The Boring PartsFederalLocal · USLocal · Canada
Charleston, South Carolina

Charleston public meetings in 2025

822 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 29, 2025

Design Review Board

Design Review Board reviews commercial roofing at 2070 Sam Rittenberg Blvd

The Design Review Board is reviewing a single staff approval item. The meeting focuses on a commercial TPO re-roof project.

commercial-propertyroofingdesign-review
Mon Dec 29, 2025

Board of Architectural Review

Fire station temporary bay, historic house renovations among staff-approved plans

This agenda lists 14 quick plan reviews approved by BAR staff between Dec 29-31, 2025. Items include a new temporary apparatus bay for Fire Station 2 & 3 (city-owned, eligible for fee waiver), renovations to historic single houses at 122 and 124 Cannon Street, and various residential exterior changes. No board discussion or public hearing is scheduled.

architectural-reviewquick-plan-reviewfire-stationhistoric-preservationconstructionpaintingroofingcharleston
Mon Dec 22, 2025

Design Review Board

Design Review Board considers three quick plan approvals

This Design Review Board meeting consists solely of staff-level quick plan reviews for three items: a mechanical mini-split installation and two sign installations. No public hearings or policy decisions are on the agenda.

design-reviewquick-plan-reviewsignsmechanicalstaff-approvals
Mon Dec 22, 2025

Commission on Women

Commission on Women to receive Mamava update

The Commission on Women will meet to approve previous minutes and hear a guest presentation. The session includes a scheduled update from Paige Feeser regarding Mamava.

women-affairscommunity-servicespublic-meeting
Mon Dec 22, 2025

Board of Architectural Review

Staff approves 22 quick-plan reviews for exterior alterations and signs

This agenda lists 22 quick-plan reviews approved by BAR staff for work ranging from roof replacements and paint jobs to new signs and pool installations at various Charleston properties. No board discussion or public hearing is scheduled; the items are procedural staff approvals.

architectural-reviewpermitshistoric-districtsignageconstructionstaff-approvals
Thu Dec 18, 2025

Technical Review Committee

TRC to review 136-room hotel, mixed-use development, and subdivisions

The Charleston Technical Review Committee will review ten site plans and subdivision plats, including a proposed 136-room hotel at 804 Orleans Road, a mixed-use development with 200 units at 578 Meeting Street, and several residential and commercial projects. The meeting also covers revisions to previously approved plans and road construction in the Long Savannah area.

site-planssubdivisionshotelmixed-useresidentialcommercialroad-construction
Thu Dec 18, 2025

Technical Review Committee

Technical Review Committee to review 10 site and subdivision plans

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans. The body is evaluating several new developments and revisions to previously approved plans across West Ashley, the Peninsula, James Island, and Johns Island.

zoningsite-planssubdivisionsroadshousingcommercial-development
Thu Dec 18, 2025

Recreation Committee

Recreation Committee to receive parks and recreation updates

The Recreation Committee will meet to introduce new commission members. The session includes presentations providing updates on recreation and parks.

parksrecreationcity-government
Wed Dec 17, 2025

Planning Commission

Planning Commission to consider nine zoning requests in West Ashley

The Planning Commission will review zoning requests for nine properties, primarily in West Ashley. These requests include designating land for business park use and single-family residential use. One rezoning request for 1757 Main Road has been deferred.

zoningwest-ashleyland-useresidential
Wed Dec 17, 2025

Planning Commission

Planning Commission to review multiple zoning requests in West Ashley

The Planning Commission will consider nine zoning requests, primarily for single-family residential designations in West Ashley. The body will also address the approval of minutes from the November meeting.

zoningwest-ashleyresidentialland-use
Wed Dec 17, 2025

Planning Commission

Planning Commission approves 9 zoning changes, defers 1 rezoning

The Planning Commission approved zoning for 10 parcels, including a Business Park zoning on Savage Road and single-family residential zoning for eight properties in West Ashley. One rezoning request on Main Road in Johns Island was deferred before the meeting. The commission also approved minutes from the previous meeting.

zoningplanning-commissionwest-ashleyjohns-islandrezoningssingle-family-residentialbusiness-park
Tue Dec 16, 2025

City Council

City Council to amend zoning for dozens of parcels across West Ashley and Johns Island

The council will consider a series of ordinances to change the zoning classification of multiple parcels, including conservation, general business, and single‑family residential designations. It will also act on stormwater funding, including a $1.5 million grant with a required $500,000 match and a $5 million grant application. Additional items include annexation proposals for several West Ashley properties and discussion of affordable housing at Morrison Drive.

zoningstormwatergrantsannexationhousing
Tue Dec 16, 2025

City Council

Ways and Means committee to vote on $5M drainage grant, conservation easement

The City Council's Committee on Ways and Means will consider approval of the amended 2026 Stormwater Utility Fund budget, accept a $1.5M grant for Central Park Drainage, authorize a $5M grant application for Cooper-Jackson Drainage, approve a swim team lease, and support a conservation easement resolution up to $3M. Several items were expedited from other committees due to time constraints.

stormwatergrantsdrainagebudgetconservationrecreationreal-estatefinance
Tue Dec 16, 2025

Board of Zoning Appeals Zoning

Board will consider a one‑year extension for a residential office at 1477 Theresa Dr.

The Charleston Board of Zoning Appeals will review minutes from its December 2 meeting and consider a slate of new applications. Most items request one‑year extensions of vested rights, special exceptions, or variances for residential and mixed‑use properties. The board will vote on each request during the December 16 meeting.

zoningextensionsvariancesspecial-exceptionresidentialcommercial
Tue Dec 16, 2025

Board of Zoning Appeals Zoning

Board to consider four vested-rights extensions for variances and special exceptions

The Board of Zoning Appeals will consider approval of December 2 meeting minutes and four requests for first one-year extensions of vested rights. The extensions cover previously granted use variances and special exceptions for properties on Theresa Drive, Meeting Street, Savannah Highway, and Morrison Drive. All are first extensions and do not involve new variances or exceptions.

zoningvariancesspecial-exceptionsboard-of-zoning-appealscharlestonvested-rights
Tue Dec 16, 2025

Board of Zoning Appeals Zoning

Zoning board approves most variance requests, defers four items

The Board of Zoning Appeals met December 16, 2025, and decided on 16 applications. It approved nine requests including extensions of vested rights and variances for setbacks and lot coverage. Four items were deferred prior to the meeting, two withdrawn, and one special exception was approved while the associated variance was deferred.

zoningvariancesspecial-exceptionboard-of-zoning-appealscharlestonland-useparkingaccommodation-use
Tue Dec 16, 2025

Board of Zoning Appeals Zoning

Board to consider variance for 7 multi-family units at 211 Rutledge Ave with reduced parking

The Charleston Board of Zoning Appeals – Zoning will hold a public hearing on four variance requests and one special exception. They will decide on a request to build seven multi-family units at 211 Rutledge Ave with reduced lot area per unit and fewer parking spaces, opposed by 39 residents. Also up for decision: a special exception for an accommodation use at 216-218 King St, opposed by the Harleston Village Association, and three other variance requests for lot coverage, a sign, and a porch addition.

zoningpublic-hearingvariancesspecial-exceptionmulti-familyaccommodation-usecharlestonboard-of-zoning-appeals
Tue Dec 16, 2025

Board of Zoning Appeals Zoning

BZA to consider hotel use on King St. and setback exception on Drake St.

