The Boring PartsFederalLocal · USLocal · Canada
Amarillo, Texas

Amarillo public meetings in 2022

238 substantive meetings from 2022, with official agendas or minutes and plain-English summaries.

Thu Dec 29, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The provided agenda text contains no readable information

The agenda for the Tutbury Public Improvement District Advisory Board meeting on December 29, 2022, consists of unreadable numeric sequences. No specific items, discussions, or decisions can be identified from the provided record.

procedural
Thu Dec 29, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

No readable agenda items were found in the provided text

The meeting agenda for the Amarillo Board of Review for Landmarks, Historic Districts, and Downtown Design consists of unreadable numeric sequences. No specific decisions, proposals, or discussions are identifiable from this record.

amarilloboard of reviewunreadable
Thu Dec 29, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Provided agenda text contains no readable information

The provided text for the Amarillo Board of Review for Landmarks, Historic Districts, and Downtown Design consists of unreadable numeric sequences. No specific items, decisions, or discussions can be identified from this record.

amarilloboard of review
Wed Dec 21, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

Agenda text for December 21, 2022 meeting is unreadable

The provided agenda text consists of encoded numerical strings and contains no readable information regarding meeting topics or decisions.

unreadable
Mon Dec 19, 2022 · 10:00

Planning and Zoning Commission

No readable meeting items found in the provided agenda

The provided text for the December 19, 2022, Planning and Zoning Commission meeting consists of unreadable numeric sequences. No specific proposals, decisions, or discussions can be identified from this record.

unreadableplanning-and-zoningamarillo
Mon Dec 19, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

No readable agenda items found in the provided text

The provided meeting agenda consists of unreadable numerical strings and symbols. No identifiable discussion topics, decisions, or projects could be extracted from this record.

none
Thu Dec 15, 2022 · 12:00

One Time Event

Unreadable agenda text provided for Amarillo meeting

The provided agenda text consists of numerical sequences and does not contain readable English information. No specific items, decisions, or discussions can be identified from the source.

unreadableincompleteno-content
Thu Dec 15, 2022 · 12:00

One Time Event

No readable agenda items found for this meeting

The provided agenda text consists of numerical sequences and does not contain discernible English information or identifiable topics. No specific decisions, proposals, or items can be identified from the source.

unreadableindecipherableno-content
Wed Dec 14, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The board will consider approving landscape maintenance bids.

The Tutbury PID Advisory Board will review minutes from the October 13, 2022 meeting. The board will also discuss ongoing district operations and maintenance and consider approval of landscape maintenance bids.

pidmaintenancelandscapingoperations
Tue Dec 13, 2022 · 11:30

Beautification and Public Arts Advisory Board

The provided meeting agenda contains no readable information

The text for the December 13, 2022, Amarillo Beautification and Public Arts Advisory Board meeting consists of unreadable numerical characters. No specific items, discussions, or decisions can be identified from the provided source.

amarillobeautificationpublic-arts
Tue Dec 13, 2022 · 13:00

Amarillo City Council

The provided agenda contains only encoded numerical indices.

The text for the December 13, 2022, Amarillo City Council meeting consists of numerical values rather than readable English. No specific items or decisions are identifiable from the source document.

proceduralunreadableamarillo
Mon Dec 12, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee discusses sidewalk parking and bike trail rights-of-way

The committee will review the minutes from the October 18, 2022 meeting. Members will discuss vehicle parking blocking sidewalks and safety education opportunities. The agenda also includes updates on the TXDOT loop and walkability in Amarillo.

pedestrian-safetybicycle-safetysidewalkstxdotwalkability
Mon Dec 12, 2022 · 15:00

Library Advisory Board

Unreadable agenda text for Amarillo Library Advisory Board

The provided agenda text consists of numerical sequences and does not contain legible English content. No specific items, decisions, or discussions could be identified from the source.

unreadable
Thu Dec 8, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

The board will consider a short-term landscape maintenance contract.

The Heritage Hills PID Advisory Board will meet to approve October 12, 2022, minutes and consider a short-term landscape maintenance contract. The meeting also includes discussion of ongoing district operations and maintenance.

landscapemaintenancepid-operations
Thu Dec 8, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

TIRZ #1 Board to discuss loan agreement and downtown development projects

The Center City Tax Increment Reinvestment Zone #1 Board will review the quarterly financial report ending September 30, 2022. The meeting includes discussions regarding the current loan agreement with the City of Amarillo and the Amarillo Local Government Corporation. Additionally, the Board will discuss updates for the Downtown Wayfinding Project and a potential Food Truck Park Project.

financedowntowndevelopmentamarillo
Thu Dec 8, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

TIRZ #1 Board discusses loan agreement and downtown development projects

The Center City Tax Increment Reinvestment Zone #1 Board will review the quarterly financial report ending September 30, 2022. The meeting includes discussions regarding a loan agreement with the City of Amarillo and updates on the Downtown Wayfinding Project and a potential Food Truck Park Project.

financedowntowndevelopmentamarillo
Wed Dec 7, 2022 · 13:30

One Time Event

Board considers senior services awards and new Warford Activity Center fee

The Parks & Recreation Board will review minutes from September 14, 2022, and receive updates on projects including 9th Street and playgrounds. The board will also consider recommendations for nonprofit senior services and a new room rental fee at the Warford Activity Center Game Room.

parkssenior servicesfeesrecreationamarillo
Tue Dec 6, 2022 · 07:30

Amarillo Hospital District Board of Managers

The provided agenda text contains no readable meeting items

The agenda for the Amarillo Hospital District Board of Managers meeting on December 6, 2022, consists of numerical sequences and does not contain readable information regarding decisions or discussions.

procedural
Mon Dec 5, 2022 · 10:00

Planning and Zoning Commission

Commission to consider new plats and rezoning requests

The Planning and Zoning Commission will review two plat applications for Hollywood Addition Unit No. 20 and The Vineyards Unit No. 10. The commission will also consider rezoning acreage near Georgia St. and S.W. 58th Ave to Moderate Density and General Retail districts.

zoningplatsrezoningland-use
Mon Dec 5, 2022 · 14:00

Quail Creek Public Improvement District Advisory Board

Discussion of landscape maintenance specifications and contract details

The Quail Creek PID Advisory Board will discuss ongoing district operations and maintenance. The board will also consider landscape maintenance specifications and contract details.

maintenancelandscapingoperationspublic-improvement-district
Fri Dec 2, 2022 · 07:30

Amarillo Hospital District Finance Committee

Reviewing investment strategy and policy changes for the District’s Corpus Funds

The Finance Committee will review minutes from the August 18, 2022 meeting. The committee will also discuss proposed changes to investment strategies for the District's Corpus Funds and consider updates to the Corpus Investment Policy.

financeinvestmenthospital-districtpolicy
Mon Nov 21, 2022 · 08:30

Civil Service Commission

Civil Service Commission to elect officers and review exam appeals

The commission will elect a chairman and vice chairman and approve minutes from October 12, 2022. Members will also review personnel actions such as promotions and disciplinary actions. Additionally, the commission will consider examination appeals for Police Corporal and Fire District Chief positions.

policefirepersonnelcivil-serviceelections
Mon Nov 21, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission meeting on November 21, 2022

The Planning and Zoning Commission will hold a work session and a regular meeting. The agenda consists of procedural items, including reviewing upcoming agenda items and receiving updates on cases sent to City Council. No specific rezonings or ordinances are listed for this meeting.

planningtrainingadministration
Fri Nov 18, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will consider approving or cancelling a landscape maintenance bid

The Colonies Public Improvement District Advisory Board is meeting to discuss ongoing district maintenance items. The board will also consider whether to approve or cancel Landscape Maintenance Bid #7319.

maintenancelandscapepidamarillo
Wed Nov 16, 2022 · 08:30

Amarillo Convention and Visitors Bureau

The Board will discuss the Polk Street Streetscape Project and new board policies.

The Amarillo Convention and Visitors Bureau Board will review financial reports and approve October minutes. The meeting includes updates on the Polk Street Streetscape Project and officer election procedures. Members will also discuss potential board policies and requests for the 2023 Strategic Plan.

tourismstreetscapepolicystrategic-planfinance
Wed Nov 16, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda text contains no readable information.

The document for the November 16, 2022, meeting of the Amarillo Firemen's Relief and Retirement Fund Board of Trustees consists of unreadable numerical sequences. No discernible agenda items or discussion topics are present in the provided text.

unreadableno-contentno-information
Tue Nov 15, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

Board to review quarterly financials and Amarillo National Center payments

The Board will review quarterly financial reports as of September 30, 2022. Discussion items include updates to the District's investment policy and payments related to the Amarillo National Center. The Board will also receive status updates on approved projects at the Tri-State Fairgrounds and Amarillo Civic Center.

financeinvestmentamarillo-national-centerfairgroundscivic-centerbudget
Mon Nov 14, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

The provided meeting agenda text is unreadable.

