extending it while planning an RFP. Additional topics include changes to the MN Paid Leave employee premium, adding bereavement leave, and how to regulate ultralight aircraft in the city.

deer-huntingfirearmssolid-wastepaid-leavebereavement-leaveultralights
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
a CITY COUNCIL WORK SESSION AGENDA April 27, 2026 4:30 PM CALL TO ORDER ROLL CALL APPROVAL OF AGENDA - April 27, 2026 Council Work Session CITY COUNCIL BUSINESS A. Deer Hunting Regulations/Deer Population Management B. Commercial Solid Waste Service Pricing and Request For Proposals TOMO City Logo Change in Employer Cost vs Employee Cost for MN Paid Leave Premiums Add Bereavement Leave as an Employee Benefit Regulation of Ultralights Adopt-a-Drain Program Annual St. Croix River Workshop on the Water ADJ OURN AA City of Afton 3033 St. Croix Tri, P.O. Box 219 Meeting Date April 27, 2026 Afton, MN 55001 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: April 23, 2026 Re: Deer Hunting and Firearms Regulations/Deer Population Management Deer Hunting and Firearms Regulation The state legislation passed in 2025 to allow rifles for deer hunting in the metro area and authorizing only the County Boards to prohibit rifles is causing safety concerns and raising questions about the ability of cities to adopt firearms ordinances to mitigate the safety concerns. The City Attorney will participate in the April 27 work session to address questions regarding the regulation of rifles and other firearms. Ifa Council member has specific questions for the City Attorney, please provide those questions to staff in advance of the work session so that the City Attorney can prepare to address those questions. Establish [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026

Meeting

City Council voted to ban ultralight aircraft takeoffs and landings in Afton

The Afton City Council discussed a range of items, including forming a deer‑hunting task force, seeking competitive bids for commercial solid waste services, and revising employee payroll contributions for the state paid‑leave program. It also approved additional bereavement leave, a city logo rendering, and funding for a St. Croix River workshop, while adopting an adopt‑a‑drain program and amending the ordinance to prohibit ultralight aircraft operations.

wildlifewaste-managementpayrolllaboraviationcommunitytraining
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Work Session Minutes 5 April 27, 2026 6 Afton City Hall 7 3033 St. Croix Trail 8 Afton, MN 55001 9 10 4:30 P.M. 11 1. THE MEETING WAS CALLED TO ORDER at 4:30 p.m. by Mayor Palmquist. 12 13 2. ROLL CALL: Mayor Palmquist and Council Members Nelson, Ross, Wroblewski and Perkins. A Quorum 14 was present. Also present were City Administrator Ron Moorse and City Attorney Tom Radio (who 15 participated remotely). 16 17 3. Motion/Second: Ross/Wroblewski. To approve the agenda for the April 27 , 2026 City Council Work 18 Session. Roll Call, All Ayes, passed 5-0-0. 19 20 4. CITY COUNCIL BUSINESS 21 22 A. Deer Hunting Updates 23 Moorse explained that state legislation was passed in 2025 to allow rifles for deer hunting in the metro area and to 24 authorize County Boards to prohibit rifles for deer hunting, and there are legal questions regarding whether the 25 legislation prohibited individual cities from adopting firearms ordinances that allow only shotguns for deer 26 hunting. City Attorney Tom Radio participated in the discussion to provide legal guidance. He advised that the 27 city has the authority to regulate the discharge of firearms and this authority may enable the city to prohibit the 28 discharge of rifles for deer hunting. 29 The Council discussed the establishment of a deer hunting and deer management task force to address safety [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 21, 2026

City Council

Afton City Council to consider road maintenance and bridge inspection contracts

The City Council is reviewing proposals for 2026 structure inspections and road maintenance. This includes potential closures and repairs for pedestrian bridges and street surfacing projects.

roadsbridgesinfrastructurecontracts
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Supplemental Packet April 21, 2026 Council Meeting Memorandum To: Honorable Mayor and City Council, City of Afton From: Tyler Hastings, City Engineer Date: 4.19.2026 Re: April 2026 Engineering Reports 1. 2026 Structure Inspections The City of Afton is required to inspect 2 structures in 2026, and the Public Works Committee has recommended an evaluation of the pedestrian bridge at Putnam Boulevard over Valley Creek. L8167 — Trading Post Trail South over an unnamed stream and 82J33 — Valley Creek Trail South over Tributary Valley Creek will receive routine inspections as mandated by MnDOT, and a condition evaluation will be done for L8167 to determine if it should continue use as a pedestrian bridge, or if modifications/maintenance is needed. Action 1: Consider closing the pedestrian bridge at Putnam Boulevard until it can be evaluated. Action 2: Consider approval of CBS? proposal for $24,000 to perform 2026 Structure Inspections. 2. 2026 Road Maintenance The City of Afton is considering crack filling 16.17 miles of City Streets, and microsurfacing 6.62 miles of City Streets. With approval today, the plan is to have recommendations for award at the May City Council meeting. Projects will be advertised separately, and cost estimates are below: Project Estimated Cost Crack Fill (16.17 miles) $130,000 Microsurface (6.62 miles) $304,000 Action: Consider approval of CBS? proposal for $10,000 for work on 2026 Road Maintenance. 3. Road Patching There are 2 areas on Quadrant [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 21, 2026

Meeting

Council denies accessory building variance at 5698 Oakridge Court South

The council voted 4-0 to deny a variance request for an 1,800‑sq‑ft accessory garage at 5698 Oakridge Court South. It also approved a $24,000 contract for 2026 structure inspections and a $10,000 patching project on Quadrant/53rd Street South. Additionally, the council adopted a resolution to approve a minor subdivision at 1010 Stagecoach Trail South, pending clarification of a 33‑foot right‑of‑way requirement.

zoningroadsbudgetplanningdevelopment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Regular Meeting Minutes 5 6 April 21, 2026 7 Afton City Hall 8 3033 St. Croix Trail 9 Afton, MN 55001 10 7:00 P.M. 11 12 1. THE MEETING WAS CALLED TO ORDER by Mayor Palmquist at 7:00 pm 13 14 2. THE PLEDGE OF ALLEGIANCE – was recited. 15 16 3. ROLL CALL: Council Members Randy Nelson, Stan Ross, Lucia Wroblewski & Mayor Palmquist. A 17 quorum was present. Absent was Annie Perkins (excused). 18 ALSO PRESENT: City Administrator Ron Moorse, Planning Commission Chair Kris Kopitzke, City 19 Planner Claire Stickler, City Attorney Tom Radio. 20 21 4. APPROV AL OF AGENDA – 22 Motion/Second Ross/Wroblewski To approve the agenda for the April 21, 2026 Regular City Council 23 meeting. Passed 4-0. 24 25 5. APPROV AL OF MINUTES 26 A. Minutes of the March 17, 2026 City Council Meeting- 27 B. Minutes of the March 23, 2026 City Council Work Session Meeting- 28 C. Minutes of the March 30, 2026 City Council Work Session Meeting- 29 D. Minutes of the March 30, 2026 City Council Special Meeting 30 Motion/Second Ross/Nelson to approve the minutes of the March 17, March 23, March 30 31 City Council Meeting, Work Session, and Special Meeting. Passed 4-0. 32 33 6. PUBLIC INPUT – 34 Karl Weilandt, 13663 34th St S, stated he would like the proposal for changing accessory building sizes to be 35 practical and in line with standard building sizes. 36 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 13, 2026

Parks Committee

Sketch plan review for 4‑lot, 94.4‑acre subdivision on East End of 10" Street

The Parks Committee will review a sketch plan to subdivide a 94.4‑acre property at the east end of 10" Street into four lots. The committee will also consider the Park Dedication Fund balance of $390,396.00, a proposed park donation policy, a donation from Mark and Barbara Russo for Dave Clymer, and naming ideas for Herreid Park.

parkszoningdevelopmentfinancedonationsnaming
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
eee Parks Committee Meeting Monday, April 13, 2026 6:00 PM Due to technical issues, remote participation via Zoom will not be available for this meeting. 1. 2. 35 ca Call to Order Roll Call - Approval of Agenda Approval of Minutes A. Minutes of the March 9, 2026 Parks Committee meeting Business A. Sketch Plan Review for a 4-Lot Subdivision of a 94.4 Acre Property at the East End of 10" Street, with PID#s 05.028.20.44.0004, 05.028.20.43.0001, 08.028.20.11.0001 and 08.028.20.12.0002 Park Dedication Fund Balance Park Donation Policy Park Donation from Mark and Barabara Russo for Dave Clymer Naming Ideas for Herreid Park Adjournment Bow 4A Parks Committee Meeting Monday, March 9, 2026 6:00 PM 1. Called to Order — at 6:00 PM 2. Roll Call — Jed Housker, Grant Jensen, Nicholas Livingston, Julie Stenberg Zeidel, - with Ken Johnson and Annie Perkins sitting in. » Approval of Agenda — Approved by Grant and Angela 4. Approval of Minutes A. Minutes of the February 9, 2026 Parks Committee meeting — discussion followed to streamline both Agenda and Minute Notes -- fewer questions and less minutiae. 5. Business A. Park Dedication Fund Balance $390,500 B. 45" Street Park Design Notes a. Reviewed the Conservation easement for Herreid property prepared by Old Republic Title - Discussion followed. Between the modest size and the low impact stipulations, it seems limit this to a lower tread passive park. b. Reviewed Elissa Thompson’s recommendations regarding trails, sig [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 8, 2026