The Board of Zoning Appeals is reviewing two special exception requests. One involves the establishment of a 13-unit accommodations use on King Street, and the other concerns a residential addition on Drake Street.

zoningaccommodationssetbackshousing
Tue Dec 16, 2025

Traffic and Transportation Committee

Traffic committee to vote on Safe Streets for All Safety Action Plan

The Traffic and Transportation Committee will consider adopting the Safe Streets for All Safety Action Plan, which includes a Target Zero commitment to reduce traffic fatalities and serious injuries by 20% by 2035. The committee will also receive updates on the Folly Road/Maybank Highway/Harborview Road traffic signal timing project and the Sam Rittenberg Blvd redesign plan, and vote on a maintenance agreement for Old Towne Road/Sam Rittenberg.

transportationtraffic-safetyroad-designsignal-timingmaintenance-agreementpublic-workssafety-action-plan
Mon Dec 15, 2025

Design Review Board

Design Review Board reviews seven staff approvals for signs and renovations

The Design Review Board is processing staff approvals for various commercial projects. These items include signage installations, roof replacements, and building renovations.

design-reviewcommercial-developmentsignagerenovationsinfrastructure
Mon Dec 15, 2025

Public Works and Utilities Committee

Committee to consider $5M grant for Cooper Jackson drainage project

The Public Works and Utilities Committee will consider approving a $5 million grant application for the Cooper Jackson Drainage Project and a $1.5 million grant for Central Park Drainage Improvements. They will also discuss an ordinance to amend stormwater management standards for redevelopment and accept rights-of-way for Skye Road. The agenda includes a list of 22 temporary encroachments and a memorandum for third-party stormwater review fees.

drainagestormwatergrantspublic-worksrights-of-wayencroachmentsordinanceinfrastructure
Mon Dec 15, 2025

City Council

Committee on Real Estate to consider $3 million conservation easement

The Committee on Real Estate will discuss a resolution to support a grant application for a conservation easement on the Dill property. The committee will also consider seven property annexations in West Ashley.

real-estateconservationannexationwest-ashleyjames-island
Mon Dec 15, 2025

Board of Architectural Review

BAR staff to review 44 quick plan items, including historic building addition at 1 Henrietta St

This agenda lists 44 staff-level architectural review approvals scheduled between December 15 and December 19, 2025. Items include routine residential fences, roof replacements, interior renovations, and a major historic building renovation at 1 Henrietta Street involving modifications to a historic storefront and a new three-story addition. All items are quick plan reviews handled by staff, with no public hearings or board votes.

architecturebar-staff-approvalscharlestonhistoric-preservationquick-plan-reviewrenovationszoning
Fri Dec 12, 2025

Commission on Disability Issues

Disability commission to review retail visit handout, plan 2026 topics

The Commission on Disability Issues will hear public comment, approve past meeting minutes, and discuss scheduling topics for 2026 led by Ron Faretra. Members will also review and update the one-page handout for visits to retail establishments and restaurants. The ADA Coordinator will give a report.

disability-issuesadapublic-commentminutesmeeting-agenda
Thu Dec 11, 2025

Human Affairs and Racial Conciliation Commission

HARCC to discuss hate crime, First Amendment ordinances and housing

This meeting of the Human Affairs and Racial Conciliation Commission includes public participation, approval of prior minutes, and updates from the chair and manager. Under old business, commissioners will discuss the HARCC Ordinance, Coming Street Commons, youth initiatives, unhoused/rapid/affordable housing, and public safety items including a First Amendment Ordinance and a Hate Crime Ordinance. No new business or final decisions are specified on the agenda.

racial-conciliationordinanceshousingpublic-safetyhate-crimeyouth-initiativesmeeting
Thu Dec 11, 2025

Technical Review Committee

TRC to review roundabout, subdivisions, and bank plan

The Technical Review Committee will consider five site and subdivision plans, including a roundabout conversion at Seven Farms Drive on Daniel Island, a 42-lot conservation subdivision on Thomas Island, a preliminary plat and road plans for a 50-lot single-family development in Long Savannah, and a new bank on Morrison Drive. These are technical reviews, not final approvals.

zoningsubdivisionsroad-constructionroundaboutconservation-developmentsingle-familywest-ashleydaniel-island
Thu Dec 11, 2025

Technical Review Committee

TRC reviews 50-lot Long Savannah Phase 2 subdivision and road plans

The Technical Review Committee will review five items: a 42-lot conservation development on Thomas Island, a new bank at 1070 Morrison Drive, a roundabout conversion at Seven Farms Drive, and preliminary plat and road construction plans for the 50-lot Long Savannah Neighborhood 7 Phase 2 in West Ashley. These are technical reviews, not final approvals; outcomes include 'No Return/Paperwork Comments' and 'Revise and Return'.

site-planssubdivisionsroad-constructionconservation-developmentsingle-family-housingcommercial-developmentroundaboutwest-ashley
Thu Dec 11, 2025

Board of Architectural Review

BAR considers new policies for solar panels, EV chargers, and fencing in historic districts

The Board of Architectural Review – Small will review 15 applications for changes to historic properties, including demolition, new construction, additions, and appeals of staff decisions. The board will also consider proposed revisions to policies for alternative energy (solar panels and EV chargers) and for freestanding walls and fencing in historic districts. Public comment is accepted in person or by written submission.

historic-preservationarchitectural-reviewsolar-panelselectric-vehicle-chargersfencingcharlestonpublic-hearing
Thu Dec 11, 2025

Board of Architectural Review

Board reviews demolition request for 221 Grove Street historic home

The Board will consider three applications: demolition of exterior elements at 221 Grove Street in Council District 6; conceptual approval for a new single‑family dwelling with added height at 21 Reid Street in Council District 4; and conceptual approval for a single‑family dwelling at 188 ½ Coming Street in Council District 4. Each item includes applicant presentations and design documents. No decisions have been recorded yet.