The source document contains only numeric sequences and does not provide readable information regarding the Amarillo Economic Development Corporation Board of Directors meeting.

unreadableagenda
Wed Nov 9, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Board discusses potential sale of parking garage and retail spaces

The Board will receive updates on Hodgetown, Embassy Suites, and the Parking Garage and Retail Space. Members will discuss year-end financials and potential changes to loan agreements. The meeting also includes discussions regarding options to sell all or portions of the parking garage and retail spaces.

financeparkingretaildevelopment
Wed Nov 9, 2022 · 13:30

One Time Event

Parks & Recreation Board to discuss project and department updates

The Parks & Recreation Board will review the minutes from the September 14, 2022 meeting. The board will also receive reports on 9th Street, playgrounds, and various departmental divisions.

parksrecreationzooinfrastructurepublic-arts
Tue Nov 8, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Selection of contractor for Scott Park drainage work

The board will discuss addressing drainage at Scott Park and consider selecting a contractor for the project. Additionally, members will review City policies regarding developer reimbursement and PID oversight.

drainagescott-parkdeveloper-reimbursementpid-oversightinfrastructure
Tue Nov 8, 2022 · 11:30

Beautification and Public Arts Advisory Board

Updates on mural grants, sculptures, and library murals

The Beautification and Public Arts Advisory Board will review minutes from the October 11, 2022 meeting. The board will also receive updates regarding mural grant applications, sculptures, and a library mural project.

artsmuralspublic-artbeautificationgrants
Tue Nov 8, 2022 · 13:00

Amarillo City Council

The November 8, 2022, Amarillo City Council agenda text is unreadable

The provided agenda text consists of encoded numeric sequences that do not contain readable information. No specific items, decisions, or discussions can be identified from the source document.

amarillocity-councilunreadable
Mon Nov 7, 2022 · 10:00

Planning and Zoning Commission

Rezoning Holland’s Addition for a new outdoor auto sales lot

The Planning and Zoning Commission will consider several land use applications, including plats, a rezoning request, and a right-of-way vacation. The meeting also includes a presentation regarding the City Plan Kick-Off by MIG.

zoningland-usecity-planningplatrezoning
Fri Nov 4, 2022 · 14:00

Quail Creek Public Improvement District Advisory Board

Discussion of landscape maintenance specifications and contract details

The Quail Creek PID Advisory Board will discuss ongoing district operations and maintenance. The board will also consider landscape maintenance specifications and contract details.

landscapingmaintenanceoperationspublic-improvement-district
Wed Oct 26, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Amarillo Convention and Visitors Bureau Board to consider arts marketing grants

The Amarillo Convention and Visitors Bureau Board will meet to review financial reports and approve minutes from September 28, 2022. The board is also scheduled to consider actions regarding arts marketing grants, budget adjustment policy, and an amendment to the Certificate of Formation.

tourismgrantsbudgetartsmarketingadministration
Wed Oct 26, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board considers streetscape grant and downtown project reimbursements

The Center City TIRZ #1 Board of Directors will consider a streetscape grant for the Texas Panhandle First Responders Memorial Project at 1018 S Polk Street. The board will also discuss a reimbursement agreement with Texas Blakey Amarillo, LLC regarding design and feasibility study costs for a proposed downtown residential project.

streetscapegrantsredevelopmentdowntownmemorials
Wed Oct 26, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board considers streetscape grant and downtown residential project costs

The Board will consider a streetscape grant for the Texas Panhandle First Responders Memorial Project at 1018 S Polk Street. Members will also discuss reimbursement for design services and feasibility studies for a downtown residential project. Additionally, the board will review the Wayfinding Project and active incentive agreements.

grantsdevelopmentdowntownmemorialsstreetscape
Tue Oct 25, 2022 · 13:00

Amarillo City Council

Council considers $5 million settlement and $28 million building renovation

The Amarillo City Council will consider a $5,000,000 settlement agreement and a construction manager award up to $28,000,000 for the Amarillo Hardware Building renovation. The agenda also includes tax abatement and incentive agreements for Coast Packing Company — South. Additionally, several rezoning requests and airport equipment purchases are up for consideration.

zoningbudgetconstructionairportpolicehousing
Mon Oct 24, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The October 24, 2022, Colonies PID Advisory Board meeting was cancelled.

The scheduled meeting of the Colonies Public Improvement District Advisory Board for October 24, 2022, was cancelled. The agenda included approving minutes and discussing a proxy for Bid #7319.

pidamarillocancelled
Wed Oct 19, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda text contains no legible information.

The meeting agenda for the Amarillo Firemen's Relief and Retirement Fund Board of Trustees on October 19, 2022, does not contain readable items or discussion topics. The source text consists only of numerical sequences.

firemenretirementfund
Wed Oct 19, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Board to discuss parking garage software, retail pricing, and project updates

The Amarillo Local Government Corporation Board of Directors will review updates for Hodgetown, Embassy Suites, and the Parking Garage. The board will consider Skidata software updates and listing prices for parking garage retail space. Discussions regarding negotiations for the parking garage retail space are also scheduled.

parkingretaildevelopmenthodgetownembassy suites
Tue Oct 18, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee discusses safety education and walkability updates in Amarillo

The committee will review minutes from the August 8, 2022 meeting. Members will also discuss safety education and receive updates on right of way availability and walkability in Amarillo. Kim Hooker from TxDOT will be introduced to the committee.

pedestrian-safetybicycle-safetytransportationwalkabilitypublic-safety
Mon Oct 17, 2022 · 10:00

Planning and Zoning Commission

Commission to consider variance for 443.6-acre Storybook Estates plan

The Planning and Zoning Commission will review a variance request regarding alleys and block length for the Storybook Estates preliminary plan near Loop 335 and S. Grand St. The commission will also consider vacation of a 0.10-acre public alley in the Ridgecrest Unit No. 14 area. Additionally, the meeting includes updates on cases previously sent to City Council.

zoningland-usedevelopmentpublic-works
Thu Oct 13, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

The October 13, 2022, Center City TIRZ #1 Board meeting was cancelled

This meeting was cancelled due to a lack of quorum. The agenda included discussions regarding streetscape grants and reimbursement agreements for downtown projects.

developmentgrantsdowntownamarillo
Thu Oct 13, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

The October 13, 2022, Center City TIRZ #1 Board meeting was cancelled.

The scheduled meeting for the Center City Tax Increment Reinvestment Zone #1 Board of Directors was cancelled due to a lack of quorum. Proposed agenda items included a streetscape grant and reimbursement agreements for downtown projects.

zoninggrantsdowntowndevelopmentmemorial
Thu Oct 13, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The Tutbury PID Advisory Board will consider landscape maintenance specifications.

The Tutbury Public Improvement District Advisory Board will discuss ongoing district operations and maintenance. The board will also consider the approval of landscape maintenance specifications.

pidmaintenancelandscapingoperations
Thu Oct 13, 2022 · 16:00

Zoning Board of Adjustment

Zoning Board considers sign height variance at 8772 S Coulter Street

The Zoning Board of Adjustment will consider a request for a variance to exceed the height limit for a freestanding sign at 8772 S Coulter Street. The board will also review the minutes from the September 8, 2022 meeting.

zoningsignageland-use
Wed Oct 12, 2022 · 08:30

Civil Service Commission

Commission to consider new member appointment and approve police and fire registers.

The Civil Service Commission will consider appointing a new member and approving minutes from August 24, 2022. The body will also review employee transfers, promotions, and disciplinary actions. Additionally, the commission will consider eligibility registers for police recruits and fire personnel.

policefirepersonnelappointmentscivil-service
Wed Oct 12, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

Discussion of phase 3 landscape improvements and district operations

The Heritage Hills Public Improvement District Advisory Board will discuss phase 3 of landscape improvements and ongoing PID operations and maintenance. The board will also consider approving the minutes from the August 10, 2022 meeting.

landscapingpublic-improvement-districtoperationsmaintenance
Tue Oct 11, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

No readable agenda items found for October 11 meeting

The provided text for the Amarillo Economic Development Corporation Board of Directors meeting contains unreadable numeric sequences. No specific decisions, proposals, or discussions can be identified from the source.

amarilloeconomic-development
Tue Oct 11, 2022 · 11:30

Beautification and Public Arts Advisory Board

Beautification Board to review mural grants and community crosswalk standards

The Beautification and Public Arts Advisory Board will discuss several ongoing projects and updates. This includes reviews of mural grant applications, the HOODOO Mural Festival, and library murals. The board will also receive information on community crosswalk program design standards.

muralpublic-artsbeautificationcrosswalkscommunity-projects
Tue Oct 11, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $18 million agreement for new financial software

The council will consider several large contracts, including an $18 million agreement for enterprise resource planning software and a $2.3 million implementation contract. Other items include rezoning requests and various service awards for city infrastructure. The council will also discuss a potential sister city relationship with Dnipro, Ukraine.

softwarebudgetzoningfinancepublic-works
Mon Oct 10, 2022 · 15:00

Library Advisory Board

Library Advisory Board to review department activities and upcoming exhibition tour

The Library Advisory Board will meet to approve minutes from the August 8, 2022 meeting. The Director of Library Services will present updates on departmental issues, including programming at all APL locations and the Friends of the Library. The board will also receive an update regarding Americans and the Holocaust.

libraryprogrammingpublic-meetingamarillo
Thu Oct 6, 2022 · 12:00

Advisory Committee for People with Disabilities

Advisory Committee for People with Disabilities to discuss transit and MPO plans

The Advisory Committee for People with Disabilities will review meeting minutes from April 7, 2022. The agenda includes updates on current transit projects and a presentation regarding Metropolitan Planning Organization (MPO) plans. Members will also discuss committee powers and brainstorm future projects.

disabilitytransitplanningpublic-forumamarillo
Mon Oct 3, 2022 · 10:00

Planning and Zoning Commission

Commission to review new plats and a rezoning request

The Planning and Zoning Commission will consider three plat applications for residential additions and one rezoning request for an 0.86-acre tract. The meeting also includes updates on previous cases and approval of past meeting minutes.

zoningplatsrezoningland-useamarillo
Wed Sep 28, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Board to consider staff salaries and receive project updates

The Amarillo Convention and Visitors Bureau Board will consider staff salaries and review presentations from TACVB and Voyage+. The agenda also includes a financial report and the approval of minutes from August 24, 2022.

tourismsalariesfinancepresentations
Wed Sep 28, 2022 · 17:00

Animal Management & Welfare Advisory Board

Amarillo Animal Management & Welfare Advisory Board reviews department updates

The board will consider approving the May 11, 2022, meeting minutes. Members will also receive reports regarding department staffing and various animal welfare programs.

animal-welfarereportsstaffingpublic-commentamarillo
Tue Sep 27, 2022 · 13:00

Amarillo City Council

No readable agenda items found for Amarillo City Council

The provided agenda text consists of numeric placeholders and contains no readable information. No specific decisions, discussions, or items can be identified from this record.

proceduralunreadable-text
Wed Sep 21, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided meeting agenda contains unreadable encoded text.