Meeting

Public Works Committee to review road maintenance and infrastructure projects

The Public Works Committee is meeting to discuss road reviews, bridge reports, and specific infrastructure repairs. The body will evaluate current maintenance projects and security needs for city facilities.

roadsinfrastructurepublic-workswastewater
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of Afton Public Works Committee Meeting April 8, 2026 1:00 PM 3033 St. Croix Trail Afton, MN 55001 Agenda 1. Call to Order 2. Committee Business Bridge Report by Tyler City Roads Review by Tyler and Ken Micro Surfacing Year One Assessment Crackfill Project for 2026 Valley Creek Public Works Garage Security Replace Boundary Fence on East Side of Wastewater Treatment Site Blind Entry on 30" Street Additional Caution/Warning Signage at the Curve Near the Intersection of 60" Street and Oakgreen Avenue. HOAMOOW DS 3. Adjournment
Tue Apr 7, 2026

City Council

NRGC to review sketch plan for 94.4‑acre subdivision at east end of 10th Street

The Natural Resources and Groundwater Committee will review a sketch plan for a four‑lot subdivision covering 94.4 acres at the east end of 10th Street (PID#s 05.028.20.44.0004, 05.028.20.43.0001, 08.028.20.11.0001, 08.028.20.12.0002). The meeting also includes updates on Kelle’s Creek bank stabilization, the 2025 Resilient Communities Project, a land‑rehabilitation project west of City Hall, and regional trail plans. Additional items cover prescribed burns, well testing for nitrates and coliform bacteria, and newsletter content.

zoningwater-resourcestrailsenvironmentland-usenatural-resources
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Natural Resources and Groundwater Committee (NRGC) Meeting Tuesday, April 7, 2026 5:00 PM Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. Revised Agenda 1. Call to order 2. Roll call: David Husebye, Susan Loomis, Kim Myhers, Elissa Thompson, Cody Kaye, Petra Brokken, Scott Hafner and Sven Risom 3. Approval of Agenda for April 7, 2026 meeting and additional agenda items proposed by members. 4. Approval of Minutes of the January 6, 2026 meeting. 5. New Business i) Sketch Plan Review for a 4-lot Subdivision of a 94.4 Acre Property at the East End of 10th Street, with PID#s 05.028.20.44.0004, 05.028.20.43.0001, 08.028.20.11.0001 and 08.028.20.12.0002 6. Old Business i) Kelle’s Creek Bank Stabilization and Floodplain Forest Restoration in Steamboat and Carver Parks — Kim and Elissa ii) 2025 Resilient Communities Project — Sven iii) Land Rehabilitation Project on City Property West of City Hall and City Entryway - Elissa iv) Regional Trails — Sven 1) Battle Creek to St. Croix River 2) Stillwater to Afton v) Prescribed burns — Scott vi) Well Testing for Nitrates and Coliform Bacteria in 2026 - Dave vii) Natural resources awareness program 1) Newsletter/Afton Naturalist - Sven a) Organizations b) Invasive species topics viii) NRGC items for Afton’s monthly newsletter 1) Buckthorn removal and post removal re-vegetation — above 2) Prescribed burns - Scott 3) Mosquito PSA - Petra ix) NRGC Management Organization upd [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 6, 2026

Meeting

Planning Commission recommends denial of variance for 5698 Oakridge Court South

The Planning Commission reviewed a variance request for a detached garage and a sketch plan for a 4-lot subdivision. The body also discussed procedures for handling new information provided by applicants during meetings.

zoningvariancessubdivisionsland-use
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AFTON 1 APPROVED PLANNING COMMISSION MINUTES April 6, 2026 2 3 The meeting was held in-person, participation via Zoom was not available. 4 5 1. CALL TO ORDER – Chair Kris Kopitzke called the meeting to order at 7:00 pm. 6 7 2. PLEDGE OF ALLEGIANCE 8 9 3. ROLL CALL – Present: Doug Parker, Justin Sykora, Kris Kopitzke, Kate McGinn, Chris Bursack, Kuchen 10 Hale, Christian Dawson. Absent was Sally Doherty, Alison Miller (both excused). A quorum was present. 11 12 ALSO IN ATTENDANCE – City Administrator Ron Moorse, Council Member Annie Perkins, City Planner 13 Emily Herald. 14 15 4. APPROVAL OF AGENDA – 16 Motion/Second Sykora/Parker to approve the agenda for the April 6, 2026 Planning Commission 17 meeting. Passed 7-0. 18 19 5. APPROVAL OF MINUTES – 20 Motion/Second Sykora/Hale to approve the minutes of the March 2, 2026 Planning Commission 21 meeting. Passed 6-0-1 (Dawson abstain). 22 23 6. REPORTS AND PRESENTATIONS 24 None 25 26 7. PUBLIC HEARINGS 27 A. Variance Application for an Accessory Building at 5698 Oakridge Court South 28 Chair Kopitzke opened the public hearing at 7:03 PM. 29 Emily Herald, City Planner, provided a summary of the application which is for a property (5698 Oakridge 30 Ct S) which is zoned Agriculture and measures 5.5 acres in size. The property owner has requested a 50-foot 31 variance in order to build a 1,800 ft2 detached garage within 50 feet of the side (eastern) property line. Per § 32 153.077 and § [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 6, 2026

Planning Commission

Planning Commission reviews variance for 1,800 sq ft garage at 5698 Oakridge Ct S

The Afton Planning Commission is reviewing a variance request for an 1,800 sq ft accessory building at 5698 Oakridge Ct S. The applicant proposes a 50-foot side-yard setback, which is less than the 100-foot requirement for structures over 1,500 sq ft. Staff and neighbors have raised concerns about the structure's visibility and potential impact on neighboring properties.

zoningvarianceplanning-commissionaftonaccessory-buildingproperty-linesetback
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
04-06-2026 Planning Commission Meeting Supplemental Packet City of Afton Planning Commission From: Craig Abrahamson, 5686 Oakridge CtS Re: Variance Application Concerns for Proposed Accessory Building at 5698 Oakridge Ct S Date: April 6, 2026 Neighbor Concerns The ‘Submitted Variance’ questionnaire appears to contain factual inconsistencies. Variance Criteria #3: Granting the requested variance will alter the established character of the area. Similarly sized accessory structures are uncommon within Afton Creek Preserve (apart from the original landowner/developer property). The proposed placement near the property line may increase the structure’s visual prominence from adjacent properties and may adversely affect neighboring property values. 11: The proposed building will be visible from multiple (not 1) nearby properties (as indicated by the red arrows in the diagram). For example, Property #2 may have views of the structure from the rear porch/deck and from interior living areas. Based on current site conditions, tree coverage in this area appears limited; therefore, vegetative screening may be minimal. Compliance i City Scope: The following requirements should be addressed pursuant to the subsequent cited Afton Creek Preserve Homeowner’s Association governing document segments. DECLARATION OF COVENANTS, CONDITIONS AND RESTRICTIONS AFTON CREEK PRESERVE HOMEOWNERS’ ASSOCIATION 8.4 No building, fence, wall, or other structure shall be erected or maintained upon [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026

Meeting

City Council approves $500 contribution to Afton‑Lakeland PTO school carnival

The Afton City Council authorized a $500 payment to the Afton‑Lakeland PTO for its school carnival, using funds from the city’s Charitable Gaming Account. Council members also discussed proposals for monthly vegetation maintenance of downtown medians and City Hall plantings, noting that Horticulture could not submit a proposal because it involved herbicides. The council decided to defer further action on the vegetation maintenance request to the April 21 meeting.

budgetparks-recreationpublic-workscommunitycharitable-gaming
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED Special City Council Meeting Minutes 5 March 30, 2026 6 Afton City Hall 7 3033 St. Croix Trail 8 Afton, MN 55001 9 10 5:15 P.M. 11 1. THE MEETING WAS CALLED TO ORDER at 5:32 P.M. by Mayor Pro Tem Lucia Wroblewski. 12 13 2. ROLL CALL: Mayor Pro Tem Wroblewski, Council Members Randy Nelson and Annie Perkins. A Quorum 14 was present. Also present was City Administrator Ron Moorse. 15 16 3. Motion/Second: Perkins/Nelson. To approve the agenda for the March 30, 2026 Special City Council 17 Meeting with the order of items reversed. Roll Call, All Ayes, passed 3-0-0. 18 19 4. CITY COUNCIL BUSINESS 20 21 A. Request for Contribution from the City to the Afton-Lakeland PTO Carnival 22 23 Moorse explained that Alicia Loquai of the Afton-Lakeland PTO attended the March 17 Council meeting to 24 request a contribution of $2,000 from the City of Afton to assist in funding the costs of the Afton-Lakeland 25 School Carnival and suggested using funds from revenues received from charitable gaming. 26 27 Alicia Loquai was present, and responded to questions regarding the carnival and how the requested contribution 28 relates to the carnival. Alicia indicated that the carnival is by far the largest fundraiser of the PTO. 29 30 The Council discussed the types of organizations and size of contributions made by the City. 31 Moorse indicated most contributions were [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026