historic-preservationzoningnew-constructiondemolitiondesign-review
Thu Dec 11, 2025

Board of Architectural Review

Board approves demolition of exterior elements at 221 Grove Street

The Board of Architectural Review approved the minutes from the November 13 meeting with conditions. It granted approval for the demolition of exterior elements at 221 Grove Street. Several applications were deferred, including conceptual approval for new construction at 21 Reid Street and for projects at 188 ½ Coming Street, 244 Ashley Avenue, and 21 Council Street. Other projects received approval with conditions, such as the restoration at 122 Logan Street and additions at 59 Gibbes Street and 4 Savage Street.

historic-preservationdemolitionresidentialarchitecturezoning
Thu Dec 11, 2025

Board of Architectural Review

BAR-S considers conceptual approval for Charleston Day School restoration at 122 Logan Street

The Board of Architectural Review – Small will review 14 applications, mostly for conceptual approvals of modifications to historic structures. Items include restoration of the former Fielding Funeral Home for Charleston Day School, residential additions, flood elevation projects, and an appeal of a staff decision at 64 America Street.

historic-preservationarchitectural-reviewconceptual-approvalflood-elevationdemolitioncharlestonold-city-district
Thu Dec 11, 2025

Community Development

Ordinance to create Small Business Enterprise and Human Affairs Commission

The committee will discuss an amended ordinance to create a Small Business Enterprise program and restructure the Human Affairs and Racial Conciliation Commission into a Human Affairs Commission, ensuring compliance with federal and state law. They will also consider approving the minutes from the November 20, 2025, meeting.

community-developmentordinancewomen-minority-business-enterprisesmall-business-enterprisehuman-affairs-commission
Wed Dec 10, 2025

Special Events Committee

Special Events Committee reviews 2026 parade and festival applications

The committee is discussing event permits for 2026, including parades and stadium concerts. Members are also reviewing an after-action report for the Food and Wine Classic and discussing the formalization of 2026 policies and SOPs.

eventspermitsparadespublic-safetytourism
Wed Dec 10, 2025

Board of Architectural Review

BAR-L to consider policy revisions on solar, fences, and hardscaping

The Board of Architectural Review – Large will review applications for new construction, demolition, and alterations in Charleston's historic districts, and consider revisions to policies on alternative energy, freestanding walls/fences, and hardscaping. A conceptual approval for a mixed-use affordable housing building at 474 Meeting Street has been withdrawn by the applicant.

historic-preservationzoningsolar-energyfencingdemolitionaffordable-housingcharleston
Wed Dec 10, 2025

Board of Architectural Review

BAR to review mockup panel for new building at 230 Saint Philip St

The Board of Architectural Review will consider a request from Greystar to approve a mockup panel for new construction (Courier Square Phase II, Building 04) at 230 Saint Philip Street. The board will also vote on minutes from the November 12, 2025 meeting.

architectural-reviewnew-constructionmockup-panelcannonborough-elliottboroughcharleston
Wed Dec 10, 2025

Board of Architectural Review

Board approves demolition of 474 Meeting Street for Star Gospel Mission redevelopment

The Board of Architectural Review approved full demolition of a non-historic building at 474 Meeting Street owned by Star Gospel Mission, with conditions to salvage architectural elements. The board also approved preliminary designs for two new residential structures at 89.5 and 91.5 Nassau Street as part of a multi-phase affordable housing plan, and approved revisions to several BAR policies and guidelines. An application for a new mixed-use affordable housing building at 474 Meeting Street was withdrawn by the applicant.

architectural-reviewdemolitionaffordable-housinghistoric-districtcharlestonbar-policiesnew-construction
Wed Dec 10, 2025

Board of Architectural Review

BAR to review exterior repairs at historic Robert Mills Manor housing complex

The Board of Architectural Review – Large will consider six applications, including a full demolition at 474 Meeting Street, new residential construction at 89.5 and 91.5 Nassau Street, and exterior alterations at the historic Robert Mills Manor public housing complex. One item for a mixed-use affordable housing building at 474 Meeting Street has been withdrawn by the applicant.

architectural-reviewhistoric-preservationhousingdemolitionnew-constructionpublic-housing
Tue Dec 9, 2025

Public Safety Committee

Police Dept. seeks approval for $93,150 subaward with FAVOR Lowcountry

The Public Safety Committee will decide on three police department items: accepting a $5,000 grant to combat underage drinking, applying for a $3,000 grant for the same purpose, and approving a $93,150 subaward with Faces and Voices of Recovery Lowcountry for services under the SCORF grant project.

policegrantsunderage-drinkingdrug-preventionrecovery-services
✓ Decided: Committee approved $93,150 subaward to FAVOR Lowcountry for opioid outreach

The Public Safety Committee approved the minutes from the October 21, 2025 meeting. It unanimously accepted a $5,000 FY25 Ernest E. Kennedy Center AET grant after the fact. The committee also unanimously approved submitting an application for a $3,000 FY26 Ernest E. Kennedy Center AET grant. Finally, it unanimously approved a subaward agreement with Faces and Voices of Recovery (FAVOR) Lowcountry for up to $93,150 to support the Charleston Police Department’s SCORF opioid‑outreach project.

Mon Dec 8, 2025

Design Review Board

Design Review Board reviews 9 staff-level plan approvals

The Design Review Board is reviewing a series of staff-level quick plan approvals for commercial construction, signage, mechanical work, retaining walls, demolition, and roofing. No major policy decisions or public hearings are on the agenda; all items are administrative permit reviews.

design-reviewcommercial-constructionsignsdemolitionstaff-approvals
Mon Dec 8, 2025

Board of Architectural Review

Board of Architectural Review processes 38 staff approvals for city projects

The Board of Architectural Review is reviewing a series of staff approvals for residential and commercial property modifications. These items include roofing replacements, exterior painting, and structural repairs across various city addresses.

zoninghistoric-preservationbuilding-permitsresidentialcommercial
Thu Dec 4, 2025

Technical Review Committee

TRC reviews 313-unit mixed-use project at 295 Calhoun St

The Technical Review Committee will review 13 site plans and subdivision applications, including a 313-unit mixed-use development at 295 Calhoun Street, two affordable housing projects, a Walmart expansion, and a new Johns Island recreation center. Items also include preliminary plats, road construction plans, and an early site package for a Long Savannah neighborhood. All reviews are conducted via Zoom.

site-planssubdivisionsaffordable-housingmixed-use-developmentwalmart-expansionrecreation-centertechnical-review-committee
Thu Dec 4, 2025

Technical Review Committee

Technical Review Committee to review 313-unit mixed-use at 295 Calhoun St

The Technical Review Committee will review 13 development proposals, including site plans, subdivisions, and road construction. Items include a 313-unit mixed-use project, an 88-unit affordable housing development, and a Walmart expansion. Most proposals are returning for revisions, with some receiving no-comment returns.