The source document for the September 21, 2022, Firemen's Relief and Retirement Fund Board of Trustees meeting consists of non-textual numerical strings. No specific items, decisions, or discussions can be identified from the provided text.

unreadable
Mon Sep 19, 2022 · 10:00

Planning and Zoning Commission

Commission considers rezoning for residential and mini-storage developments

The Planning and Zoning Commission will review several platting requests and rezoning applications. These include changes to land use for residential, mini-storage, and adult day care uses.

zoninghousingland-usedevelopment
Mon Sep 19, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

Tutbury PID Board considers landscape specifications and tree maintenance reimbursement

The Tutbury Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider approving landscape maintenance specifications and tree maintenance reimbursement to the Tutbury Home Owners Association.

maintenancelandscapehousingpublic-improvement-district
Wed Sep 14, 2022 · 13:30

One Time Event

Parks & Recreation Board to discuss budget, master plan, and department updates

The Parks & Recreation Board will consider approving the minutes from the August 10, 2022 meeting. The board will also receive reports regarding the budget, master plan, and 9th Street project. Various departmental divisional updates will be presented.

parksbudgetmaster-planrecreationpublic-arts
Tue Sep 13, 2022 · 11:30

Beautification and Public Arts Advisory Board

Beautification Board to review mural grant reimbursements and elect Vice-Chair

The Beautification and Public Arts Advisory Board will receive updates on projects including the Library Mural and Thompson Park. The Board will also consider action on mural grant reimbursement invoices and the election of a Vice-Chair.

beautificationpublic-artsmuralsparkslocal-government
Tue Sep 13, 2022 · 13:00

Amarillo City Council

The provided meeting agenda contains no readable information.

The source document consists of encoded numerical strings that do not form legible English words or sentences. Consequently, the specific decisions and discussions for this Amarillo City Council meeting cannot be determined from the provided text.

unreadableamarillo-texas
Thu Sep 8, 2022 · 13:00

Amarillo City Council

Unreadable agenda text provided for Amarillo City Council meeting

The provided agenda text consists of encoded numerical data that cannot be read as English. No specific items, decisions, or discussions can be identified from this source.

unreadableprocedural
Thu Sep 8, 2022 · 16:00

Zoning Board of Adjustment

Zoning Board to consider side yard setback variance at 3405 Golden Chestnut Lane

The Zoning Board of Adjustment will meet to approve minutes from the July 14, 2022 meeting and consider a single variance request. The agenda also includes a public forum for citizen comments.

zoningvarianceamarillosetbacks
Wed Sep 7, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider rezoning 21.24 acres at SW 34th Ave. and Soncy Rd.

The Planning and Zoning Commission will review several land use requests, including a new plat for The Colonies Unit No. 81. The agenda also includes multiple rezoning applications and the vacation of two public rights-of-way.

zoningplattingland-useamarillo
Tue Sep 6, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers 2022/2023 budget and property tax rate increase

The City Council will hold a public hearing on the fiscal year 2022/2003 budget, which includes a $13,211,986 increase in property tax revenue. The council is also considering ordinances to adopt this budget and set a total ad valorem tax rate of $0.49086 per $100 valuation.

budgettaxesordinancepublic-hearingpolicefire
Mon Aug 29, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

The provided agenda for the Amarillo EDC contains no readable items.

The source text consists of unreadable encoded characters. No meeting topics, proposals, or decisions can be identified from the provided document.

amarilloeconomic-development
Mon Aug 29, 2022 · 14:00

Colonies Public Improvement District Advisory Board

Consideration of landscape maintenance specifications and a management contract

The Colonies PID Advisory Board will discuss ongoing improvement maintenance items. The board will also consider approving landscape maintenance specifications for Bid #7319 and a management contract for maintenance and operations activities.

landscapemaintenancecontractspidamarillo
Thu Aug 25, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Consideration of the Pavilion at the Santa Fe Depot Project

The Board will consider a project for the Pavilion at the Santa Fe Depot in Holland’s Addition. The meeting also includes a discussion regarding a Comprehensive Plan Update.

landmarkshistoric-districtsdowntown-designplanning
Thu Aug 25, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Consideration of the Pavilion at the Santa Fe Depot Project

The Board will consider a project for the Pavilion at the Santa Fe Depot located in Holland’s Addition. The meeting also includes a discussion regarding the Comprehensive Plan Update.

landmarkshistoric-districtsdowntown-designplanningsanta-fe-depot
Wed Aug 24, 2022 · 08:30

Civil Service Commission

Appointment of new commission member and review of eligibility registers

The Civil Service Commission will consider appointing a new member to the commission. The meeting includes reviewing employee updates such as promotions, transfers, and disciplinary actions. The commission will also review eligibility registers for Fire District Chief and Police Recruit positions.

civil-servicepolicefirepersonnelappointments
Wed Aug 24, 2022 · 08:30

Amarillo Convention and Visitors Bureau

ACVB Board to discuss arts committee structural changes

The Amarillo Convention and Visitors Bureau Board will review financial reports and minutes from July 27, 2022. The meeting includes a presentation by Smith Travel Research and a discussion regarding changes to the ACVB Arts Committee structure.

tourismartsfinancetravel-research
Mon Aug 22, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

Board to discuss 2022/2023 budget and elect new officers

The Board will review quarterly financials as of June 30, 2022, and discuss the 2022/2023 District Budget. The meeting also includes the election of officers and consideration of a lease addendum with the Amarillo Tri-State Exposition.

budgetfinanceelectionsleasingamarillo-national-center
Thu Aug 18, 2022 · 07:30

Amarillo Hospital District Board of Managers

Finance Committee to consider 2022/2023 Amarillo Hospital District budget

The Finance Committee will consider the Amarillo Hospital District budget for the 2022/2023 fiscal year. The committee will also discuss a recommended funding increase for specialized pediatric services through Texas Tech University Health Sciences Center.

budgethealthcarepediatricspensionpublic-health
Thu Aug 18, 2022 · 07:30

Amarillo Hospital District Finance Committee

Committee to consider 2022/2023 budget and pediatric service funding increase

The committee will discuss the Amarillo Hospital District Budget for the 2022/2023 fiscal year. Members will also consider a recommendation to increase funding for Texas Tech University Health Sciences Center pediatric services. Additionally, staff will present on local suicide prevention efforts and a retirement plan actuarial report.

budgethealthcarepediatricspensionpublic health
Thu Aug 18, 2022 · 12:00

One Time Event

The East Gateway TIRZ Board will consider the FY2022-23 annual budget.

The Tax Increment Reinvestment Zone #2 Board of Directors is meeting to discuss the FY2022-23 annual budget. The board will also consider approving minutes from the July 21, 2022 meeting.

budgetfinanceeast-gatewaytax-increment
Thu Aug 18, 2022 · 12:00

One Time Event

The East Gateway TIRZ #2 Board will consider the FY2022-23 annual budget.

The East Gateway TIRZ #2 Board of Directors is meeting to discuss the FY2022-23 annual budget. The board will also review and approve minutes from the July 21, 2022, meeting.

budgetfinancetax-increment-reinvestment-zone
Wed Aug 17, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided meeting agenda contains no readable information

The text for the August 17, 2022, Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numeric data. No specific items, decisions, or discussions can be identified from the source provided.

firemen-retirement-fundamarillo
Wed Aug 17, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Review of 2022-2023 budget and parking garage rate recommendations

The Board will consider the 2022-2023 fiscal year budget and recommendations for parking garage rate structures. Updates on Hodgetown, Embassy Suites, and the Parking Garage/Retail Space projects are also scheduled. Additionally, the Board will discuss a rental request from the Panhandle Adult Rebuilding Center.

budgetparkingdevelopmentfinance
Tue Aug 16, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $16.3 million for water reclamation facility upgrades

The council will review gun violence trends and progress on the Partners for Development project. Members will also consider several contract awards for airport maintenance, vehicle purchases, and IT infrastructure.

waterairportpoliceinfrastructuretechnologybudget
Mon Aug 15, 2022 · 10:00

Planning and Zoning Commission

The Commission will review several subdivision plats and a rezoning request.

The Planning and Zoning Commission will consider four new subdivision plats and one rezoning request. The commission will also discuss a proposed zoning plan for the annexation of 44.26 acres near Soncy Road.

zoningplatsrezoningannexationland-use
Fri Aug 12, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The Advisory Board will consider landscape maintenance specifications for Bid #7319.

The Colonies PID Advisory Board is meeting to discuss ongoing improvement maintenance and future agenda items. The board will also consider approving landscape maintenance specifications for Bid #7319 and a management contract for maintenance and operations administrative responsibilities.

maintenancelandscapingcontractspid
Thu Aug 11, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to consider FY2022-23 annual budget and 2022 investment policy

The Center City Tax Increment Reinvestment Zone #1 Board will discuss the FY2022-23 annual budget and the 2022 investment policy. The meeting also includes updates on downtown projects and next steps for a wayfinding project.

budgetfinancedowntowninfrastructure
Thu Aug 11, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to consider FY2022-23 annual budget and 2022 investment policy

The Center City Tax Increment Reinvestment Zone #1 Board of Directors will discuss the FY2022-23 annual budget and the 2022 investment policy. The meeting also includes updates on downtown Amarillo projects and next steps for a wayfinding project.

budgetinvestmentdowntownwayfindingamarillo
Wed Aug 10, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

Review of the 2022/23 Budget and 5-Year Service Plan

The Heritage Hills Advisory Board will consider recommendations for the 2022/23 Budget and 5-Year Service Plan. The meeting also includes discussions regarding phase 3 landscape improvements and ongoing PID operations and maintenance.

budgetlandscapinginfrastructurepublic improvement district
Wed Aug 10, 2022 · 13:30

One Time Event

Parks & Recreation Board to review minutes and receive various program updates

The Parks & Recreation Board will consider approving the minutes from the July 13, 2022, meeting. The board will also receive progress reports on several city services, including aquatics, the zoo, and park maintenance.

parksrecreationzooaquaticscity-government
Tue Aug 9, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will consider Mural Grant Program rule amendments and deadline extensions.