City Council

City Council to decide on vegetation contract and $2,000 PTO carnival grant

The Afton City Council will consider two matters: approving a contract with Willow River for monthly weed control and seasonal plant‑bed maintenance on St. Croix Trail medians and City Hall, and authorizing a $2,000 contribution to the Afton‑Lakeland PTO for its school carnival using charitable gaming funds.

vegetationmaintenancecontractbudgetcharitable-gamingptocarnival
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
FP City of Afto ru SPECIAL CITY COUNCIL MEETING AGENDA Monday, March 30, 2026 5:15 PM AGENDA CALL TO ORDER ROLL CALL APPROVAL OF AGENDA — March 30, 2026 Special City Council Meeting CITY COUNCIL BUSINESS A. Proposals for Monthly Vegetation Maintenance in Medians and at City Hall B. Request for Contribution from the City to the Afton-Lakeland PTO Carnival ADJOURN 4A City of Afton 3033 St. Croix Tri, P.O. Box 219 Afton, MN 55001 Meeting Date March 30, 2026 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: March 26, 2026 Re: Proposals for Monthly Vegetation Maintenance in St. Croix Trail Medians and at City Hall We have been very fortunate to have volunteers who were willing to maintain the two medians at the north entrance to the downtown Old Village area, as well as to maintain the plantings in front of the city hall. For 2026, Elissa Thompson, a member of the Natural Resource and Groundwater Committee, has indicated she will take on the spring and fall clean-up of the two medians. The monthly maintenance of the plantings in the medians and the city hall shrubs will be done by a landscape contractor. A proposal has been requested from Horticulture and Willow River to provide weed control for the medians and to maintain the shrubs in front of the city hall. A proposal has been submitted by Willow River that includes the spring and fall clean-ups (see attached). Because Elissa Thompson has agreed to take [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 26, 2026

Meeting

City reviews neighborhood trails plan and U of M recommendations

The Greenway Corridors Working Group will review the status of the neighborhood trails planning process. Members will hear a presentation from a University of Minnesota capstone project that includes a survey and recommendations. The group will then discuss next steps based on feedback from the City Council.

trailsplanningcommunitycity-councilworkgroup
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Greenway Corridors Working Group Meeting Thursday, March 26, 2026 5:00 PM This meeting will be held in-person in the City Hall Council Chambers 3033 St. Croix Trail Afton, MN 55001 Agenda 1. Call to Order - Chair Sven Risom 2. Roll Call Katie Bloome Bob Dickie Kris Kopitzke Susan Loomis Alison Miller Sven Risom Lori Swanson Elissa Thompson • Review Agenda and Make Edits Appropriately 3. Update and Review Neighborhood Trails Planning Process Status 4. Receive Presentation from U of M Capstone Project on Survey and Recommendations 5. Determine Next Steps based on City Council Feedback 6. Adjournment
Mon Mar 23, 2026

City Council

Council to consider flat $125 per‑meeting fee for videographer

The Afton City Council will hear a presentation by the University of Minnesota Capstone Team on the Neighborhood Trails Planning Project. Staff will propose changing videographer compensation from $30 per hour to a flat $125 per meeting, with an hourly rate of $35 for additional services. The Council will discuss options for increasing the maximum size of storage sheds from 160 square feet to 300 or 400 square feet. The City Administrator will provide routine updates on projects and needs.

trailsvideographerfeesaccessory-buildingscity-council
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City Of. "Afton CITY COUNCIL WORK SESSION AGENDA March 23, 2026 4:30 PM 1. CALL TO ORDER 2. ROLL CALL 3. APPROVAL OF AGENDA — March 23, 2026 Council Work Session 4. CITY COUNCIL BUSINESS A. Presentation by the U of M Capstone Team Regarding the Neighborhood Trails Planning Project B. Videographer Compensation C. Accessory Building Size D. City Administrator Updates 5. ADJOURN 4A City of Afton 3033 St. Croix Tri, P.O. Box 219 Afton, MIN 55001 Meeting Date March 23, 2026 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: March 19, 2026 Re: Presentation by the U of M Capstone Students and Discussion Regarding a Vision Statement and Goals for the Neighborhood Trails Planning Project The U of M student Capstone Team has conducted a survey that included the Council and the members of Afton’s volunteer committees and commissions to obtain feedback regarding needs and priorities related to trails in Afton. The response rate for the survey was very high. The results of the survey will be presented by the Capstone Team at the work session. The Capstone Team has also met with Sven Risom of the City’s Greenway Corridors Working Group and Council member Lucia Wroblewski to tour Lucia’s property and neighboring properties and discuss neighborhood trails. The information provided by the survey, and additional information, insights and recommendations to be provided by the Capstone Team, are designed to help inform and a [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 23, 2026

Meeting

Afton City Council reviews neighborhood trails planning and videographer pay

The City Council received a presentation from a U of M Capstone Team on neighborhood trails planning priorities. The Council also agreed to change the contracted videographer's pay to a flat rate per meeting. Other agenda items were not discussed due to time constraints.

trailsplanningcontractscompensation
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Work Session Minutes 5 March 23, 2026 6 Afton City Hall 7 3033 St. Croix Trail 8 Afton, MN 55001 9 10 4:30 P.M. 11 1. THE MEETING WAS CALLED TO ORDER at 4:45 p.m. by Mayor Palmquist. 12 13 2. ROLL CALL: Mayor Palmquist and Council Members Nelson, Ross, Wroblewski and Perkins. A Quorum 14 was present. Also present was City Administrator Ron Moorse. 15 16 3. Motion/Second: Ross/Wroblewski. To approve the agenda for the March 23, 2026 City Council Work 17 Session. Roll Call, All Ayes, passed 5-0-0. 18 19 4. CITY COUNCIL BUSINESS 20 21 A. Presentation by the U of M Capstone Team Regarding the Neighborhood Trails Planning Project 22 The U of M student Capstone Team presented the results of a survey regarding needs and priorities concerning 23 neighborhood trails, and also led the Council through exercises designed to assist the Council in identifying 24 potential elements of, and priorities for, neighborhood trails planning that could be part of a vision statement for 25 neighborhood trails. 26 27 B. Videographer Compensation 28 Moorse summarized that the compensation for the contracted videographer has not been adjusted for several 29 years. The current compensation is $30/hour. This generally results in a per-meeting compensation of about $90 30 to $105. The City of Lakeland pays a flat rate of $175 per meeting. The City of Lake St. [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026

Meeting

City Council approves 3.5% pay increase for city staff

The Afton City Council approved a 3.5% salary increase for city staff, adopted the developer’s agreement for the Afton Business Park Second Addition, and approved a change to the firefighter relief association’s pension vesting schedule. The council tabled a minor subdivision application at 1010 Stagecoach Trail South and continued a variance application for an accessory building at 2249 Neal Avenue South to the next meeting. Additional discussion covered deer‑hunting authority and proposals for median maintenance.

payrolldevelopmentpensionzoninghunting
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Regular Meeting Minutes 5 6 March 17, 2026 7 Afton City Hall 8 3033 St. Croix Trail 9 Afton, MN 55001 10 7:00 P.M. 11 12 1. THE MEETING WAS CALLED TO ORDER by Mayor Palmquist at 7:00 pm 13 14 2. THE PLEDGE OF ALLEGIANCE – was recited. 15 16 3. ROLL CALL: Council Members Annie Perkins, Stan Ross, Lucia Wroblewski & Mayor Palmquist. A 17 quorum was present. Absent was Randy Nelson (excused). 18 ALSO PRESENT: City Administrator Ron Moorse, Planning Commission Vice Chair Justin Sykora, City 19 Planner Claire Stickler, City Attorney Tom Radio. 20 21 4. APPROV AL OF AGENDA – 22 Add item 10C8 “legislative updates” 23 Motion/Second Ross/Wroblewski To approve the agenda for the March 17, 2026 Regular City Council 24 meeting. Passed 4-0. 25 26 5. APPROV AL OF MINUTES 27 A. Minutes of the February 17, 2026 City Council Meeting 28 B. Minutes of the March 2, 2026 City Council Work Session 29 Motion/Second Ross/Wroblewski to approve the minutes of the February 17 and March 2 City 30 Council Meeting and work session. Passed 4-0. 31 32 6. PUBLIC INPUT – 33 Karl Weilandt, 13663 34th St S, asked if there was any update on accessory buildings on substandard lots. 34 35 Jeff Walker 1022 Indian Tr S was interested in an update on the deer hunting issues. 36 37 David Houlston 16071 31st S, General Manager for Afton Marina. Requests city autho [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026