zoninghousingaffordable-housingdevelopmentsite-planssubdivisionsrecreation
Wed Dec 3, 2025

Board of Zoning Appeals Site Design

Board to hear variance requests for grand tree removals and buffer reductions

The Board of Zoning Appeals – Site Design will consider multiple applications seeking variances and special exceptions to allow removal of grand trees and reduce buffer widths. Items include a request at 2925 Maybank Hwy to remove 6 grand trees and reduce impervious setbacks near 8 trees, and at 3097 South Shore Dr. to remove one grand tree. Other sites include 103-107 Cannon St., 295 Calhoun St., and 1820 Wallace School Rd. The board will also review minutes from prior meetings.

zoningtreesvariancesspecial-exceptionsbuffer-requirementspublic-hearingcharleston
Wed Dec 3, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to review tree removal and setback requests

The Board of Zoning Appeals-Site Design will consider variance and special exception requests regarding the removal of grand trees and construction setbacks. The board will also vote on the approval of meeting minutes from August and November 2025.

zoningvariancestreessite-design
Wed Dec 3, 2025

Board of Zoning Appeals Site Design

Board approves tree removal and setback variance at 2925 Maybank Hwy with conditions

The Board of Zoning Appeals – Site Design deferred minutes from two prior meetings due to lack of quorum. It denied a variance to remove one grand tree at 3097 South Shore Dr. The board approved multiple tree-removal variances and special exceptions at five other sites, all with conditions including required tree planting and monetary contributions.

tree-removalvariancessite-designcharlestonzoning-boardtree-preservationconditions
Wed Dec 3, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to consider tree removal variances

The Charleston Board of Zoning Appeals will hear requests to remove multiple protected trees at two properties on Johns Island and the Battery Haig neighborhood. The board will also consider a variance to reduce construction setbacks near trees at the Johns Island site.

zoningtree-removalvarianceenvironmentpublic-hearingcharleston
Wed Dec 3, 2025

Commission on History

Commission to discuss markers for African burial ground and fallen police horse

The Commission on History will discuss updates on protecting burial remains under the YWCA at 106 Coming Street and consider a new marker for the Anson Street African Burial Ground. They will also discuss a proposal for a memorial marker for Moonshine, a police horse killed in 1994.

history-commissionmemorialsafrican-burial-groundpolice-horseshampton-parkywca-coming-streetpublic-art
✓ Decided: Commission adopts burial‑ground resolution for 106 Coming Street

The History Commission adopted a multi‑paragraph resolution urging the City to act as a respectful steward of the proposed burial ground at 106 Coming Street and to follow ethical and practical guidelines, with votes ranging from unanimous to not unanimous. The commission also approved a resolution recognizing Charleston as an America 250 showcase city and designating December 14 as Revolutionary War Victory Day, despite two members voting against and the chair abstaining. In addition, the commission unanimously tabled the Moonshine Marker item and approved item B1 from the September meeting.

Tue Dec 2, 2025

City Council

City Council to vote on $381 million appropriation for fiscal year 2026

City Council will hold public hearings to decide on the 2026 general and enterprise fund budgets, including a $381,004,157 appropriation. The body will also consider several large capital project contracts and the certification of two abandoned buildings on Cumberland Street.

budgetinfrastructurehousingtransportationpublic-works
✓ Decided: City Council unanimously gave first reading to four FY2026 funding ordinances

City Council voted unanimously to give a first reading to four ordinances related to the Municipal Accommodations Fee and the city’s FY2026 budget. The ordinances include two that distribute Municipal Accommodations Fee funds for fiscal year 2026, one that appropriates money to meet the city’s liabilities for the fiscal year ending Dec 31 2026 (as amended), and one that raises $381,004,157 for the fiscal year ending Dec 31 2026. The council also unanimously approved the minutes of the November 18 2025 meeting.

Tue Dec 2, 2025

City Council

Council to vote on $46M increase for Municipal Operations Complex project

The Ways and Means Committee is considering the 2026 budgets for the general fund, stormwater utility, hospitality fee, and state accommodations tax, plus several large capital contracts and change orders. Key items include a $46 million change order for the Municipal Operations Complex, a $1.67 million West Ashley Bikeway resurfacing contract, and multiple parking garage repair change orders.

budgetcapital-projectsstormwaterparkingbikewayannexationlowlinemunicipal-operations-complex
✓ Decided: Committee approved the 2026 General Fund and Enterprise Funds Budget (amended)

The Committee on Ways and Means unanimously approved the amended 2026 General Fund and Enterprise Funds Expenditure Budget, as well as the 2026 General Fund and Enterprise Funds Revenue Budget. It also approved the 2025 and 2026 Hospitality Fee Budgets, the State Accommodations Tax Budgets, the 2026 Stormwater Utility Fund Budget, municipal accommodations fee ordinances, and a $2,353,323 Stop Loss Insurance policy with Cigna. All items were adopted without dissent.

Tue Dec 2, 2025

Board of Zoning Appeals Zoning

BZA to weigh use variance for tattooing in GB zone on Stinson Drive

The Board of Zoning Appeals will consider nine applications, including a use variance for tattooing services at 535 Stinson Dr., a reduced lot coverage variance at 2510 Watercrest Ln. (40% proposed), and a subdivision frontage variance at 714 Swan Dr. with proposed frontages as low as 0 feet. Other items include setback variances and extensions of vested rights. One application at 170 Wentworth St. has been withdrawn.

zoningvariancesboard-of-zoning-appealsuse-variancelot-coveragesetbackscharleston
Tue Dec 2, 2025

Board of Zoning Appeals Zoning

Board to consider lot coverage variance for Johns Island home

The Board of Zoning Appeals will hear two variance/special exception requests and consider approving prior meeting minutes. The main item is a request to exceed the allowed lot coverage at 2510 Watercrest Ln on Johns Island, now proposed at 40% vs the 35% limit. Also up for hearing is a special exception to extend non-conforming side setbacks at 3 Saint Margaret St in Wagener Terrace for a rear addition.

zoningboard-of-zoning-appealsvarianceslot-coveragesetbacksspecial-exceptionsjohns-islandwagener-terrace
Tue Dec 2, 2025

Board of Zoning Appeals Zoning

Variance approved for 2510 Watercrest Ln to increase lot coverage to 40%

The Board of Zoning Appeals approved several variances and special exceptions for residential properties, including a lot‑coverage variance at 2510 Watercrest Ln. It also approved extensions of vested rights for two properties and granted various setbacks and accessory‑structure variances. One appeal was withdrawn by the applicant.

zoningvariancesspecial-exceptionsvested-rightsaccessory-structures
Tue Dec 2, 2025

Board of Zoning Appeals Zoning

Variance sought to subdivide lot with 0-foot frontage on Swan Dr.