The Beautification and Public Arts Advisory Board will discuss updates on various projects, including the Library Mural and Thompson Park. The meeting includes consideration of Mural Grant Program rule amendments and reimbursement deadline extensions. The board will also hold an election for a Vice-Chair.

muralgrantspublic-artsbeautification
Tue Aug 9, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

Tutbury PID Advisory Board to consider 2022/23 budget and service plan

The board will review the minutes from the June 3, 2022, meeting. Members will also discuss ongoing operations and maintenance for the district and consider recommendations for the 2022/23 budget and a five-year service plan.

budgetmaintenanceoperationsplanning
Mon Aug 8, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee to discuss bike master plan and walkability improvements

The committee will review the minutes from the June 13, 2022, meeting. Members will also receive an update on the Bike Master Plan and a presentation regarding the process for acquiring right of way for future bike trails. Additionally, the group will discuss ways to improve walkability in Amarillo.

pedestrianbicyclewalkabilitytransportationamarillo
Mon Aug 8, 2022 · 15:00

Library Advisory Board

Library Advisory Board to discuss departmental issues and library activities

The Library Advisory Board will review the minutes from its June 13, 2022 meeting. The Director of Library Services will present on departmental issues, including programming and library events. The board will also hear updates regarding the East Branch and Downtown Library.

libraryprogrammingpublic-servicesamarillo
Thu Aug 4, 2022 · 19:00

Amarillo Area Public Health Board

The meeting agenda contains only unreadable numerical sequences.

The provided agenda for the Amarillo Area Public Health Board dated August 4, 2022, consists of numerical strings that do not form readable English text. No specific items, discussions, or decisions can be identified from the source document.

procedural
Tue Aug 2, 2022 · 13:00

Amarillo City Council

Council considers $50 million aerospace development incentive

The Amarillo City Council is reviewing the proposed tax rate for the 2022/2023 fiscal year. The agenda includes incentive agreements for Albers Aerospace and Austin Hose involving significant capital improvements. The council will also consider several rezoning ordinances and various city contracts.

economic-developmentzoningtax-ratebudgetcontracts
Mon Aug 1, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission to elect leaders and review seven plat applications

The commission will hold elections for a Chairman and Vice Chairman. The meeting includes the consideration of seven plat applications for various additions and subdivisions. Additionally, the commission will review one rezoning request near Wichita Ave. and Mirror St.

zoningplatelectionland-useamarillo
Thu Jul 28, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to discuss FY2022-23 budget and Wayfinding Project next steps

The Board will review the FY2022-23 annual budget and the 2022 investment policy. The meeting also includes discussions on the Wayfinding Project and updates regarding projects at Santa Fe Depot.

budgetinvestmentwayfindingsanta-fe-depotamarillo
Thu Jul 28, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board to discuss FY2022-23 annual budget and investment policy

The Board will review the FY2022-23 annual budget and consider the 2022 Investment Policy. The meeting also includes discussions on next steps for the Wayfinding Project and updates on projects at the Santa Fe Depot.

budgetinvestmentwayfindinginfrastructure
Wed Jul 27, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Review of 2022.23 CVB operating budget and final audit report

The Amarillo Convention and Visitors Bureau Board will review the 2022.23 operating budget and a final audit report. The board is also scheduled to approve minutes from the June 22, 2022 meeting.

budgetaudittourismfinance
Tue Jul 26, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers purchasing up to 15,768 acres of groundwater rights

The Amarillo City Council will review several ordinances regarding rezoning and annexation. The agenda also includes consideration of an $11,100,000 settlement agreement and the potential purchase of groundwater rights in Roberts County.

groundwaterzoningbudgetcontractspublic-worksannexation
Mon Jul 25, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

The provided agenda text is unreadable

The meeting agenda for the Amarillo Economic Development Corporation Board of Directors on July 25, 2022, consists of unreadable numeric sequences. No specific items, discussions, or decisions can be identified from the provided source.

unreadable
Thu Jul 21, 2022 · 12:00

One Time Event

Discussion of the FY2022-23 East Gateway TIRZ #2 annual budget

The East Gateway TIRZ #2 Board will discuss the FY2022-23 annual budget and the 2022 investment policy. The board is also scheduled to approve minutes from the May 19, 2022 meeting.

budgetfinanceinvestmenttirez
Thu Jul 21, 2022 · 12:00

One Time Event

Discussion of the FY2022-23 annual budget for East Gateway TIRZ

The East Gateway TIRZ Board will discuss the FY2022-23 annual budget. The board is also scheduled to consider the 2022 Investment Policy and approve minutes from the May 19, 2022 meeting.

budgetfinanceinvestment-policytax-increment-reinvestment-zone
Wed Jul 20, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda text contains no readable information.

The source document for the July 20, 2022, Amarillo Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numerical sequences. No specific decisions, proposals, or items can be identified from the provided text.

unreadableprocedural
Wed Jul 20, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Review of 2022-2023 fiscal year budget and parking garage agreements

The Board will discuss the 2022-2023 fiscal year budget and consider the 2022 Investment Policy. The meeting also includes updates on Hodgetown, Embassy Suites, and parking garage retail space.

budgetdevelopmentparkinginvestmentamarillo
Wed Jul 20, 2022 · 14:00

Colonies Public Improvement District Advisory Board

Board to consider 2022/23 Budget and 5-Year Service Plan recommendations

The Colonies PID Advisory Board will discuss ongoing maintenance items and landscape maintenance specifications for Bid #7319. The board will also consider recommendations for the 2022/23 Budget and a 5-Year Service Plan.

budgetmaintenancelandscapingpidamarillo
Mon Jul 18, 2022 · 10:00

Planning and Zoning Commission

Commission to discuss proposed 44-acre annexation near SW 34th Ave.

The Planning and Zoning Commission will consider a plat for Chaparral Hills Unit No. 12 near Western St. and Big Horn Trl. The commission will also discuss the proposed annexation of a 44.26 acre tract at SW 34th Ave. and Sony Rd.

zoningannexationplatland-use
Fri Jul 15, 2022 · 13:00

Amarillo City Council

The July 15, 2022, Amarillo City Council agenda contains unreadable text

The provided agenda text consists of numeric sequences and does not contain legible information regarding meeting items or decisions. The record appears to be corrupted or contains only unreadable data.

unreadableprocedural
Thu Jul 14, 2022 · 13:00

Amarillo City Council

No readable agenda information available

The provided text for the July 14, 2022, Amarillo City Council meeting consists of unintelligible numeric sequences and contains no readable details regarding decisions or discussions.

unreadable
Thu Jul 14, 2022 · 16:00

Zoning Board of Adjustment

Zoning Board to consider setback variance for 2213 S Hughes Street

The Amarillo Zoning Board of Adjustment will meet to approve minutes from the May 12, 2022 meeting. The board will also consider a request to reduce rear and side yard setbacks at 2213 S Hughes Street.

zoningvarianceland-use
Wed Jul 13, 2022 · 13:00

Amarillo City Council

No readable agenda items are present in the provided text

The document for the July 13, 2022, Amarillo City Council meeting contains only numerical sequences and does not provide any readable information regarding proposed or decided actions.

procedural
Wed Jul 13, 2022 · 13:30

One Time Event

Amarillo Parks & Recreation Board to review various city projects and updates

The Parks & Recreation Board will discuss several ongoing municipal projects and department reports. This includes reviewing the minutes from the June 8, 2022 meeting. The board will also receive updates on items such as the Martin Road Complex and the Botanical Gardens.

parksrecreationbudgetinfrastructurepublic-arts
Tue Jul 12, 2022 · 10:00

Airport Advisory Board

No readable agenda items found for the July 12, 2022 meeting

The provided text for the Amarillo Airport Advisory Board contains unreadable numeric sequences. No specific decisions, discussions, or proposals can be identified from the source document.

amarilloairport-advisory-board
Tue Jul 12, 2022 · 11:30

Beautification and Public Arts Advisory Board

Board to discuss mural grant reimbursements and project updates

The Beautification and Public Arts Advisory Board will review minutes from the June 14, 2022 meeting. Members will receive reports on the Apache Tree Grant, budget status, and temporary art reimbursements. The board will also consider action on mural grant reimbursement invoices.

artsbudgetgrantsbeautification
Tue Jul 12, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $5,343,549 in transit grants and several rezoning requests

The council will consider applications for $5,343,549.00 in federal and state grants for Amarillo City Transit. The agenda also includes public hearings for land annexation and multiple zoning changes. Additionally, the council will review several contract awards for city equipment and furniture.

transitzoningannexationcontractspublic-hearing
Mon Jul 11, 2022 · 10:00

Pinnacle Public Improvement District Advisory Board

Pinnacle PID Advisory Board to consider 2022/23 Budget and 5-Year Service Plan

The Pinnacle Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetpidoperationsmaintenanceplanning
Wed Jul 6, 2022 · 10:00

Planning and Zoning Commission

Commission to consider rezoning 8.29 acres from Agricultural to Residential District 3

The Planning and Zoning Commission will review two rezoning applications and a subdivision replat. The meeting also includes a work session for updates on cases previously sent to City Council.

zoningrezoningland-usehousingamarillo
Tue Jun 28, 2022 · 13:00

Amarillo City Council

The provided agenda text for Amarillo City Council is unreadable

The source document consists of numerical sequences and does not contain readable text, names, or descriptions of meeting items.

unreadable
Tue Jun 28, 2022 · 13:00

Amarillo City Council

City Council considers $2 million AT&T broadband contract

The Amarillo City Council will consider a $2 million contract for fiber broadband internet service through the Amarillo Connected Broadband Project. The agenda also includes public hearings regarding rezoning requests and a utility franchise agreement. Additionally, several infrastructure repairs and vehicle purchases are scheduled for approval.

broadbandzoningutilitiesinfrastructurepublic-works
Mon Jun 27, 2022 · 13:00

Amarillo City Council

No readable agenda items found for June 27, 2022 meeting

The provided text for the Amarillo City Council meeting contains no readable English content or identifiable agenda items. The source consists of unreadable numerical data.

unavailableunreadableno-content
Fri Jun 24, 2022 · 10:00

Vineyards Public Improvement District Advisory Board

Review of Vineyards PID 2022/23 Budget and 5-Year Service Plan

The Vineyards Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider recommendations for the 2022/23 Budget and a 5-Year Service Plan.

budgetpidoperationsplanning
Wed Jun 22, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Discussion of the Civic Center Project

The Amarillo Convention and Visitors Bureau Board will review financial and audit reports. The meeting also includes a discussion regarding the Civic Center Project.

tourismcivic-centerfinancemarketingamarillo
Wed Jun 22, 2022 · 10:00

Pinnacle Public Improvement District Advisory Board

The board will consider recommending the 2022/23 Budget and 5-Year Service Plan

The Pinnacle PID Advisory Board is meeting to discuss ongoing operations and maintenance. The board will also consider making a recommendation regarding the 2022/23 Budget and 5-Year Service Plan.

budgetpidoperationsplanning
Wed Jun 22, 2022 · 10:00

Point West Public Improvement District Advisory Board

Review of 2022/23 Budget and 5-Year Service Plan for Pinnacle PID

The Pinnacle Public Improvement District Advisory Board will discuss ongoing operations and maintenance. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetoperationsplanningpid
Tue Jun 21, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

Board to discuss fairgrounds project revisions and event development payments

The Board will review the status of fiscal year 2021-2022 projects at the Tri-State Fairgrounds and consider revisions to the project list. Discussion includes event development payments for the Amarillo Limousine Show and the Amarillo Tri-State Fair. The agenda also covers quarterly financials and an update on the Civic Center project.

fairgroundseventsfinancebudgetcivic-center
Tue Jun 21, 2022 · 14:00

Quail Creek Public Improvement District Advisory Board

The board will consider the 2022/23 budget and a five-year service plan.