City Council

Afton Council to discuss deer hunting ordinance and business park agreement

The Afton City Council will meet to approve minutes and claims, discuss a developer's agreement for the Afton Business Park Second Addition, and hold a public hearing on an amendment to the Firearms Use, Discharge Ordinance to prohibit rifle use for deer hunting.

city-councildeer-huntingordinancebusiness-parkdeveloper-agreementpublic-hearingzoning
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
ey oy A icrs ———————— CITY COUNCIL AGENDA AFTON CITY COUNCIL CHAMBERS 3033 St. Croix Trail South TUESDAY, March 17, 2026 7:00 P.M. Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. The meeting can be viewed live using the following livestream link: https://vimeo.com/event/5769468 1. CALL TO ORDER 2. PLEDGE OF ALLEGIANCE 3. ROLL CALL Mayor Palmquist Council Member Nelson Council Member Ross Council Member Wroblewski Council Member Perkins 4, APPROVAL OF AGENDA A. Approval of the Agenda for the City Council Meeting of March 17, 2026 - 5. APPROVAL OF MINUTES 6. A. Minutes of the February 17, 2026 City Council Meeting- B. Minutes of the March 2, 2026 City Council Work Session Meeting- PUBLIC INPUT Citizens may share their comments or concerns on any issue that is a responsibility or function of the Afton City Council, whether or not the issue is on the Agenda. Persons who wish to address the Council must fill out a Comment Card before the meeting begins and give it to the City Administrator or Council Chair. The Council Chair will request you to come to the podium, state your full name and address and present your comments. You are encouraged to limit your presentation to no more than 3 minutes. The Council Chair reserves the right to limit an individual’s presentation if it becomes redundant, repetitive, overly argumentative, or if it is not relevant to an issue that is part of the City of Afton’s responsibilitie [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 11, 2026

Meeting

Heritage Commission reviews historic markers, township hall grant, and tours

The Heritage Preservation/Design Review Commission will consider two historical marker designs for the Putnam House and the Asa Tracy House. The commission will receive updates on the Afton Township Hall federal nomination and related grant information. Discussion will also cover the Village Online Walking Tour Phase 2 and the Valley Creek Driving Tour grant application.

historic-preservationhistorical-markerstownship-hallgrantswalking-tourdriving-tour
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of Afton HERITAGE PRESERVATION/DESIGN REVIEW COMMISSION MEETING AGENDA Wednesday, March 11, 2026 6:00 P.M. 3033 St. Croix Trail Afton, MN 55001 AGENDA al CALL TO ORDER 2. ROLL CALL Chair Thomas Vice Chair Livingston Commissioner Vujovich Commissioner Vermeland Commissioner Huelster 3. APPROVAL OF AGENDA A. Approval of Agenda for March 11, 2026 meeting 4. APPROVAL OF MINUTES A. Minutes of the February 11, 2026 Meeting 5. BUSINESS A. Historical Markers 1. Putnam House/Red House 2. Asa Tracy House (Kathy’s) B. Township Hall Project 1. Federal Nomination 2. Grants C. Village Online Walking Tour — Phase 2 D. Valley Creek Driving Tour 1. Grant Application A quorum of the City Council or Other Commissions may be present to receive information. 4A Heritage Preservation Commission Wednesday, February 11, 2026, 6:00 P.M. MINUTES . CALL TO ORDER - 6:05 PM . ROLL CALL A. Chair Thomas — Yes B. Vice Chair Livingston — Yes C. Commissioner Vujovich - No D. Commissioner Vermeland - Yes E. Commissioner Huelster ~ Yes . APPROVAL OF AGENDA A. Approval of the Agenda for the February 11, 2026 meeting - Livingston — 1st, Huelster — 2nd; passed . APPROVAL OF MINUTES A. Approval of the Minutes of the January 14, 2026 meeting - Livingston — 1st, Huelster — 2nd; passed . BUSINESS A. Design Review - Pairs for Pours for Exterior Improvements at 3335 St. Croix Trail South i. Pairs for Pours was not ready for the Feb. meeting, so they did not attend. B. Design Review Landspec [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026

Parks Committee

Parks Committee to discuss 45th Street Park design and donation policy

The Parks Committee will review design notes for the 45th Street Park and discuss expanding the park bench donation policy. The committee will also receive an update on the Park Dedication Fund balance.

parkszoningdonationstrail-designbudget
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
(ee —" of /\\ = City of Afton Parks Committee Meeting Monday, March 9, 2026 6:00 PM Due to technical issues, remote participation via Zoom will not be available for this meeting, 1. Call to Order 2. Roll Call - 3. Approval of Agenda 4. Approval of Minutes A. Minutes of the February 9, 2026 Parks Committee meeting 5. Business A. Park Dedication Fund Balance B. 45" Street Park Design Notes C. Park Bench Donation Policy 1. Beyond Benches to Include Things Like Trees, Plantings, Other Park Structures, Trailhead Picnic Shelter, Boardwalks, Etc. Do we have a list of wants and needs? 2. What Does Memorial Mean — Person Who Lived in Afton, Had a Special Connection to Afton? Does it Include Businesses in Afton? Memorial = non-living? 3. Compare to Memorial Benches in Woodbury (Afton Memorial is larger than just benches today) 4. Afton and Woodbury Both Carry a Maintenance Donation Time Limit for Renewal — 10 years 5. Woodbury Has a Map of Sites on the City Website for Potential Bench Locations 6. Adjournment 4A City of Afton Parks Committee Meeting Minutes Monday, February 9", 2026 6:00 Call to Order The meeting was called to order at 6:03 PM by Nicholas Livingston Attendees: Grant Jensen, Bob Dickie, Nicholas Livingston, Julie Zeidel, Council Member Annie Perkins, Approval of Agenda Approved by Bob and seconded by Grant Approval of meeting minutes of January 12, 2026 Approved by Julie and seconded by Grant Business 1. The Park Dedication Fund balance as of December [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 2, 2026

Meeting

Planning Commission recommends approval of lot split and denial of barn variance

The Planning Commission reviewed two land-use applications. The body recommended approving a minor subdivision to create an additional lot and recommended denying a setback variance for a livestock barn.

zoningsubdivisionvarianceagriculture
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AFTON 1 APPROVED PLANNING COMMISSION MINUTES March 2, 2026 2 3 The meeting was held in-person, participation via Zoom was not available. 4 5 1. CALL TO ORDER – Chair Kris Kopitzke called the meeting to order at 7:00 pm. 6 7 2. PLEDGE OF ALLEGIANCE 8 9 3. ROLL CALL – Present: Doug Parker, Justin Sykora, Kris Kopitzke, Kate McGinn, Chris Bursack, Kuchen 10 Hale. Absent was Christian Dawson, Sally Doherty, Alison Miller. A quorum was present. 11 12 ALSO IN ATTENDANCE – City Administrator Ron Moorse, Mayor Bill Plamquist, City Planner Emily 13 Herald. 14 15 4. APPROVAL OF AGENDA – 16 Motion/Second Sykora/Parker to approve the agenda for the March 2, 2026 Planning Commission 17 meeting. Passed 6-0. 18 19 5. APPROVAL OF MINUTES – 20 Motion/Second Hale/Kopitzke to approve the minutes of the February 2, 2026 Planning Commission 21 meeting. Passed 5-0-1 (Parker abstain). 22 23 6. REPORTS AND PRESENTATIONS 24 None 25 26 7. PUBLIC HEARINGS 27 A. Minor Subdivision application to create one additional lot at 1010 Stagecoach Tr S 28 Chair Kopitzke opened the public hearing at 7:08 pm 29 Emily Herold, City Planner, provided a summary of the application which is for a minor subdivision at 30 located at 1010 Stagecoach Trail South in Afton, MN. This proposal would split one lot (20.04 total acres) 31 into two lots measuring 15.04 acres (Parcel A) and 5 acres (Parcel B). Access to all lots would be from 32 existing roads and no new road infrastr [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 2, 2026

Planning Commission

Planning Commission to hold hearings on subdivision and building variance

The Planning Commission will hold public hearings regarding a request to create an additional lot at 1010 Stagecoach Trail South and a variance for an accessory building at 2249 Neal Avenue South. The body will also review highlights from the February 17, 2026, City Council meeting.