The Board of Zoning Appeals – Zoning will hold a public hearing on December 2, 2025 to decide five variance and special exception requests. Items include setback reductions, vertical extensions of non-conforming structures, and a major lot frontage variance for a subdivision. Public comments have been submitted for all applications.

zoningvariancesspecial-exceptionspublic-hearingsboard-of-zoning-appealscharlestonsetbackssubdivision
Mon Dec 1, 2025

Design Review Board

Design Review Board to consider fire station mockup and commercial projects

The Design Review Board will review three applications for construction and design approvals. The board will also review the minutes from the October 6, 2025 meeting.

design-reviewcommercial-developmentpublic-safetyzoning
✓ Decided: Design Review Board approved mockup panel for new City Fire station

The board approved a mockup panel for the new City Fire station on Johns Island, voting 5‑0 in favor. It gave preliminary approval for Building 4 of the 606 Brooking Square project, also 5‑0. It granted preliminary approval for two one‑story buildings at 1791 Hickory Knoll Way, again 5‑0. The board also approved the minutes from the October 6 meeting, 5‑0.

Mon Dec 1, 2025

Design Review Board

Preliminary approval for new veterinary building at Point Hope

The Design Review Board will consider two items: approval of a completed mock-up panel for the Johns Island Fire Station #23 at 2015 Wildts Battery Boulevard, and preliminary approval for Building #4, a new veterinary office, at 606 Brooking Square Lane in the Point Hope development. The board previously granted conceptual approval for the project, and staff comments have been addressed in the latest submission.

design-reviewdevelopmentfire-stationveterinary-officepoint-hopecharleston
Mon Dec 1, 2025

Design Review Board

Board gives preliminary OK for two commercial buildings on Johns Island

The Design Review Board approved three applications: a completed mockup panel at 2015 Wildts Battery Blvd, preliminary approval for building 4 at 606 Brooking Square Ln, and preliminary approval for two 1-story commercial buildings at 1791 Hickory Knoll Way. The board also approved the meeting minutes from October 6, 2025.

design-reviewcommercial-developmentjohns-islandcainhoypreliminary-approvalboard-decisions
Mon Dec 1, 2025

Design Review Board

Staff approves change of office to private club at 2201 Mechanic St

This agenda lists 11 staff-level quick plan reviews approved by the Design Review Board staff. No board discussion or public hearings are scheduled; all items are routine commercial building, sign, and repair permits. The most notable is a change of occupancy from office to a private club with indoor golf simulators, pickleball courts, and a bar at 2201 Mechanic St.

design-reviewcommercial-developmentpermitssignszoning
Mon Dec 1, 2025

Board of Architectural Review

Approval of 77‑unit affordable housing project at 275 Huger St

The Charleston Board of Architectural Review will conduct quick‑plan reviews of 42 permit applications. Items include residential roofing, mechanical upgrades, sign installations, fence permits, and a new 77‑unit affordable housing building at 275 Huger St. The board will decide whether to approve each application.

housingaffordable-housingconstructionsignsfencesmechanicalroofing
Mon Nov 24, 2025

Design Review Board

Design Review Board staff to review new daycare, upfit, and sign permits

The Design Review Board is conducting a staff-level quick plan review meeting on November 24, 2025. Items include a new 10,071 SF child daycare facility at 3309 Maybank Highway, an interior upfit for a 2,060 SF commercial unit at 846 Gates Crossing Way, an electrical inspection at 1551 Ashley River Road, and a sign package for Novant Health at 960 Charleston Regional Parkway. No public hearings or detailed decisions are on the agenda.

design-reviewcommercial-constructiondaycaresign-permitelectrical-permit
Mon Nov 24, 2025

Commission on Women

Commission on Women to approve minutes and discuss topics

The Commission on Women will meet to approve the minutes from the September 22, 2025 meeting and discuss items. The meeting is scheduled for November 24, 2025, at 4:00 p.m. at 2 George Street.

commissionminutesdiscussionada
✓ Decided: Commission unanimously approved September 2025 meeting minutes

The Commission on Women voted unanimously to approve the minutes from the September 22, 2025 meeting. No other formal actions or votes were recorded. The commission discussed a draft Mamava lactation pod proposal and community health resources, but these remained informational. The meeting adjourned at 4:32 p.m.

Mon Nov 24, 2025

Board of Architectural Review

Board of Architectural Review staff reviews 18 property permits

The Board of Architectural Review staff is reviewing a series of quick plan permits for residential and commercial properties. These requests include renovations, new construction, and exterior maintenance across various city locations.

zoningarchitecturepermitshistoric-preservationcommercial-developmenthousing
Fri Nov 21, 2025

Commission on Disability Issues

Commission on Disability Issues to plan 2026 topics and update retail visit guide

The Mayor’s Commission on Disability Issues will meet to review minutes from previous meetings and plan topics for 2026. The body will also update a one-page handout used for visits to restaurants and retail establishments.

disability-rightsadaaccessibilitypublic-outreach
Thu Nov 20, 2025

Redevelopment and Preservation Commission

Commission to review roof replacements and rehabilitation requests

The Redevelopment and Preservation Commission will meet to approve minutes and review progress reports. The body will consider approval requests for the Roof Replacement Program and substantial rehabilitation reviews.

housingpreservationroofingrehabilitation
Thu Nov 20, 2025

Technical Review Committee

City reviews new West Ashley Aquatic Center site plan

The Technical Review Committee will consider twelve applications, including site plans for a self‑storage facility, townhomes, a city aquatic center, road and drainage projects, and several residential developments. Each item will be reviewed for compliance with zoning, engineering, and other departmental requirements. The committee will make recommendations but does not issue final approvals at this meeting.

zoningsite-plansdevelopmentinfrastructurehousing
Thu Nov 20, 2025

Technical Review Committee

TRC reviews new West Ashley aquatic center and large subdivisions

The Technical Review Committee meets to review 12 site plans, subdivision plats, and construction plans. All items require revisions, paperwork comments, or are pending stormwater comments; no approvals are granted at this stage. Notable proposals include a new city aquatic center in West Ashley, a 50-unit townhome development on Travis Lane, and a 272-lot subdivision phase on Sawtimber Street.

site-planssubdivisionszoningdevelopmentaquatic-centertownhomesroadsstormwater
Thu Nov 20, 2025