The Quail Creek PID Advisory Board will discuss the 2022/23 budget and a five-year service plan for recommendation. The meeting also includes discussions regarding ongoing district operations and maintenance.

budgetoperationsmaintenanceplanning
Mon Jun 20, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning Commission to review subdivision, rezoning, and annexation requests

The Planning and Zoning Commission will consider several land use applications, including a new subdivision and two rezoning cases. The commission will also discuss a preliminary plan for the 224.59-acre Homestead project and a proposed zoning plan for a large annexation.

zoningsubdivisionrezoningannexationland-use
Mon Jun 20, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Unreadable agenda text for Amarillo Economic Development Corporation

The provided text for the June 20, 2022, meeting contains only unreadable numeric characters. No legible information regarding specific agenda items, decisions, or discussions is present in the source.

unreadableagendaamarillo
Fri Jun 17, 2022 · 13:00

Amarillo City Council

The provided meeting agenda contains no readable information or identifiable items

The source text consists of numeric sequences and placeholders rather than legible English. No specific decisions, proposals, or discussions can be identified from this record.

amarilloproceduralunreadable
Wed Jun 15, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The June 15, 2022, meeting agenda contains no readable text.

The provided agenda text consists of numerical sequences that do not contain legible English information. No specific items, decisions, or discussions can be identified from the source document.

unreadable
Tue Jun 14, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will review mural grant reimbursements and various project updates.

The Beautification and Public Arts Advisory Board will consider approving minutes from the May 10, 2022 meeting. Members will also receive updates on several projects, including Xcel Junction Box and Mural Plaques. Additionally, the board will discuss action regarding mural grant reimbursement invoices.

artbeautificationgrantsmuralscity-projects
Tue Jun 14, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $1.58 million pavilion for Santa Fe Depot

The Amarillo City Council will consider several rezoning requests and contract awards, including infrastructure upgrades for the airport and Santa Fe Depot. The meeting includes updates on homeless services and the Amarillo Broadband Project. Additionally, the council will review economic development agreements for senior housing.

zoninghousinginfrastructurebudgethomelessnessaviation
Mon Jun 13, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee to discuss process for acquiring right of way for future bike trails

The committee will review minutes from the April 11, 2022 meeting. Members will also discuss improving walkability in Amarillo and receive an update on Six Pack Outdoors. A presentation regarding the process for acquiring right of way for future bike trails is scheduled.

bicyclepedestriansafetytrailswalkability
Mon Jun 13, 2022 · 15:00

Library Advisory Board

Library Advisory Board to review library services and departmental updates

The Library Advisory Board will review departmental activities, including updates on the Mobile Hotspot Lending Program and Seed Library. The board will also consider approving minutes from the April 11, 2022 meeting. A presentation regarding North Branch activities is scheduled.

librarypublic-servicesprogramming
Fri Jun 10, 2022 · 10:00

Point West Public Improvement District Advisory Board

Point West PID Advisory Board to discuss 2022/23 Budget and 5-Year Service Plan

The board will consider recommending the 2022/23 Budget and a 5-Year Service Plan. The meeting also includes discussions regarding ongoing maintenance items for the district.

budgetmaintenanceplanningpublic-improvement-district
Thu Jun 9, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Board to consider 2022/23 Budget and 5-Year Service Plan

The board will discuss the 2022/23 Budget and 5-Year Service Plan for recommendation. Other discussions include Scott Park drainage issue reimbursement and contractor criteria for Greenways projects.

budgetinfrastructuremaintenancepublic-worksdrainage
Wed Jun 8, 2022 · 13:30

One Time Event

Parks & Recreation Board to consider approval of athletic complex study

The Parks and Recreation Board will meet to discuss several park projects and updates. The board will consider action on the athletic complex study and review minutes from the May 11, 2022 meeting. Updates are scheduled for the Martin Road Complex, Rick Klein Field Renovation, and 9th Street Trails.

parksrecreationinfrastructurebudgetpublic-forum
Tue Jun 7, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will consider the 2022/23 budget and a 5-year service plan

The Colonies PID Advisory Board will meet to discuss ongoing maintenance items and approve minutes from May 27, 2022. The board will also consider recommending the 2022/23 Budget and 5-Year Service Plan.

budgetmaintenanceplanningpublic-improvement-district
Mon Jun 6, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

The board will consider a change order for phase 2 landscape improvements.

The Heritage Hills Public Improvement District Advisory Board will meet to approve May 23, 2022 minutes and discuss a change order for Bid 7106 regarding phase 2 landscape improvements. The meeting also includes discussion of future agenda items.

landscapeinfrastructurepublic-improvement-district
Mon Jun 6, 2022 · 10:00

Planning and Zoning Commission

Commission to consider residential to office rezoning and new subdivision plats

The Amarillo Planning and Zoning Commission will meet on June 6, 2022. The agenda includes reviews of subdivision plats, a rezoning request for Coulter Acres, and a public right-of-way vacation.

zoningplatsrezoningland-useamarillo
Mon Jun 6, 2022 · 13:00

Town Square Public Improvement District Advisory Board

Consideration of 2022/23 Budget and 5-Year Service Plan for Town Square PID

The Advisory Board will discuss ongoing operations and maintenance for the Town Square Public Improvement District. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetmaintenanceplanningpublic-improvement-district
Fri Jun 3, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

The board will consider the 2022/23 budget and a five-year service plan.

The Tutbury PID Advisory Board will discuss ongoing operations and maintenance for the district. The meeting includes consideration of recommendations for the 2022/23 budget and a five-year service plan.

budgetoperationsmaintenanceplanning
Fri May 27, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will discuss the landscape maintenance contract and potential termination

The Colonies Public Improvement District Advisory Board will discuss a landscape maintenance contract and consider its termination. The meeting also includes a review of ongoing PID improvement maintenance items.

landscapemaintenancepidpublic-improvement
Wed May 25, 2022 · 08:30

Amarillo Convention and Visitors Bureau

The board will review April hotel performance and summer staff activities.

The Amarillo Convention and Visitors Bureau Board will meet to approve minutes from April 27, 2022, and review financial reports. The agenda includes presentations regarding National Travel and Tourism Week and upcoming summer staff activities.

tourismhospitalityfinancial-reportcommunications
Wed May 25, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Board to consider parking garage rates and agreements

The Board will review project updates for Hodgetown, Embassy Suites, and the Parking Garage and Retail Space. Members will consider ratifying the 2022 Sod Poodles Parking Garage Agreement and discuss future parking garage rate structures. Discussion is also scheduled regarding Potter County’s agreement for spaces in the parking garage.

parkingdevelopmentinfrastructurebudget
Tue May 24, 2022 · 07:30

Amarillo Hospital District Board of Managers

Board to hold public hearing on mandatory health provider assessments

The Board will conduct a public hearing and consider a resolution regarding the LPPF Mandatory Payment Assessment rate for the fiscal year ending August 31, 2022. Members will also review annual financial audits and quarterly investment performance reports.

hospitalfinanceaudittaxinvestment
Tue May 24, 2022 · 13:00

Amarillo City Council

Council considers economic incentives and various city contracts

The Amarillo City Council is reviewing incentive agreements for industrial projects, including Producer Owned Beef, LLC. The agenda also includes rezoning requests and several contracts for police vehicles and utility maintenance.

zoningeconomic-developmentpoliceutilitiespublic-works
Mon May 23, 2022 · 10:00

Heritage Hills Public Improvement District Advisory Board

Heritage Hills PID Advisory Board to consider 2022/23 Budget and Service Plan

The board will consider recommendations for the 2022/23 Budget and a 5-year Service Plan. Members will also discuss a change order for Bid 7106 phase 2 landscape improvements. Additionally, the meeting includes discussions on ongoing district operations and maintenance.

budgetlandscapingmaintenanceoperations
Thu May 19, 2022 · 12:00

One Time Event

Discussion of East Gateway TIRZ #2 project plans and financing

The East Gateway TIRZ #2 Board will discuss the final project and financing plan, City Economic Development Guidelines, and TIF policy and procedures. The board is also scheduled to receive the audit for the period ending September 30, 2021.

financeauditeconomic-developmentamarillo
Thu May 19, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to discuss project financing plan and policies

The East Gateway TIRZ Board will meet to approve minutes from March 31, 2022 and receive the September 30, 2021 audit. The board is also scheduled to discuss the final project and financing plan along with TIF policy and procedures.

financeauditeconomic-developmentzoning
Wed May 18, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

No readable agenda items were found for the May 18, 2022 meeting

The provided text for the Firemen's Relief and Retirement Fund Board of Trustees contains only numeric sequences. No identifiable decisions or discussions are present in the record.

proceduralunreadable
Mon May 16, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider rezoning for an asphalt or concrete batching plant

The Planning and Zoning Commission will review four rezoning applications. These include requests for an asphalt or concrete batching plant, a manufactured home district, and changes to commercial and development districts.

zoningland-usehousingcommercialindustrial
Mon May 16, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Meeting agenda text is unreadable

The provided text for the Amarillo Economic Development Corporation Board of Directors meeting contains only numeric strings and symbols. It is not possible to identify any specific items, decisions, or discussions from this record.

unreadable
Thu May 12, 2022 · 16:00

Zoning Board of Adjustment

The board will consider a setback variance for a monument sign.