zoningsubdivisionvarianceland-use
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of A ftart PLANNING COMMISSION AGENDA March 2, 2026 7:00 pm Afton City Council Chambers 3033 St. Croix Trail Afton, MN 55001 Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. The meeting can be viewed live using the following livestream link: https://vimeo.com/event/5739719 AGENDA 1. CALL TO ORDER - 2. PLEDGE OF ALLEGIANCE — 3. ROLL CALL - a) Sally Doherty b) Kris Kopitzke (Chair) c) Justin Sykora d) Christian Dawson e) Doug Parker f) Kuchen Hale g) Alison Miller h) Chris Bursack i) Kate McGinn 4. APPROVAL OF AGENDA — 5. APPROVAL OF MINUTES — A. February 2, 2026 Meeting Minutes 6. REPORTS AND PRESENTATIONS — none 7. PUBLIC HEARINGS — A. Minor Subdivision Application to Create One Additional Lot at 1010 Stagecoach Trail South B. Variance Application for an Accessory Building at 2249 Neal Avenue South 8. NEW BUSINESS — None 9. OLD BUSINESS - A. Update on City Council Actions — Council Highlights from the February 17, 2026 Council meeting - attached. 10. ADJOURN — A quorum of the City Council or Other Commissions may be present to receive information. ak GY ok oh oS ed BA Sk LS: OMNODNBWNADOOANMDOBRW DH = AAIAAKRRRRABRARBRARWAWHWWWWWWWWNNNN SA CITY OF AFTON DRAFT PLANNING COMMISSION MINUTES February 2, 2026 The meeting was held in-person, participation via Zoom was not available. CALL TO ORDER — Chair Kris Kopitzke called the meeting to order at 7:00 pm. PLEDGE OF ALLEGIANCE ROLL CALL - Present: Justin Syk [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 2, 2026

City Council

Afton City Council to discuss deer management and accessory building rules

The City Council will hold a work session to discuss deer hunting plans and potential changes to accessory building size and quantity limits for lots under 5 acres. The body will also review proposed security improvements for City Hall and the transition to a .gov website domain.

deer-managementzoningcity-hallpublic-safetygovernment-operations
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
= oN > City Of. “Afton CITY COUNCIL WORK SESSION AGENDA March 2, 2026 4:30 PM CALL TO ORDER ROLL CALL APPROVAL OF AGENDA — March 2, 2026 Council Work Session CITY COUNCIL BUSINESS A. Deer Hunting Plans for 2026 B. Accessory Buildings on Substandard Lots C. City Hall Security D. City of Afton Domain Name Change to .gov Format E. City Administrator Updates ADJOURN 4A City of Afton 3033 St. Croix Tri, P.O. Box 219 Meeting Date March 2, 2026 Afton, MIN 55001 Council Action Memo To: Mayor Palmquist and City Council Members From: Ron Moorse, City Administrator Date: February 25, 2026 Re: Deer Hunting Plans For 2026 Ordinance Prohibiting the Use of Rifles for Deer Hunting in Afton A public hearing regarding the ordinance prohibiting the use of rifles for deer hunting will be held at the March 17 Council meeting. Updates Staff has heard in calls with residents that there are a lot more hunters in Afton than there were several years ago. The recent city newsletter encouraged property owners who allow hunters on their property to require them to take more than one deer. The DNR’s Wildlife Manager for the North Metro Area has indicated that a special hunt on a group of private properties is not as effective as convincing more hunters to take antlerless deer. Obstacles to Hunters Taking Multiple Deer e« Hunters only want to take a buck ¢ Processing multiple deer is expensive and time consuming o Some churches and non-profit organizations will take deer for processi [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026

City Council

City Council discusses deer hunting regulations and herd management

The City Council is reviewing proposals and resident feedback regarding deer hunting within Afton. Discussions include potential restrictions on rifles, the use of sharpshooters, and the implementation of Earn-a-Buck regulations.

huntingwildlife-managementcity-codepublic-safety
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
02-17-2026 City Council Regular Meeting Second Supplemental Packet From: Eric Fosmo Sent: Monday, February 16, 2026 1:16 PM To: Bill mayor <- Anne Perkins Ward 2 Council Member ward2 ; Randy ward4 ; Administrator Subject: Comments on City of Afton Deer Hunting Discussions Mayor, Councilmembers, and Administrator, | am writing to provide comments, feedback, and suggestions regarding the Council's ongoing discussions related to deer hunting within the City of Afton. | appreciate the time the Council has devoted to this issue and, in particular, the intent to maintain and encourage hunting as the primary method of deer herd management within the City. | also spoke directly with Councilmembers Wroblewski and Nelson within the past week to share much of this feedback by phone. Below are my comments on specific items the Council is currently discussing or has discussed over the last few months: ¢ Rifle restriction: | am generally supportive of the rifle restriction as written in the current Council packet. This approach maintains the status quo regarding firearm use for deer hunting and, given the character of Afton, seems appropriate. ¢ Earn-a-Buck regulations: | do not support implementing an Earn-a-Buck requirement. | do not believe the City can regulate its way to improved deer herd management. | have included alternative suggestions below that | believe would be more effective in the long term and better aligned with encouraging deer hunting and increased antlerless h [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026

Meeting

Council approved a Conditional Use Permit for a private riding stable at 13750 15th St S

The Afton City Council approved Resolution 2026-15, granting a Conditional Use Permit for a private riding stable at 13750 15th St S with added septic and public‑event conditions. It also adopted three resolutions (2026-16, 2026-17, 2026-18) approving the final plat and easement vacations for the Afton Business Park at 300 and 377 Maple Court. The council referred an amendment to the Firearms Use, Discharge ordinance that would prohibit rifles for deer hunting to a public hearing at the March 17 meeting. A discussion was held on allowing accessory dwelling units called “casitas” in the agricultural zone, but no action was taken.

zoningland-usefirearmsbusiness-parkinfrastructure
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Regular Meeting Minutes 5 6 February 17, 2026 7 Afton City Hall 8 3033 St. Croix Trail 9 Afton, MN 55001 10 7:00 P.M. 11 12 1. THE MEETING WAS CALLED TO ORDER by Mayor Palmquist at 7:00 pm 13 14 2. THE PLEDGE OF ALLEGIANCE – was recited. 15 16 3. ROLL CALL: Council Members Randy Nelson, Stan Ross, Lucia Wroblewski & Mayor Palmquist. A 17 quorum was present. Absent was Annie Perkins (excused). 18 ALSO PRESENT: City Administrator Ron Moorse, Planning Commission Chair Kris Kopitzke, City 19 Engineer Tyler Hastings, City Planner Claire Stickler, City Attorney Tom Radio. 20 21 4. APPROV AL OF AGENDA – 22 Add item 9c4 “City Day on the Hill” event 23 Motion/Second Ross/Wroblewski To approve the agenda with the addition of item 9c4 for the 24 February 17, 2026 Regular City Council meeting. Passed 4-0. 25 26 5. APPROV AL OF MINUTES 27 A. Minutes of the January 20, 2026 City Council Meeting 28 Motion/Second Palmquist/Ross to approve the minutes of the January 20 City Council Meeting. 29 Passed 4-0 . 30 31 6. PUBLIC INPUT – 32 Paul Wyland, 34th St S, asked for an update on the exterior building ordinance. 33 34 Connor Daine, 14540 15th St S, stated he is in favor of allowing rifle use in Afton as they are more effective. 35 He also emailed comments on the topic. 36 37 7. REPORTS/PRESENTATIONS – 38 A. Sheriff’s Monthly Report 39 [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 11, 2026

Meeting

Afton Heritage Preservation Commission to review industrial building design

The Heritage Preservation/Design Review Commission will meet to review design proposals for a new industrial building and exterior improvements to a local business. The body will also discuss historical markers and tourism projects.

zoningdesign-reviewhistoric-preservationindustrial-developmenttourism
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City OF Afton HERITAGE PRESERVATION/DESIGN REVIEW COMMISSION — MEETING AGENDA Wednesday, February 11, 2026 6:00 P.M. 3033 St. Croix Trail Afton, MN 55001 AGENDA CALL TO ORDER 2. ROLL CALL Chair Thomas Vice Chair Livingston Commissioner Vujovich Commissioner Vermeland Commissioner Huelster 3. APPROVAL OF AGENDA A. Approval of Agenda for February 11, 2026 meeting 4. APPROVAL OF MINUTES A. Minutes of the January 14, 2026 Meeting 5. BUSINESS A. B. C. Design Review Pairs for Pours for Exterior Improvements at 3335 St. Croix Trail South Design Review Landspec 5 Afton for Planned New Industrial Building at 300 and 377 Maple Court South Historical Markers 1. Putnam House/Red House 2. Asa Tracy House (Kathy’s) Township Hall Project 1. Federal Nomination 2. Grants Village Online Walking Tour — Phase 2 Valley Creek Driving Tour [A quorum of the City Council or Other Commissions may be present to receive information. 4A Heritage Preservation Commission Wednesday, January 14, 2026, 6:00 P.M. MINUTES . CALL TO ORDER - 6:02 PM » ROLL CALL A. Chair Thomas — Yes B. Vice Chair Livingston - Yes C. Commissioner Vujovich - No D. Commissioner Vermeland - Yes E. Commissioner Huelster — Yes . APPROVAL OF AGENDA A. Approval of the Agenda for the January 14, 2026 meeting - Huelster — 1st, Livingston — 2nd; passed - APPROVAL OF MINUTES A. Approval of the Minutes of the December 10, 2025 Meeting - Thomas — ‘st, Livingston — 2nd; passed . BUSINESS A. Indigenous History in Af [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026