City Council

Council to discuss affordable housing strategy, West Edge, Morrison Drive

The City Council will hold a workshop to discuss affordable housing initiatives. Items include a presentation on Project 3500, the city's affordable housing strategy, and discussions on affordable housing at West Edge and at 993 and 995 Morrison Drive.

affordable-housingworkshopwest-edgemorrison-driveproject-3500
Thu Nov 20, 2025

Community Development

Charleston seeks $30M for Morrison Drive land

The City of Charleston is requesting approval to negotiate the purchase of 6.43 acres at 993 & 995 Morrison Drive for $30 million. The agreement includes a $500,000 earnest money deposit and requires the County to provide permanent public access easements before closing.

land-acquisitioncharleston-countymorrison-driveaffordable-housingpublic-accesscharleston-city-council
Thu Nov 20, 2025

Community Development

City Council to certify two Cumberland St. sites as abandoned buildings

The Community Development Committee will consider two resolutions to certify building sites at 28 and 32 Cumberland Street as abandoned under the South Carolina Abandoned Buildings Revitalization Act. The Committee will also hear a presentation of Project 3500, the City’s Affordable Housing Strategy, and discuss potential actions on affordable housing at West Edge. It may also approve a Memorandum of Understanding between the City and the Hope Center.

zoningaffordable-housingredevelopmentabandoned-buildingscommunity-development
✓ Decided: Committee unanimously recommends Option B for Morrison Drive site

The Community Development Committee certified 28 and 32 Cumberland Street as abandoned buildings. It approved a Memorandum of Understanding with the Hope Center, pending legal edits. The committee then unanimously recommended Option B for the Morrison Drive property to the full City Council.

Thu Nov 20, 2025

Livability Review Board

Board will review status of vacant structure at 11 Sires St.

The Livability Review Board will meet on November 20, 2025 to review and discuss the status of the vacant structure at 11 Sires St. (c. 1952). The agenda also calls for Livability staff to provide updates on properties that were previously before the board. No formal decisions are indicated in the agenda.

livabilityhousingvacant-propertiesboard-meeting
Wed Nov 19, 2025

Planning Commission

Planning Commission to vote on 15 zoning requests, PUD amendment

The Planning Commission will consider approval of meeting minutes, a PUD amendment, and 15 zoning requests. Key items include rezoning multiple city-owned parcels to Conservation on Johns Island and West Ashley, and several private requests for General Business or Single Family Residential zoning. Two items are deferred.

zoningconservationplanned-unit-developmentwest-ashleyjohns-islandland-useplanning-commission
✓ Decided: Planning Commission unanimously approves multiple zoning changes and a PUD amendment

The commission approved the October 22, 2025 meeting minutes (with one abstention) and the amendments to the September 17 and July 16, 2025 minutes. It unanimously approved an amendment to The Wedge Planned Unit Development to add former right‑of‑way. The body also unanimously approved several zoning changes, including conservation zoning for three parcels, general‑business zoning for two parcels, single‑family residential zoning for one parcel and six additional parcels.

Wed Nov 19, 2025

Planning Commission

Planning Commission to consider PUD amendment for The Wedge in West Ashley

The Planning Commission will consider a request to amend the Wedge Planned Unit Development (PUD) to include former right-of-way into the PUD. The item will receive a recommendation from the Commission and then go to City Council for a second public hearing. The Commission will also approve minutes from the October meeting.

planningzoningpudwest-ashleycharlestonland-usepublic-hearing
Wed Nov 19, 2025

Planning Commission

Commission approves zoning changes including conservation on city-owned parcels

The Planning Commission approved minutes from previous meetings, a PUD amendment for The Wedge on West Ashley Circle, and 13 zoning requests. Notable actions include rezoning three city-owned parcels to Conservation (C) on Johns Island and West Ashley, and several rezonings to General Business (GB) and Single Family Residential (SR-1/SR-2). Two items were deferred: 2089 UT Savage Rd / 2083 Savage Rd and 843 Melrose Dr.

zoningplanning-commissionconservationwest-ashleyjohns-islandcainhoypublic-hearing
Wed Nov 19, 2025

Planning Commission

Planning Commission reviews The Wedge PUD commercial development guidelines

The Planning Commission is reviewing proposed development guidelines for The Wedge Planned Unit Development, a commercial project on 14.21 acres off West Ashley Circle. The PUD amendment, already ratified by City Council in May 2025, creates three districts with specific land uses and dimensional standards. The commission will consider approval of the detailed guidelines covering zoning, parking, open space, and landscaping.

planning-commissionzoningcommercial-developmentpudwest-ashleycharleston
Tue Nov 18, 2025

City Council

City Council to consider seven rezoning requests and flood wall maintenance

City Council will hold public hearings on seven rezoning ordinances and an amendment to tree protection requirements. The body will also discuss a possible Charleston Water System rate increase and the adoption of an operations plan for the Magnolia Landing Trip Wall.

zoningflood-mitigationutilitieshousingpublic-works
✓ Decided: Councilmember Shealy moved to approve seven items, vote outcome not recorded

Councilmember Shealy moved to approve items 1 through 7 from the public‑hearing agenda, adding an amendment to SR‑2 on item 7. Councilmember Tinkler seconded the motion. No further discussion occurred and the minutes do not record a vote result.

Tue Nov 18, 2025

City Council

Committee to vote on $7.5M radio lease for police, fire

The Committee on Ways and Means will consider approval of a 5-year lease purchase agreement with Motorola for $7,543,466.28 to replace obsolete radios for Police, Fire, and general government staff. The committee will also consider a contract amendment with CBIZ, Inc. for $74,850.63 to update job descriptions and a purchase of a Heil 5000 rear loader garbage truck for $362,400.00. These items require committee approval before going to full City Council.

policefireradiosbudgetprocurementhuman-resourcespublic-works
✓ Decided: Committee approved $7.54M radio lease and $362.4K equipment purchase

The Committee on Ways and Means unanimously approved the minutes from the November 12, 2025 meeting. It also unanimously approved a five‑year lease purchase agreement with Motorola for $7,543,466.28 to replace police, fire and government radios, and a $362,400 purchase of a Heil 5000 rear loader from Carolina Environmental Systems. Finally, the committee unanimously approved an amendment to the CBIZ contract, increasing its total to $267,180.63.