The board will review the minutes from the April 14, 2022 meeting. They will also consider a request to reduce front and side yard setbacks for a monument sign at 4301 Ridgecrest Circle.

zoningvariancesignageland-use
Wed May 11, 2022 · 13:30

One Time Event

Parks & Recreation Board to review minutes and project updates

The Parks & Recreation Board will consider approving the minutes from the April 13, 2022 meeting. The board will also receive reports regarding staff, budget, athletic lighting, playgrounds, and a Senior Services RFP.

parksbudgetsenior-servicesrecreation
Wed May 11, 2022 · 17:00

Animal Management & Welfare Advisory Board

Board to discuss animal management activity, staffing, and adoption updates

The Amarillo Animal Management & Welfare Advisory Board will review reports on department activity, staffing, and community outreach. The board will also consider approving minutes from the February 23, 2022 meeting.

animal-welfarecity-governmentpublic-commentdepartment-updates
Tue May 10, 2022 · 13:00

Amarillo City Council

Amarillo Council considers new tax abatement zones for commercial and industrial use

The council will hold public hearings on creating two new tax abatement zones. They are also considering amendments to the sidewalk cost-share program and various city contracts for infrastructure and services.

zoningtax-abatementinfrastructureutilitiespublic-works
Thu May 5, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Board discusses updates to Center City TIRZ #1 project and financing plan

The Board of Directors will consider updates to the Center City TIRZ #1 Final Project and Financing Plan. The meeting also includes receiving the September 30, 2021 audit and receiving updates on specific projects.

financeaudithousingplanningzoning
Thu May 5, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

The Board will discuss updates to the Center City TIRZ #1 project and financing plan

The Board of Directors will review the September 30, 2021 audit for TIRZ #1. The meeting includes discussions regarding updates to the final project and financing plan. Updates on the Wayfinding Project and a housing study are also scheduled.

auditfinancehousingzoning
Mon May 2, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission to consider several rezoning requests

The commission will review multiple rezoning applications and a new plat for Hillside Terrace Estates. These items include changes to residential, agricultural, and office districts across various locations. A work session will also provide updates on previous cases.

zoningrezoninghousingland-usedevelopment
Mon May 2, 2022 · 14:00

Tutbury Public Improvement District Advisory Board

Review of Tutbury PID 2022/23 budget and 5-year service plan

The Advisory Board will discuss ongoing operations and maintenance for the Tutbury Public Improvement District. The board will also consider a recommendation for the 2022/23 Budget and 5-Year Service Plan.

budgetpidoperationsmaintenance
Wed Apr 27, 2022 · 08:30

Amarillo Convention and Visitors Bureau

ACVB Board to discuss staff attendance and the Great Outdoors Fund

The Amarillo Convention and Visitors Bureau Board will review financial reports and minutes from March 23, 2021. The meeting includes discussions regarding the Cross Bar, The Great Outdoors Fund, and staff attendance for the Texas Association of CVBs.

tourismbudgetcommitteetexas
Tue Apr 26, 2022 · 13:00

Amarillo City Council

City Council considers $1.1 million contract for Polk St. Streetscape Improvements

The Amarillo City Council will consider several zoning changes, land annexations, and various service contracts. This includes a public hearing on the annexation of 77.29 acres in Randall County. The council will also discuss federal funding programs like the Infrastructure Investment and Jobs Act.

zoningannexationinfrastructurebudgetpublic hearingutilitiescybersecurity
Mon Apr 25, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The PID Advisory Board will discuss the 2022/23 budget and tree care maintenance.

The Colonies Public Improvement District Advisory Board will meet to discuss the 2022/23 Budget and 5-Year Service Plan. The board will also consider a recommendation for a landscape maintenance agreement regarding tree care. Additionally, members will discuss ongoing maintenance items and a budget amendment.

budgetmaintenancelandscapingpublic-improvement-district
Thu Apr 21, 2022 · 08:30

Civil Service Commission

Civil Service Commission to consider firefighter exam appeals and personnel updates

The commission will review appeals filed by firefighters regarding specific questions on the Fire Driver exam. The meeting also includes consideration of a new commission member appointment and the police recruit eligibility register. Additionally, the body will review various personnel actions including promotions, transfers, and disciplinary actions.

policefirepersonnelappointmentscivil-service
Thu Apr 21, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Discussion of 2022/23 Budget and 5-Year Service Plan

The board will discuss the 2022/23 budget, a five-year service plan, and potential budget amendments. Members will also consider the dedication of Parcel R-370-0390-0001.0 to the City or PID.

budgetinfrastructureland-use
Thu Apr 21, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Board considers design variances for First Baptist Church Project

The Board will consider design variances regarding walkways, building edges, and signage for the First Baptist Church Project near Harrison St. and SW 12th Ave. This project includes a parking garage and church facility. The board will also approve minutes from the February 24, 2022 meeting.

zoningdowntowndevelopmentsignage
Thu Apr 21, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Design variances for the First Baptist Church Project

The Board will consider design variances for the First Baptist Church Project near Harrison St. and SW 12th Ave. These involve walkways, building edges, and signage. The meeting also includes approval of February 24, 2022, meeting minutes.

zoningdowntownlandmarksdevelopment
Wed Apr 20, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

No readable agenda items were found for the April 20, 2022 meeting

The provided text for the Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numeric sequences. No substantive information regarding decisions or discussions is present in the record.

amarillofiremen-relief-and-retirement-fundboard-meeting
Mon Apr 18, 2022 · 10:00

Planning and Zoning Commission

The Commission will discuss a 244.97 acre annexation and four subdivision plats

The Planning and Zoning Commission will consider four subdivision plat applications in Randall and Potter Counties. The commission will also hold a discussion regarding the proposed annexation of a 244.97 acre tract.

zoningsubdivisionsannexationplanning
Mon Apr 18, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

No readable agenda items are present in the provided text

The document for the April 18, 2022, Amarillo Economic Development Corporation meeting contains only unreadable numeric sequences. No specific decisions, projects, or discussions can be identified from this record.

amarilloeconomic-development
Thu Apr 14, 2022 · 16:00

Zoning Board of Adjustment

The Zoning Board of Adjustment will consider two side yard setback variances.

The Zoning Board of Adjustment will meet to consider two requests for side yard setback reductions. The board will also review the minutes from the December 9, 2021 meeting.

zoningvarianceland-useamarillo
Wed Apr 13, 2022 · 13:30

One Time Event

Parks & Recreation Board to discuss park ordinances and various project updates

The Parks & Recreation Board will meet to receive reports on several ongoing projects and maintenance. The board will also consider approving minutes from the March 9, 2022, meeting. Discussion topics include ordinance updates and a financial sustainability plan.

parksrecreationordinanceproject-updatespublic-art
Tue Apr 12, 2022 · 10:00

Airport Advisory Board

Unreadable agenda text for Amarillo Airport Advisory Board

The provided source text consists of undecipherable numerical sequences and does not contain readable English content. No specific items, decisions, or discussions can be identified from the record.

unreadable
Tue Apr 12, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will review project updates and consider mural grant reimbursements.

The Beautification and Public Arts Advisory Board will discuss several project updates, including the Park Education Signage Campaign. The board will also consider action on mural grant reimbursements for submitted invoices.

beautificationpublic-artparksgrantssignage
Tue Apr 12, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $1.3 million airport recapitalization contract

The council will discuss updates on Earth Day, residential housing studies, and zoning revisions. Proposed actions include rezoning property in Miller Heights and approving various equipment purchases for police, public works, and IT. Several resolutions regarding state funding for local events are also on the agenda.

zoningairportpoliceinfrastructurebudgetpublic-works
Mon Apr 11, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Election of 2022 Chair and Vice Chair for the committee

The Pedestrian and Bicycle Safety Advisory Committee will elect a chair and vice chair for the 2022 calendar year. The meeting also includes a review of Not Just Bikes videos and an update on Six Pack Outdoors.

pedestrianbicyclesafetyelectionleadership
Mon Apr 11, 2022 · 15:00

Library Advisory Board

The Board will consider a mobile hotspot borrowing agreement.

The Library Advisory Board will review updates to the policy for unattended children and consider an agreement for mobile hotspot borrowing through the FCC's Emergency Connectivity Fund. The meeting also includes a report on departmental activities and programming.

librarypolicytechnologypublic-services
Thu Apr 7, 2022 · 12:00

Advisory Committee for People with Disabilities

Advisory Committee for People with Disabilities to elect leaders and review transit plans

The committee will hold elections for Chair and Vice Chair positions. Members will also discuss committee duties and brainstorm projects for disability awareness. Amarillo City Transit staff will present updates on transit projects and the city's transit safety plan.

disabilitiestransitelectionspublic-safetyamarillo
Mon Apr 4, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider a Wolflin Terrace replat and a retail rezoning request

The Planning and Zoning Commission is scheduled to review a plat for Wolflin Terrace Unit No. 3 and a rezoning request for a 1.40 acre tract. The meeting also includes the approval of previous meeting minutes.

zoningplatrezoningretailamarillo
Thu Mar 31, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to consider developer agreement at 7580 East Interstate 40

The East Gateway TIRZ Board of Directors will meet to discuss a developer agreement with ATC Realty Investment, LLC for a project located at 7580 East Interstate 40. The board will also review minutes from the March 17, 2022 meeting.

tirzdevelopmentreal estate
Thu Mar 31, 2022 · 12:00

One Time Event

The board will consider a developer agreement for 7580 East Interstate 40.

The East Gateway TIRZ Board of Directors will hold a special meeting on March 31, 2022. The board will discuss a developer agreement with ATC Realty Investment, LLC for a project at 7580 East Interstate 40. The agenda also includes approval of minutes from the March 17, 2022, meeting.

developmentreal estatetax increment reinvestment zone
Tue Mar 29, 2022 · 08:30

Amarillo-Potter Events Venue District Board of Directors

The Board will consider budget amendments and event trust fund requests.