Parks Committee

Park Dedication Fund balance reported as $388,026

The Parks Committee will review the Park Dedication Fund balance of $388,026 as of Dec. 31, 2025. Members will discuss priority parks, focusing on Herreid Park’s conservation easement and possible passive‑park amenities, and Steamboat Park’s recent Releaf Grant application, which was not funded. The park bench donation policy is placed on hold pending a comparison with Woodbury’s program.

park-fundpriority-parksgrantbench-donationconservation-easement
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Parks Committee Meeting Monday, February 9, 2026 6:00 PM Due to technical issues, remote participation via Zoom will not be available for this meeting. 1. Call to Order 2. Roll Call - 3. Approval of Agenda 4. Approval of Minutes A. Minutes of the January 12, 2026 Parks Committee meeting 5. Business A. Park Dedication Fund Balance B. Focus on Top Two Priority Parks — Herreid & Steamboat Park — Elissa Thompson & Tara Kelly, WCD 1. Herreid Property a. Walk through conservation easement b. Discuss potential opportunities for passive park (trails, human, dog, horse, etc.), parking area, benches, signage, etc. 2. Steamboat Park a. Update/overview of Releaf Grant — Unfortunately, the Releaf Grant application was unsuccessful. The Washington Conservation District will continue to look for other grant opportunities. C. Park Bench Donation Policy (memorials/living tributes/companies/locations, etc.) 1. On hold until Lori comes back — comparison from current Afton program and Woodbury’s bench program 6. Adjournment Priority Parks for 2026: e Herreid Park — Jenny sent conservation easement link to Parks Committee Steamboat/Carver Park Town Square Park- Trees be removed/replanted/etc. Remus Park — 2026 trail through park discussed Meadow Ridge — 6 additional acres/plantings Levee Plantings — Additional plantings 4A City of Afton Parks Committee Meeting Minutes Monday, January 12, 2026 6:00 Attendees: Lori Swanson, Grant Jenson, Bob Dickie, Angela Tangen Council Member Annie Perk [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 2, 2026

Meeting

Planning Commission recommends approval of riding stable CUP with conditions

The commission held a public hearing on a Conditional Use Permit for a private riding stable at 13750 15th St S and voted to recommend its approval with specific conditions. Commissioners added a casita ordinance item for future city council consideration. The commission also reviewed the draft Agriculture Conservation Development ordinance and received an update on recent city council actions.

zoningagricultureland-usehousingdevelopment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AFTON 1 APPROVED PLANNING COMMISSION MINUTES February 2, 2026 2 3 The meeting was held in-person, participation via Zoom was not available. 4 5 1. CALL TO ORDER – Chair Kris Kopitzke called the meeting to order at 7:00 pm. 6 7 2. PLEDGE OF ALLEGIANCE 8 9 3. ROLL CALL – Present: Justin Sykora, Kris Kopitzke, Sally Doherty, Chris Bursack, Kuchen Hale, Christian 10 Dawson. Absent was Doug Parker, Alison Miller, Kate McGinn (excused). A quorum was present. 11 12 ALSO IN ATTENDANCE – City Administrator Ron Moorse, Mayor Bill Plamquist, City Planner Emily 13 Herald. 14 15 4. APPROVAL OF AGENDA – 16 Add item 8A “casita ordinance” 17 Motion/Second Hale/Bursack to approve the agenda for the February 2, 2026 Planning Commission 18 meeting. Passed 6-0. 19 20 5. APPROVAL OF MINUTES – 21 Motion/Second Sykora/Dawson to approve the minutes of the January 5, 2026 Planning Commission 22 meeting. Passed 5-0-1 (Doherty abstain). 23 24 6. REPORTS AND PRESENTATIONS 25 None 26 27 7. PUBLIC HEARINGS 28 A. Conditional Use Permit Application for a private riding stable at 13750 15th St S 29 Chair Kopitzke opened the public hearing at 7:03pm. 30 Emily Herold, City Planner provided a summary of the application which is for a family farm consisting of a 31 house, barn with indoor riding arena, accessory storage structure(s), exterior riding areas/pasture space, and 32 land for cultivating alfalfa hay. The applicant is requesting a Conditional Use Permit i [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 2, 2026

Planning Commission

Planning Commission to consider CUP for indoor riding stable at 13750 15" St S

The commission will hold a public hearing on a Conditional Use Permit to create an indoor private riding stable on 13750 15" St S, a 30.8‑acre agricultural parcel. Commissioners will also review the draft Agriculture Conservation Development Ordinance and receive a summary of recent City Council actions. No new business is scheduled.

zoningagricultureplanningpermitsdevelopment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
= a re City of Afton PLANNING COMMISSION AGENDA February 2, 2026 7:00 pm Afton City Council Chambers 3033 St. Croix Trail Afton, MN 55001 Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. AGENDA 1. CALL TO ORDER - 2. PLEDGE OF ALLEGIANCE — 3. ROLL CALL - a) Sally Doherty b) Kris Kopitzke (Chair) c) Justin Sykora d) Christian Dawson e) Doug Parker f) Kuchen Hale g) Alison Miller h) Chris Bursack i) Kate McGinn 4. APPROVAL OF AGENDA — 5. APPROVAL OF MINUTES — A. January 5, 2026 Meeting Minutes 6. REPORTS AND PRESENTATIONS — none 7. PUBLIC HEARINGS — A. Conditional Use Permit Application for a Private Riding Stable at 13750 15" Street South 8. NEW BUSINESS — None 9. OLD BUSINESS - A. Draft Agriculture Conservation Development Ordinance B. Update on City Council Actions — Council Highlights from the January 20, 2026 Council meeting - attached. 10. ADJOURN — A quorum of the City Council or Other Commissions may be present to receive information. OONDOBRW MH = SA CITY OF AFTON DRAFT PLANNING COMMISSION MINUTES January 5, 2026 The meeting was held in-person, participation via Zoom was not available. 1. CALL TO ORDER — Chair Kris Kopitzke called the meeting to order at 7:00 pm. 2. PLEDGE OF ALLEGIANCE 3. ROLL CALL — Present: Justin Sykora, Kris Kopitzke, Alison Miller, Chris Bursack, Kuchen Hale, Doug Parker, Kate McGinn, Christian Dawson. Absent was Sally Doherty (excused). A quorum was present. ALSO IN ATTENDANCE [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026

City Council

Afton City Council to review land use applications and city appointments

The City Council will consider variance and subdivision applications for properties on St. Croix Trail South and Maple Court. The body will also designate the city engineer and attorney, and discuss planning for 2026 street projects.

zoninginfrastructureappointmentspublic-safetyland-use
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
city OF - “A ste Orn CITY COUNCIL AGENDA AFTON CITY COUNCIL CHAMBERS 3033 St. Croix Trail South TUESDAY, January 20, 2026 7:00 P.M. Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. 1. CALL TO ORDER 2. PLEDGE OF ALLEGIANCE 3. ROLL CALL Mayor Palmquist Council Member Nelson Council Member Ross Council Member Wroblewski Council Member Perkins 4, APPROVAL OF AGENDA A. Approval of the Agenda for the City Council Meeting of November 18, 2025 - 5. APPROVAL OF MINUTES A. Minutes of the December 16, 2025 City Council Meeting- B. Minutes of the January 12, 2026 City Council Work Session Meeting- 6. PUBLIC INPUT Citizens may share their comments or concerns on any issue that is a responsibility or function of the Afton City Council, whether or not the issue is on the Agenda. Persons who wish to address the Council must fill out a Comment Card before the meeting begins and give it to the City Administrator or Council Chair. The Council Chair will request you to come to the podium, state your full name and address and present your comments. You are encouraged to limit your presentation to no more than 3 minutes. The Council Chair reserves the right to limit an individual’s presentation if it becomes redundant, repetitive, overly argumentative, or if it is not relevant to an issue that is part of the City of Afton’s responsibilities. The Council Chair may also limit the number of individual presentations to accommodate the s [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026

Meeting

Council denies variance and subdivision for 3787 St. Croix Trail property

The Afton City Council voted to deny both a variance request and a minor subdivision application for the parcels at 3787 St. Croix Trail South and 4010 Penfield Avenue South. The council also approved a preliminary plat, street easement vacation, and conditional use permit for 300 and 377 Maple Court. Additional actions included authorizing $2,000 for a road inventory update and beginning the process to change the city’s domain name to www.aftonmn.gov.