Tue Nov 18, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to review 11 variance and special exception requests

The Board of Zoning Appeals is meeting to consider several applications for zoning variances and special exceptions. These requests include proposals for residential additions, new lot creations, and parking reductions for commercial and residential properties.

zoningvariancesparkinghousingland-use
Tue Nov 18, 2025

Board of Zoning Appeals Zoning

Board to consider lot coverage and special exception requests

The Charleston Board of Zoning Appeals will meet to consider a variance for a lot coverage increase on Watercrest Ln. and a special exception for a single-family residence on Main St. with insufficient lot size.

zoningvariancespecial-exceptionhousingplanningboard-of-zoning-appeals
Tue Nov 18, 2025

Board of Zoning Appeals Zoning

Board defers lot coverage variance for Johns Island home, approves multiple setback exceptions

The Board of Zoning Appeals approved most requests, including variances for building additions, lot size exceptions, and setback reductions. A lot coverage variance for 2510 Watercrest Ln. was deferred, and a parking variance for 137 & 141 Spring St. was deferred by the applicant. A wine bar at 106 Columbus St. was approved with conditions limiting hours, prohibiting liquor, and banning live music.

zoningboard-of-zoning-appealsvariancesspecial-exceptionsparkingsetbackslot-coveragedeferred
Tue Nov 18, 2025

Board of Zoning Appeals Zoning

Board to decide on variance to subdivide lot at 12 Orrs Ct. for family home

The Board of Zoning Appeals will hold public hearings on four requests for variances or special exceptions. Items include vertical extension of a nonconforming setback at 17 Alberta Ave., a front setback variance at 66 Anson St., subdivision variances at 12 & 12½ Orrs Ct., and a side setback variance at 59 Gibbes St. The board will vote on each application after hearing public comment.

zoningboard-of-zoning-appealsvariancesspecial-exceptioncharleston
Tue Nov 18, 2025

Traffic and Transportation Committee

Committee to discuss e-bike ordinance and transportation sales tax referendum

The Traffic and Transportation Committee will discuss a potential ordinance regulating e-bikes within the city and hold a public hearing on transportation priorities for a possible future transportation sales tax referendum. The meeting also includes approval of previous minutes and public comment opportunities.

traffice-bikestransportationsales-taxordinancepublic-hearing
✓ Decided: Committee unanimously approved the November 12, 2025 meeting minutes

The Traffic and Transportation Committee approved the November 12, 2025 meeting minutes by a unanimous vote. No other motions were adopted; the committee discussed e‑bike ordinance alignment and transportation‑sales‑tax priorities but took no formal action. The meeting was then adjourned.

Mon Nov 17, 2025

Design Review Board

AT&T antenna swap at 3519 Maybank Hwy approved by staff

The Design Review Board has one staff-level approval on the agenda: an AT&T request to swap antennas and RRUs on an existing communication tower at 3519 Maybank Highway. No height increase or ground disturbance is proposed. This is a routine administrative item.

design-reviewcommunications-towerstaff-approvalequipment-replacement
Mon Nov 17, 2025

Public Works and Utilities Committee

Committee discusses Magnolia Landing Trip Wall flood mitigation agreement

The Public Works and Utilities Committee will consider an ordinance to adopt the Magnolia Landing Trip Wall Operations and Maintenance agreement, which could alter FEMA flood maps. They will also authorize acceptance of sidewalk maintenance on Mutual Drive and Forrest Acres Circle, and review formal agreements for FEMA elevation grants with property owners. A discussion on a possible rate increase from Charleston Water System is also scheduled.

public-worksutilitiesflood-mitigationfema-grantssidewalkswater-ratesencroachments
✓ Decided: Committee unanimously approved Magnolia Trip Wall O&M ordinance

The Public Works & Utilities Committee approved three FEMA grant agreements and the Magnolia Trip Wall operations and maintenance ordinance, all by unanimous vote. It also approved the city’s acceptance of maintenance for two sidewalk easements. No other substantive items were decided.

Mon Nov 17, 2025

Public Safety Committee

Public Safety Committee to vote on updated Fire Department risk assessment and standards of cover

The Public Safety Committee will consider approval of the updated Community Risk Assessment and Standards of Cover document for the Charleston Fire Department, which defines risks and performance standards as part of the department's reaccreditation process. The committee will also vote on the minutes from the October 21, 2025 meeting.

public-safety-committeefire-departmentcommunity-risk-assessmentstandards-of-coveraccreditationcharleston
Mon Nov 17, 2025

City Council

Committee to consider 8 annexations in West Ashley

The Committee on Real Estate is meeting to consider eight annexation requests for properties in West Ashley, each seeking to bring parcels into the city limits. The committee will also approve minutes from October 27, 2025, and begin with an invocation.

annexationreal-estatewest-ashleycity-boundarypublic-hearing
✓ Decided: Committee approved eight West Ashley annexations and meeting minutes

The Real Estate Committee unanimously approved the October 27, 2025 meeting minutes. It then unanimously voted to take all eight proposed annexations together and to approve those annexations. All votes were unanimous.

Mon Nov 17, 2025

Board of Architectural Review

Special needs housing development proposed at 84 Barree St

The Charleston Board of Architectural Review will review a series of staff approvals, including exterior repairs, window and roof replacements, pool installations, signage projects, and a major special‑needs housing development. One item is a proposed 41,500‑sq‑ft, five‑story Ronald McDonald House for special needs at 84 Barree St, with 22 on‑site parking spaces and a second‑level bridge connection. All other items are routine exterior or interior renovation requests.

housingspecial-needssignageroofingpoolsconstruction
Thu Nov 13, 2025

Accommodations Tax Advisory Committee

Committee will approve the 2025 amended Accommodations Tax budget

The Accommodations Tax Advisory Committee will meet on November 13, 2025 at 10:00 a.m. The agenda includes approval of the September 11, 2025 minutes, an update on state accommodations tax revenue projections, and consideration of the 2025 amended budget and the 2026 proposed budget. The committee will discuss these items, address other business, and then adjourn.

accommodations-taxbudgetrevenuecity-counciltax
Thu Nov 13, 2025

Human Affairs and Racial Conciliation Commission

Commission to discuss housing, youth, and Coming Street Commons

The commission will hear a presentation from CCSD and City staff on programs for displaced families and youth. They will also discuss old business including affordable housing, youth initiatives, Coming Street Commons, the HARCC Ordinance, and the Open Data Initiative. Public comment and approval of previous minutes are also on the agenda.

housingyoutheducationaffordable-housingcoming-street-commonshuman-affairs
✓ Decided: Commission approved meeting minutes and set review period for HARCC ordinance

The commission unanimously approved the minutes from the September 11, 2025 meeting. They decided the Community Development Committee will hold a 30‑ to 60‑day review before voting on the HARCC ordinance. City Council approved funding for an affordable‑housing project, and the History Commission chose to proceed with its own statement on the Coming Street Commons project. The commission agreed to circulate a draft resolution prepared by Commissioner Cleaveland.