The Board will review annual and quarterly financial reports and consider budget amendments for Civic Center projects. They will also discuss requests from CMSA and USTPA to participate in the Event Trust Fund for October 2022 events.

budgetfinancecivic-centerfairgroundseventsamarillo-potter
Mon Mar 28, 2022 · 15:00

Planning and Zoning Commission

Proposed revisions to Amarillo zoning and subdivision ordinances will be considered.

The Planning and Zoning Commission is holding a special meeting to consider proposed revisions to the City of Amarillo Zoning and Subdivision Ordinances. The applicant for these revisions is the City of Amarillo.

zoningsubdivisionordinance
Fri Mar 25, 2022 · 08:30

Civil Service Commission

The Commission will approve the Police Captain eligibility register.

The Civil Service Commission will review minutes from the March 16, 2022, meeting. The body will also consider various personnel actions, including promotions and disciplinary actions. Additionally, the Commission will review the eligibility register for the Police Captain position.

policepersonnelcivil-serviceamarillo
Wed Mar 23, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Amarillo Convention and Visitors Bureau Board to consider arts marketing grants

The Amarillo Convention and Visitors Bureau Board will review arts organization marketing grants. The agenda also includes an update on the Route 66 Centennial and a discussion regarding the Founders Book. Staff will provide reports on sales and servicing.

tourismartsmarketingroute-66finance
Tue Mar 22, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Provided agenda text for March 22, 2022 meeting is unreadable

The provided source document consists of an unintelligible sequence of numbers and symbols. No specific items, decisions, or discussions can be identified from the text.

unreadableno-contentnon-textual
Tue Mar 22, 2022 · 13:00

Amarillo City Council

City Council considers $7 million bond issuance for park and recreational lighting

The Amarillo City Council will consider several rezoning requests and infrastructure contracts, including utility relocations for a future City Hall. The agenda also includes public hearings on the city's Comprehensive Plan and a $7 million bond issuance for park lighting.

zoningbudgetinfrastructureparkspublic-works
Mon Mar 21, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning to review city ordinance revisions and rezonings

The Planning and Zoning Commission will consider proposed revisions to the City of Amarillo Zoning and Subdivision Ordinances. The agenda includes reviews of two plats, P-22-15 and P-22-18. Additionally, the Commission will discuss rezoning requests for South Side Acres Unit No. 20 and Johnson and McCluskey Addition.

zoningland-useordinancesplatsamarillo
Thu Mar 17, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to appoint Vice Chair and discuss future items

The East Gateway TIRZ Board of Directors will meet to approve minutes from the February 17, 2022, meeting. The agenda includes the appointment of a Vice Chair. The Board may also convene in executive session to discuss an economic development incentive request within the TIRZ #2 boundary.

tax-increment-reinvestment-zoneeconomic-developmentappointmentsamarillo
Thu Mar 17, 2022 · 12:00

One Time Event

Potential discussion of economic development incentives for East Gateway TIRZ #2

The Board will meet to approve minutes from the February 17, 2022 meeting and appoint a Vice Chair. The Board may also convene in executive session to discuss an economic development incentive request within the TIRZ #2 boundary.

economic-developmenttax-increment-reinvestment-zoneappointments
Wed Mar 16, 2022 · 08:30

Civil Service Commission

Civil Service Commission to review Police Captain exam appeal by Lt. Shane Chadwick

The Civil Service Commission will meet to approve minutes from the January 5, 2022 meeting and review various personnel actions. The commission will also consider the firefighter eligibility register and an appeal regarding a police captain written examination.

policefirefighterpersonnelcivil-serviceexaminations
Wed Mar 16, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

Meeting agenda content is unreadable from the provided text

The provided text for the Firemen's Relief and Retirement Fund Board of Trustees meeting consists of numeric sequences that do not contain legible information regarding items to be discussed or decided.

amarillofiremen-relief-and-retirement-fund
Thu Mar 10, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Discussion of drainage fees and lot assessments for Greenways at Hillside PID

The Greenways at Hillside PID Advisory Board will discuss City of Amarillo drainage fees and possible related actions. The board will also consider Class C and D lot assessments, developer reimbursement, and a budget amendment.

drainagefeesbudgetassessmentsdevelopment
Wed Mar 9, 2022 · 13:30

One Time Event

Proposed special event fee changes and subcommittee appointments

The Parks & Recreation Board will consider proposed changes to special event fees. The board will also discuss appointing members to the Strategic Planning and Outreach subcommittees. Additionally, officials will provide updates on playgrounds.

parksrecreationfeessubcommitteeplanningoutreach
Tue Mar 8, 2022 · 11:30

Beautification and Public Arts Advisory Board

The board will discuss Bloomberg Foundation opportunities and beautification projects.

The board will review minutes from the February 8, 2022 meeting. Members will also discuss potential beautification project ideas and opportunities through the Bloomberg Foundation.

public-artbeautificationamarillo
Tue Mar 8, 2022 · 13:00

Amarillo City Council

City Council considers $1.9 million contract for sewer main rehabilitation

The City Council will review ordinance updates regarding food hygiene inspections and towing fees. The agenda includes several contract awards for police uniforms, park maintenance, and public health services. A public hearing is also scheduled for the Five-Year Community Investment Program.

zoninginfrastructurebudgetpublic healthpoliceutilities
Mon Mar 7, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning to consider adopting the Eastridge Neighborhood Plan

The Commission will consider several rezoning requests and new land plats. Members will also review the adoption of the Eastridge Neighborhood Plan as an amendment to the city's Comprehensive Plan. The meeting includes a work session to review agenda items and project updates.

zoningplanninghousingland-useamarillo
Wed Mar 2, 2022 · 11:30

Amarillo Local Government Corporation Board of Directors

Amarillo Local Government Corporation Board to elect officers and review projects

The Board will elect new officers for one-year terms and appoint members to a standing committee. Staff will provide updates on the Hodgetown, Embassy Suites, and Parking Garage and Retail Space projects. The meeting also includes a presentation of quarterly financials.

developmentgovernmentfinanceparkingretail
Tue Mar 1, 2022 · 07:30

Amarillo Hospital District Board of Managers

Board considers pension plan amendments and actuarial contract updates

The Board will consider amending an actuarial contract with Arthur J. Gallagher & Co. regarding pension risk transfer services. They will also discuss amendments to the retirement plan for Northwest Texas Healthcare System employees. Additionally, a member will be appointed to the TIRZ #1 Board.

pensionhealthcarecontractretirement
Thu Feb 24, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Discussion on the Polk Street Streetscape Project

The Board of Review will hold a presentation and discussion regarding the Polk Street Streetscape Project. The meeting also includes the nomination and election of a Chairman and Vice Chairman.

downtownstreetscapelandmarksplanning
Thu Feb 24, 2022 · 17:30

Board of Review for Landmarks, Historic Districts, and Downtown Design

Presentation and discussion on the Polk Street Streetscape Project

The Board of Review will hold a presentation and discussion regarding the Polk Street Streetscape Project. The meeting also includes the election of a Chairman and Vice Chairman.

landmarksdowntown-designpolk-streetpublic-meeting
Wed Feb 23, 2022 · 17:00

Animal Management & Welfare Advisory Board

The Board will elect a Chair and Vice Chair for 2022.

The board will conduct elections for leadership positions and consider approving minutes from October 6, 2021. Members will also receive updates on department staffing, veterinary services, and adoption programs.

animal-managementelectionsveterinary-servicesadoptiondepartment-updates
Tue Feb 22, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Meeting agenda text is unreadable

The provided document for the Amarillo Economic Development Corporation meeting on February 22, 2022, consists of non-textual numeric characters and contains no readable information regarding decisions or discussions.

unreadable
Tue Feb 22, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers several rezonings and various municipal contracts

The Amarillo City Council will review updates from advisory boards and discuss the Five-Year Community Investment Program. The agenda includes second and final readings for multiple land rezoning ordinances. The council will also consider several contract awards for public health grants, police equipment, and park maintenance.

zoningpoliceparksbudgetpublic-healthinfrastructure
Mon Feb 21, 2022 · 10:00

Planning and Zoning Commission

The commission will consider several subdivision plats and rezoning requests.

The Amarillo Planning and Zoning Commission is reviewing six plat applications for various subdivisions. The meeting also includes consideration of three rezoning requests to change properties to the General Retail District.

zoningplatssubdivisionretailamarillo
Thu Feb 17, 2022 · 12:00

One Time Event

The East Gateway TIRZ Board will review quarterly financials and discuss future goals

The Tax Increment Reinvestment Zone #2 Board of Directors is meeting to approve minutes from August 26, 2021, and appoint a Vice Chair. The agenda also includes a presentation of quarterly financials and a discussion regarding current and future goals for the East Gateway TIRZ.

financegovernanceeast-gateway-tirzamarillo
Thu Feb 17, 2022 · 12:00

One Time Event

East Gateway TIRZ Board to review financials and discuss future goals

The East Gateway TIRZ Board of Directors will meet to review quarterly financial reports and discuss current and future goals for the zone. The board also intends to appoint a Vice Chair and approve minutes from the August 2021 meeting.

financegovernanceeast-gateway-tirzamarillo
Wed Feb 16, 2022 · 08:30

Amarillo Convention and Visitors Bureau

Review and possible action on the 2022 Strategic Plan

The Amarillo Convention and Visitors Bureau Board will meet to discuss several organizational updates. The agenda includes a review of the 2022 Strategic Plan and an update regarding The Great Outdoors Fund. The board will also review the EOY Smith Travel Research Report.

tourismstrategic-plantravel-researchfinance
Wed Feb 16, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided agenda contains no readable text for review.