zoningplanningdevelopmentroadsparksfire
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Regular Meeting Minutes 5 6 January 20, 2026 7 Afton City Hall 8 3033 St. Croix Trail 9 Afton, MN 55001 10 7:00 P.M. 11 12 1. THE MEETING WAS CALLED TO ORDER by Mayor Palmquist at 7:00 pm 13 14 2. THE PLEDGE OF ALLEGIANCE – was recited. 15 16 3. ROLL CALL: Council Members Randy Nelson, Stan Ross, Annie Perkins, Lucia Wroblewski & Mayor 17 Palmquist. A quorum was present. 18 ALSO PRESENT: City Administrator Ron Moorse, Planning Commission Chair Kris Kopitzke, City 19 Engineer Tyler Hastings, City Planner Claire Stickler, City Attorney Tom Radio. 20 21 4. APPROV AL OF AGENDA – 22 Motion/Second Palmquist/Wroblewski To approve the agenda for the January 20, 2026 Regular City 23 Council meeting. Passed 5-0. 24 25 5. APPROV AL OF MINUTES 26 A. Minutes of the December 16, 2025 City Council Meeting 27 B. Minutes of the January 12, 2026 City Council Work Session Meeting 28 Motion/Second Ross/Perkins to approve the minutes of the December 16 and January 12 City 29 Council Meeting and Work Sessions. Passed 5-0 . 30 31 6. PUBLIC INPUT – 32 Resident at 13663 36th St S asked about when review might happen for the ordinance regarding secondary 33 buildings and lot sizes. 34 35 7. REPORTS/PRESENTATIONS – 36 A. Sheriff’s Monthly Report 37 Report in packet. 38 39 B. City Accountant’s Budget Report 40 Report in packet. 41 42 C. Low [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 14, 2026

Meeting

Heritage Preservation Commission to discuss indigenous history and historical markers

The Heritage Preservation/Design Review Commission will meet to hear from a guest regarding indigenous history in Afton. The body will also discuss historical markers, the Township Hall project, and the commission's role in reviewing new commercial buildings in industrial zones.

historic-preservationindigenous-historylandmarksdesign-reviewgrants
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
a ZED City of — OFL HERITAGE PRESERVATION/DESIGN REVIEW COMMISSION = MEETING AGENDA Wednesday, January 14, 2026 6:00 P.M. 3033 St. Croix Trail Afton, MN 55001 AGENDA CALL TO ORDER ROLL CALL Chair Thomas Vice Chair Livingston Commissioner Vujovich Commissioner Vermeland Commissioner Huelster APPROVAL OF AGENDA A. Approval of Agenda for January 14, 2026 meeting APPROVAL OF MINUTES A. Minutes of the December 10, 2025 Meeting BUSINESS A. Indigenous History in Afton: Invited Guest Amo 1. Sharyl Whitehawk- Lac Courte Oreilles, Afton Resident, Belwin Indigenous Liaison and American Indian Education Center (AIEC) Counselor Historical Markers 1. Putnam House/Red House 2. Asa Tracy House (Kathy’s) . Township Hall Project 1. Federal Nomination 2. Grants Village Online Walking Tour — Phase 2 Valley Creek Driving Tour Brief Discussion of HPC Role in Design Review of New Commercial Buildings in the Industrial Zones. [A quorum of the City Council or Other Commissions may be present to receive information. 4A Heritage Preservation Commission Wednesday, December 10, 2025, 6:00 P.M. MINUTES . CALL TO ORDER — 6:00 PM . OATH OF OFFICE - Hugh Huelster A. Hugh Huelster was sworn in as HPC Commissioner by Ron Moorse. . ROLL CALL A. Chair Thomas - Yes B. Vice Chair Livingston - Yes C. Commissioner Vujovich - Yes D. Commissioner Vermeland - Yes E. Commissioner Huelster - Yes . APPROVAL OF AGENDA A. Approval of the Agenda for the December 10, 2025 meeting; Vujovich — ‘st, Hu [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

Parks Committee

Parks Committee to discuss 2026 planning and park bench donation policy

The Parks Committee will review a priority list for 2026 park planning and discuss a policy for park bench donations. The body will also receive updates on the skating rink and the FSI Standard Urban Forest Grant.

parksplanninggrantszoningbudget
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Parks Committee Meeting Monday, January 12, 2026 6:00 PM — 7:00 PM Note: The Park’s meeting will only be one hour long, due to another meeting starting at 7:00 PM Due to technical issues, remote participation via Zoom will not be available for this meeting. nN Call to Order Roll Call - Approval of Agenda Approval of Minutes A. Minutes of the December 8, 2025 Parks Committee meeting Business A. Park Dedication Fund Balance B. Park Bench Donation Policy (memorials/living tributes/companies/locations, etc.) C. Skating Rink — Motion to Council — Update D. Priority List of Afton Parks — Lori’s recommendation for 2026 Park planning E. FSI Standard Urban Forest Grant — Update F. Allow Bee Area in Steamboat Park (attached to trees) . Adjournment Suggested Priority Parks (listed in bold): Herreid Park Steamboat/Carver Park Town Square Park Remus Park Meadow Ridge Dike Plantings Rinta Park — Community Garden Aftonwood Park — Conservancy Afton Creek Preserve — Privately Owned Cedar Bluff— Privately Owned Oxbow Trail — Shared with Belwin (maintained by Belwin) Collin Green Park — Believed to be landlocked with right-of-way 4A City of Afton Parks Committee Meeting Minutes Monday, December 8, 2025 6:00 Attendees: Lori Swanson, Grant Jenson, Nicholas Livingston, Angela Tangen, Julie Zeidel, Todd Ringgenberg Liaisons — Council Member Annie Perkins, Public Works Ken Johnson Cail to Order: The meeting was called to order at 6:00 by Lori Swanson Approval of Minutes from Oct [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

City Council

Agriculture Preservation Committee to review draft conservation ordinance

The Agriculture Preservation Committee is meeting to discuss a draft Agriculture Conservation Development (ACD) ordinance. The proposed rules aim to preserve farmland by allowing landowners to subdivide property for residential use in exchange for placing at least 50% of the land into a permanent agricultural conservation easement.

agriculturezoningconservationland-useeasements
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City Of. Afton Agriculture Preservation Committee Meeting Monday, January 12, 2026 7:00 PM Note: This meeting will be held in-person in the City Hall Council Chambers at 3033 St. Croix Trail Afton, MN _ 55001 Agenda 1. Call to Order - Chair Marjorie Wade 2. Roll Call Chris Bliska Cody Kaye Michael Morehead Kevin Murphy Doug Parker Nicole Roettger Nancy Turner Marjorie Wade Joel Wipperfurth 3. Draft Agriculture Conservation Development Ordinance 4. Schedule next meeting 5. Adjournment Ag. Preservation Committee Meno ” City of Afton Meeting: January 12, 2026 3033 St. Croix Trl, P.O. Box 219 Afton, MN 55004 To: Agriculture Preservation Committee Members From: Ron Moorse, City Administrator Date: January 8, 2026 Re: Draft Agriculture Conservation Development Ordinance Preservation of Agriculture ; Afton’s current land preservation initiatives (The PLCD ordinance and partnering with the Minnesota Land Trust, Belwin and Washington County to preserve open space) are limited to “open space” or natural resource protection, although “continued farming” is also prioritized in the City’s Comprehensive Plan. The City is working to identify ways to successfully encourage and facilitate the preservation of agriculture over the long term in Afton. Afton currently has a number of sizable family farms in the western portion of the City. As the owners of this farmland plan for the future use of this land, they currently have limited options for the land, most of which do not involve ‘c [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

Meeting

Afton City Council reviews regional trail routes and 2026 deer hunt rules

The City Council met with Washington County planning staff to provide feedback on potential routes for a regional trail between Battle Creek Regional Park and the St. Croix River. The Council also discussed the administration of deer hunt rules for the 2026 season.

regional-trailhunting-regulationszoningtransportation
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
PROCEEDINGS OF THE AFTON CITY COUNCIL 1 CITY OF AFTON 2 WASHINGTON COUNTY, MINNESOTA 3 4 APPROVED City Council Work Session Minutes 5 January 12, 2026 6 Afton City Hall 7 3033 St. Croix Trail 8 Afton, MN 55001 9 10 4:30 P.M. 11 1. THE MEETING WAS CALLED TO ORDER at 4:30 p.m. by Mayor Palmquist. 12 13 2. ROLL CALL: Mayor Palmquist and Council Members Nelson, Wroblewski and Perkins. A Quorum was 14 present. Also present was City Administrator Ron Moorse. 15 16 3. Motion/Second: Nelson/Wroblewski. To approve the agenda for the January 12, 2026 City Council Work 17 Session. Roll Call, All Ayes, passed 4-0-0. 18 19 4. CITY COUNCIL BUSINESS 20 21 A. Meeting with Washington County Planning Staff Regarding Potential Routes for the Regional 22 Trail from Battle Creek Regional Park to the St. Croix River 23 Moorse summarized that based on input from stakeholders in the regional trail scoping area regarding priority 24 goals and criteria for the regional trail, as well as detailed evaluation of multiple potential trail segment options 25 between the Battle Creek Regional Park and the St. Croix River, Washington County planning staff have mapped 26 numerous trail segment options that are color-coded to reflect how well they meet the goals and criteria. 27 28 At the work session, County staff presented a map showing the color-coded trail segment options, with the 29 purpose of obtaining feedback from the Council regarding a number of main trail segment [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 7, 2026