The meeting agenda for the Amarillo Firemen's Relief and Retirement Fund Board of Trustees consists of unreadable numeric sequences. No specific items, decisions, or discussions can be identified from the provided text.

amarillofiremen-retirement-fund
Mon Feb 14, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Committee to review accident maps and public education ideas

The committee will consider approving minutes from the November 15, 2021, meeting. Agenda items include a safety presentation featuring accidents on a map and a discussion regarding educational ideas for the public. The committee will also welcome a new member and report on current vacancies.

safetyeducationcommittee-updatespedestrian-safetybicycle-safety
Mon Feb 14, 2022 · 15:00

Library Advisory Board

Amarillo Library Advisory Board discusses potential Seed Library partnership

The board will consider electing a Chair and Vice-Chair. Members will also discuss a potential partnership with the Randall County Master Gardener Board to create a Seed Library at the Downtown Library.

librarygardeninggovernmentelectionspublic-meetings
Sun Feb 13, 2022 · 11:00

Pedestrian and Bicycle Safety Advisory Committee (sunset)

Election of committee chair and vice chair for the 2023 calendar year

The committee will consider electing a chair and vice chair for 2023 and approving minutes from December 12, 2022. Members will also receive updates on bike trail right-of-way availability, the TXDOT loop, and walkability in Amarillo.

bikingwalkingtransportationamarillocommittee
Thu Feb 10, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Discussion of Polk Street Streetscape Project and regional organizations

The Board will review quarterly financials and approve minutes from the December 13, 2021 meeting. The agenda includes discussions regarding the Polk Street Streetscape Project and Neighborhood Empowerment Zones. Additionally, the Board will discuss Ports-to-Plains and TEX-21 Organizations.

infrastructurefinanceamarillostreetscape
Thu Feb 10, 2022 · 12:00

Center City Tax Increment Reinvestment Zone #1 Board of Directors

Discussion of Polk Street Streetscape Project and quarterly financials

The Board will review quarterly financial reports and approve minutes from the December 13, 2021 meeting. The agenda also includes discussions regarding the Polk Street Streetscape Project and Neighborhood Empowerment Zones.

financestreetscapedevelopmentneighborhood-empowerment
Wed Feb 9, 2022 · 13:30

One Time Event

Amarillo Parks and Recreation Board to consider special event fee changes

The board will review minutes from the January 12, 2022 meeting and discuss several ongoing park projects. The agenda also includes consideration of proposed changes to special event fees.

parksrecreationfeespublic-policy
Tue Feb 8, 2022 · 11:30

Beautification and Public Arts Advisory Board

Board to consider FY22 mural grant awards and discuss park art pads

The board will review the January 11, 2022, meeting minutes and consider recommendations for FY22 Mural Grant Project Awards. Members will also discuss Bloomberg Foundation opportunities and Art Pads installed in several city parks.

muralgrantspublic-artparksbeautification
Tue Feb 8, 2022 · 13:00

Amarillo City Council

Council considers economic development agreement for new Buc-ee's travel center

The Amarillo City Council will discuss the 311 Project and progress on the City Hall project. The agenda includes economic development agreements for a new Buc-ee's travel center and Horizon Ag Products. Several contract awards for airport equipment, waste collection, and public health marketing are also up for consideration.

zoningeconomic-developmentbudgetinfrastructurepublic-healthaviation
Mon Feb 7, 2022 · 10:00

Planning and Zoning Commission

Commission to consider 313.75-acre Mesquite Ridge West preliminary plan

The Amarillo Planning and Zoning Commission will review several subdivision plats and rezoning requests. The agenda includes the 313.75-acre Mesquite Ridge West preliminary plan and various changes to residential and retail districts.

zoningsubdivisionrezoningdevelopmenthousing
Thu Feb 3, 2022 · 12:00

Advisory Committee for People with Disabilities

The Feb 3, 2022, Advisory Committee for People with Disabilities meeting was cancelled

The scheduled meeting of the Advisory Committee for People with Disabilities was cancelled due to a lack of quorum. The planned agenda included the election of leadership and presentations regarding Amarillo City Transit.

disabilitytransitamarillogovernment
Wed Feb 2, 2022 · 14:00

Colonies Public Improvement District Advisory Board

The board will consider a landscape maintenance agreement addendum for tree care.

The Colonies PID Advisory Board will discuss ongoing improvement maintenance items. The meeting also includes consideration of a recommendation for a landscape maintenance agreement addendum regarding tree care.

landscapingmaintenancetree-carepublic-improvement-district
Tue Feb 1, 2022 · 07:30

Amarillo Hospital District Board of Managers

Amarillo Hospital District to discuss pension risk transfer and indigent care agreement

The Board of Managers will elect officers and review quarterly investment performance. The meeting includes discussions regarding the Indigent Care Agreement and options for pension risk transfer services.

pensionfinancehealthcareindigent-careboard-election
Thu Jan 27, 2022 · 13:00

Amarillo City Council

The provided agenda contains no readable information.

The text for the January 27, 2022, Amarillo City Council meeting consists of encoded numeric strings and does not contain legible items or discussions. The document contains only unreadable data rather than procedural boilerplate or substantive items.

amarillocity council
Thu Jan 27, 2022 · 15:00

Planning and Zoning Commission

Discussion of the Zoning and Subdivision Ordinance Revision Project

The Amarillo City Council and Planning and Zoning Commission will receive updates on the ongoing Zoning and Subdivision Ordinance Revision project. This is an informational meeting for presentation and public comment. No votes or decisions will be taken during this session.

zoningsubdivisionordinanceplanning
Wed Jan 26, 2022 · 08:30

Amarillo Convention and Visitors Bureau

The January 26, 2022, Amarillo Convention and Visitors Bureau meeting was cancelled.

The scheduled meeting of the Amarillo Convention and Visitors Bureau Board was cancelled due to a winter weather event. No agenda items were discussed or decided.

amarillomeeting cancellationwinter weathertourism
Wed Jan 26, 2022 · 17:00

Animal Management & Welfare Advisory Board

The January 26 Animal Management & Welfare Advisory Board meeting was cancelled.

The scheduled meeting for the Amarillo Animal Management & Welfare Advisory Board was cancelled due to a lack of quorum or potential severe weather. The agenda included elections for Chair and Vice Chair and several department updates.

animal-welfareelectionsdepartment-updatesamarillo
Tue Jan 25, 2022 · 13:00

Amarillo City Council

AEDC considers $6.6 million purchase of 1,329 acres at US Hwy 60 and Parsley Road

The City Council will discuss funding options for repairing athletic field lighting, including potential bond issuances totaling up to $16 million. The agenda also includes a public hearing for a new tax abatement zone and several zoning changes. Additionally, the council will consider various contract awards for software, equipment, and architectural services.

zoningbudgeteconomic-developmentpublic-workspolice
Thu Jan 20, 2022 · 19:00

Amarillo Area Public Health Board

The Amarillo Area Public Health Board agenda contains no readable text

The provided agenda text consists of unreadable numeric sequences. No specific items, decisions, or discussions can be identified from the source document.

proceduralunreadable
Wed Jan 19, 2022 · 10:00

Firemen's Relief and Retirement Fund Board of Trustees

The provided meeting agenda contains no readable content

The source document for the Firemen's Relief and Retirement Fund Board of Trustees meeting consists of unreadable numerical sequences. No specific items, decisions, or discussions can be identified from the provided text.

procedural
Wed Jan 19, 2022 · 10:00

Planning and Zoning Commission

Amarillo Planning and Zoning Commission to review multiple rezoning requests

The commission will consider several rezoning requests involving residential, retail, and moderate density districts. The agenda also includes reviews of multiple plats and a utility easement vacation. A work session is scheduled to discuss previous cases and upcoming agenda items.

zoningrezoningplatsland-useamarillo
Wed Jan 19, 2022 · 11:00

Amarillo Economic Development Corporation Board of Directors

Unreadable agenda text for January 19, 2022 meeting

The provided document for the Amarillo Economic Development Corporation Board of Directors contains only unreadable numeric sequences. No specific items, decisions, or discussions can be identified from the record.

unreadableprocedural
Wed Jan 12, 2022 · 10:00

Greenways Public Improvement District Advisory Board

Discussion of City of Amarillo drainage fees and PID budget calculations

The Greenways at Hillside Public Improvement District Advisory Board will discuss the history of City of Amarillo drainage fees and potential actions regarding them. The board will also review commercial acreage calculations for the PID Budget and five-year service plan.

drainagebudgetmaintenance
Wed Jan 12, 2022 · 13:30

One Time Event

The Parks & Recreation Board will elect a Chairman and Vice Chairman.

The Parks & Recreation Board will elect a Chairman and Vice Chairman for one term. The board will also consider appointing members to the Strategic Planning and Outreach sub-committees. Updates are scheduled for several projects, including the Zoo Disposition Policy and Sports Complex Study.

parkselectionssubcommitteezoosportsplanning
Tue Jan 11, 2022 · 10:00

Airport Advisory Board

Airport Advisory Board discusses various terminal repairs and infrastructure projects

The Airport Advisory Board will vote on updated art policies and meeting minutes. The board will also hear presentations regarding several airport maintenance and infrastructure projects.

aviationinfrastructuremaintenanceairportpublic-works
Tue Jan 11, 2022 · 11:30

Beautification and Public Arts Advisory Board

The Board will consider electing officers and reallocating funds for staff support.

The Beautification and Public Arts Advisory Board will meet to elect a Chair and Vice-Chair. The meeting includes discussions on reallocating funds for a full-time staff member and updates on the FY22 Mural Grant Project and art pads in city parks.

artsstaffingbudgetparksgrants
Tue Jan 11, 2022 · 13:00

Amarillo City Council

Amarillo City Council considers $10.8 million contract for Martin Road Lake improvements

The Amarillo City Council will consider several contracts and ordinances during this meeting. Items include a $10.8 million project for Martin Road Lake and incentives for the Mateen Bar USA manufacturing facility. The council will also hold public hearings on a nocturnal curfew ordinance and various rezoning requests.

zoningbudgetpublic-safetyinfrastructureeconomic-development
Wed Jan 5, 2022 · 08:30

Civil Service Commission

Civil Service Commission to review police and fire department personnel updates

The Civil Service Commission will elect a chairman and vice-chairman for the year. The commission will also review employee changes, including promotions and disciplinary actions. Additionally, it will consider approving eligibility registers for Police Sergeant and Fire Lieutenant positions.

policefirepersonnelcivil-serviceamarillo
Mon Jan 3, 2022 · 10:00

Planning and Zoning Commission

The Commission will consider rezoning an 8.49-acre tract to General Retail District

The Planning and Zoning Commission will elect a Chairman and Vice Chairman. The agenda includes reviewing two plat applications for South Georgia Place and Spring Lake. Additionally, the commission will consider rezoning an 8.49-acre tract at Hillside Rd. and Nancy Ellen St.

zoningplatsrezoningland-use