Meeting

City reviews and updates Greenway Corridor planning framework

The Afton Greenway Corridors Working Group will review the Greenway Corridor/Trail Planning Framework and discuss recommended changes and next steps. The group will receive an update on the Resilient Communities Project projects in cooperation with the University of Minnesota and discuss further actions for the regional trail planning process. The meeting will also set the date and time for the next working group session.

greenwaytrailsplanningcommunity-engagementregional-trailresilient-communities
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
— a Greenway Corridors Working Group Meeting Wednesday, January 7, 2026 5:30 PM This meeting will be held in-person in the City Hall Council Chambers 3033 St. Croix Trail Afton, MN 55001 Agenda Call to Order - Chair Sven Risom Roll Call Katie Bloome Bob Dickie Kris Kopitzke Susan Loomis Alison Miller Sven Risom Lori Swanson Elissa Thompson e Review Agenda and Make Edits Appropriately Review Greenway Corridor/Trail Planning Framework - Discuss Recommended Changes and Next Steps Update Regarding the RCP (Resilient Communities Project) Projects in Cooperation with the University of Minnesota Discuss Next Steps in the RCP effort and the Regional Trail Planning Process for the Working Group Identify the Next Meeting Date/Time Adjournment Greenway Corridor/Trail Planning Framework 12-28-25 Project elements Vision o Aclear brief statement that clearly captures and describes the essence of what we want the Greenway Corridors planning and implementation process to accomplish Goals co Aset of clear, measurable results/benefits we want to achieve Goal o Research and frame up the goal with the Council and Greenway Corridor/Trail Working group = Set timetable — completion mid semester Definition — Define a Greenway Corridor/Trail for the City of Afton — can be done through workshops with Greenway Corridor/Trail working group, etc.....others..... o We should establish an Afton definition of what is “it”. o Think about shared trails, uses, :power” vehicles, and future Engagement — [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026

City Council

NRGC to discuss well testing for nitrates and coliform bacteria in 2026

The Natural Resources and Groundwater Committee will review updates on several ongoing projects, including the 2025 Resilient Communities Project and land rehabilitation west of City Hall. Members will discuss well testing for nitrates and coliform bacteria scheduled for 2026, as well as other items such as creek bank stabilization and cell tower considerations. The meeting also includes routine agenda approval, officer elections, and scheduling of the next meeting.

natural-resourceswater-qualityland-rehabfloodplain-restorationcell-towerstrails
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Natural Resources and Groundwater Committee (NRGC) Meeting Tuesday, January 6, 2026 5:00 PM Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting. Agenda 1. Call to order 2. Roll call: David Husebye, Susan Loomis, Kim Myhers, Elissa Thompson, Cody Kaye, Petra Brokken, Scott Hafner and Sven Risom 3. Approval of Agenda for January 6, 2026 meeting and additional agenda items proposed by members. 4. Election of Officers for 2026 5. Approval of Minutes of the December 2, 2025 meeting. 6. Old Business i) 2025 Resilient Communities Project - Sven ii) Land rehabilitation project on City property west of City Hall and City Entryway – Elissa iii) Kelle’s Creek Bank Stabilization and Floodplain Forest Restoration in Steamboat and Carver Parks – Kim and Elissa iv) Cell Towers in Afton - Petra v) Regional Trails – Sven 1) Battle Creek to St. Croix River 2) Stillwater to Afton vi) Prescribed burns – Scott vii) Well Testing for Nitrates and Coliform Bacteria in 2026 viii) Natural resources awareness program 1) Newsletter/Afton Naturalist - Sven a) Organizations b) Invasive species topics ix) NRGC items for Afton’s monthly newsletter 1) Buckthorn removal and post removal re-vegetation – above 2) Prescribed burns - Scott 3) Spraying of lawns and gardens in downtown Afton – Petra 4) Mosquito PSA - Petra x) NRGC Management Organization update 1) Washington Conservation D [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026

Planning Commission

Planning Commission to hold hearing on Landspec 5 Afton business park proposal

The Planning Commission will conduct a public hearing regarding a preliminary plat, street vacation, and conditional use permit for a proposed business park. The body will also discuss a draft Agriculture Conservation Development Ordinance.

zoningbusiness-parkland-useagriculturepublic-hearing
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
City of "Afton PLANNING COMMISSION AGENDA January 5, 2026 7:00 pm Afton City Council Chambers 3033 St. Croix Trail Afton, MN 55001 Please Note: Due to technical issues, remote participation via Zoom will not be available for this meeting, ; AGENDA 1. CALL TO ORDER- 2. PLEDGE OF ALLEGIANCE — 3. ROLL CALL - a) Sally Doherty b) Kris Kopitzke (Chair) c) Justin Sykora d) Christian Dawson e) Doug Parker f) Kuchen Hale g) Alison Miller h) Chris Bursack i) Kate McGinn 4. APPROVAL OF AGENDA — 5. APPROVAL OF MINUTES — A. December 1, 2025 Meeting Minutes 6. REPORTS AND PRESENTATIONS — none 7. PUBLIC HEARINGS — A. Landspec 5 Afton Preliminary Plat, Vacation of Easements and Street ROW, Lot Combination and CUP Applications at 300 and 377 Maple Court 8. NEW BUSINESS — None 9. OLD BUSINESS - A. Draft Agriculture Conservation Development Ordinance B. Update on City Council Actions — Council Highlights from the December 16, 2025 Council meeting - attached. 10. ADJOURN — A quorum of the City Council or Other Commissions may be present to receive information. I ae ee Ses Cre Ge a Ce OOMONOARWNADOANDORW DM = NNN N=-O SA CITY OF AFTON DRAFT PLANNING COMMISSION MINUTES December 1, 2025 The meeting was held in-person, participation via Zoom was not available. CALL TO ORDER — Chair Kris Kopitzke called the meeting to order at 7:00 pm. PLEDGE OF ALLEGIANCE ROLL CALL - Present: Justin Sykora, Kris Kopitzke, Alison Miller, Chris Bursack, Doug Parker, Sally Doherty, Kate McGinn. Absent was Ku [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026

Meeting

Planning Commission recommends approval of business park at Hudson Road S and Manning Avenue S

The Planning Commission reviewed applications for a 125,600 ft2 multi-tenant business park. The body recommended approval of the preliminary plat, street vacation, and a Conditional Use Permit with specific modifications to the allowed uses and landscaping.

zoningcommercial-developmentland-useplanning
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AFTON 1 APPROVED PLANNING COMMISSION MINUTES January 5, 2026 2 3 The meeting was held in-person, participation via Zoom was not available. 4 5 1. CALL TO ORDER – Chair Kris Kopitzke called the meeting to order at 7:00 pm. 6 7 2. PLEDGE OF ALLEGIANCE 8 9 3. ROLL CALL – Present: Justin Sykora, Kris Kopitzke, Alison Miller, Chris Bursack, Kuchen Hale, Doug 10 Parker, Kate McGinn, Christian Dawson. Absent was Sally Doherty (excused). A quorum was present. 11 12 ALSO IN ATTENDANCE – City Administrator Ron Moorse, Council member Annie Perkins, City Planner 13 Emily Herald. 14 15 4. APPROVAL OF AGENDA – 16 Motion/Second Parker/Sykora to approve the agenda for the January 5, 2026 Planning Commission 17 meeting. Passed 8-0. 18 19 5. APPROVAL OF MINUTES – 20 Motion/Second Parker/Bursack to approve the minutes of the December 1, 2025 Planning Commission 21 meeting. Passed 6-0-2 (Hale, Dawson abstain). 22 23 6. REPORTS AND PRESENTATIONS 24 None 25 26 7. PUBLIC HEARINGS 27 A. Landspec 5 Afton Preliminary Plat, Vacation of Easements and street ROW Lot combination and CUP at 28 300 and 377 Maple Court 29 Chair Kopitzke opened the public hearing at 7:04 pm. 30 Emily Herold, City Planner provided a summary of the suite of applications which consist of 31 requests for a preliminary plat, street vacation, and Conditional Use Permit (CUP) – in order to construct a 32 125,600 ft2 multi-tenant business park building on the southeast corner of Hudson [Excerpt truncated on this listing page; use the official record for the full text.]

Meeting archives

🔗 Embed this city · use the data

Free to reuse under CC BY 4.0 — a link back is appreciated. Paste this into your site:

<iframe src="https://mytown.theboringparts.com/city/aftonmn.gov/embed/" width="100%" height="640" loading="lazy" style="border:1px solid #ddd;border-radius:8px" title="Afton government meetings"></iframe>
<p>Local government meetings via <a href="https://mytown.theboringparts.com/city/aftonmn.gov/">MyTown</a></p>

The credit line under the iframe is a real link back — keep it and you help others find us (and it satisfies the CC BY attribution). Prefer JSON? meetings.json · full embed & API guide.