Thu Nov 13, 2025

Technical Review Committee

TRC to review 323-unit mixed-use Point Hope Capstone development

The Technical Review Committee will review 12 site plans and subdivision applications, including a 323-unit mixed-use development at Point Hope Capstone, a 42-lot conservation subdivision on Thomas Island, and renovations to Johnson Hagood Stadium at The Citadel. The committee also considers preliminary plats for new subdivisions in Cainhoy and West Ashley, plus road construction plans and a pedestrian bridge.

site-planssubdivisionsdevelopmentcainhoywest-ashleypeninsulamixed-usestadium-renovation
Thu Nov 13, 2025

Technical Review Committee

TRC reviews 12 development plans including 910-acre parkway extension

The Technical Review Committee will review 12 site plans, subdivision plats, and road construction plans. Most items, including a 42-lot conservation subdivision and a 323-unit mixed-use development, are revisions or pending stormwater comments. No final approvals are on the agenda.

zoningsite-planssubdivisionsdevelopmentconservationstadiumroadswest-ashley
Thu Nov 13, 2025

Human Resources Committee

Committee to consider $74,850 contract amendment for job study

The Human Resources Committee will decide whether to approve a $74,850.63 contract amendment with CBIZ, Inc. to update job descriptions and confirm job functions, increasing the total contract to $267,180.63. They will also review a staffing and retention report from the previous meeting.

human-resourcescontractcompensationstaffingbudget
✓ Decided: Human Resources Committee approved a $70,000 contract for citywide job description update

The committee unanimously approved the October 7, 2025 meeting minutes. It also approved a $70,000 contract with CBIZ to update roughly 700–1,100 citywide job descriptions, with a target completion date of April 1. The motion for the contract passed unanimously.

Thu Nov 13, 2025

Board of Architectural Review

BAR to consider new office building with drive-thru at 1070 Morrison Drive

The Board of Architectural Review – Small will review 15 applications for demolitions, new construction, exterior alterations, and appeals of staff decisions. Key items include a new office building with a drive-thru lane at 1070 Morrison Drive, full demolition of a c. 1890 dwelling at 30 Blake Street, and two new single-family dwellings at 158 Spring Street and 82 Alexander Street. The board will also hear appeals regarding window denials at 95 America Street and 115 Smith Street.

architectural-reviewhistoric-districtdemolitionnew-constructionalterationsappealscharleston
Thu Nov 13, 2025

Board of Architectural Review

Two partial demolition requests for Wagener Terrace homes

The Board of Architectural Review – Small will consider two applications for partial demolition of elements visible from the public right-of-way at 8 Riverside Drive and 75 Darlington Avenue, both in Wagener Terrace (Council District 6). The board will also review minutes from the October 23, 2025 meeting. No other items are listed.

board-of-architectural-reviewdemolitionhistoric-preservationwagener-terracecharleston
Thu Nov 13, 2025

Board of Architectural Review

Board denies demolition of historic Philip Simmons home at 30 Blake Street

The Board of Architectural Review reviewed several demolition and restoration requests. The board denied a request for full demolition of a historic dwelling at 30 Blake Street, requiring a stabilization plan instead. Other decisions included conceptual approvals for new construction and various partial demolitions.

historic-preservationdemolitionzoningarchitecturepublic-hearings
Thu Nov 13, 2025

Board of Architectural Review

BAR-S to consider full demolition of 30 Blake Street

The Board of Architectural Review – Small will review 15 applications, including several demolition requests, conceptual approvals, and appeals. The highest-profile item is the proposed full demolition of 30 Blake Street, a c. 1890 dwelling in the East Side, which drew 96 opposition comments and 1 in support. Other actions include partial demolitions, new construction, and appeals of staff decisions on windows.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonpublic-hearingnew-constructionappeals
Wed Nov 12, 2025

Special Events Committee

Special Events Committee denies car display permit at Marion Square

The Special Events Committee approved most permits with conditions, including SEWE 2026, parades, and concerts, but denied a car display event at Marion Square due to concerns about commercial use and lack of charitable beneficiary. A wedding parade on Meeting/Tradd/E Bay was approved over a livability representative's objection. The committee also tabled the Stoney 100 endurance event for further review. Updates included adjustments to Riverdogs fireworks schedule and discussion of policy formalization for 2026.

special-eventspermitsparadesfestivalsdenialsmarion-squarecredit-one-stadiumfireworks
Wed Nov 12, 2025

City Council

Council to vote on $1.5M-$1.9M fee transfer for homeless housing

Council will act on several items including transferring fee-in-lieu funds from Courier Square to Star Gospel Mission for 22 rental units for persons transitioning from homelessness. They will also consider a $5.34M contract for parking garage repairs, a $832,600 port security grant requiring a $208,150 match, and a $500,020 change order for the Spring-Fishburne pump station. Several annexations and a lease agreement with Ronald McDonald House are also on the agenda.

housinghomeless-servicesgrantsinfrastructurepublic-safetyparkingdowntowncommunity-development
✓ Decided: City Council unanimously approved the November 12 meeting minutes

The council voted unanimously to approve the minutes of the November 12, 2025 meeting. No other formal actions or votes were recorded. The meeting featured public comments and a presentation on infrastructure needs on Johns Island.

Wed Nov 12, 2025

City Council

Approve $5.34 M contract for structural repairs to four city parking garages

The Ways and Means Committee will vote on several capital projects, including a $5,344,341 contract for parking garage structural repairs, a $33,870 change order for 395 King Street retail renovation, and a $501,017 playground upgrade at Mary Utsey Park. It will also consider a new business‑license rate ordinance, a $832,600 port‑security grant, and various real‑estate lease and purchase authorizations.

budgetparkingparksbusiness-licensinggrant
✓ Decided: Committee approved $5.34M parking garage structural repairs contract

The Committee on Ways and Means unanimously approved a $5,344,341 contract with Stone Restoration of America for structural repairs to four city parking garages. It also approved multiple public‑works purchases, a new business‑license schedule, a park playground contract, and accepted an $832,600 port‑security grant. All actions were recorded as unanimous votes.

Wed Nov 12, 2025

Board of Architectural Review

BAR to review new hotel, apartment building, and neon sign appeal

The Board of Architectural Review – Large will consider several applications including a new hotel at 245 Huger Street (preliminary approval), a mixed-use apartment building at 578 Meeting Street (final approval), and an appeal of staff's denial of a neon sign at 176 Concord Street. Also on the agenda are a mockup panel at 230 Saint Philip Street and revisions for exterior alterations at 200 and 205 Meeting Street.

architectural-reviewnew-constructionhotelmixed-usesignshistoric-districtcharleston
Wed Nov 12, 2025

Board of Architectural Review

Board to review mockup panel for 230 Saint Philip Street new construction

The Board of Architectural Review will consider approval of a mockup panel for a new building at 230 Saint Philip Street (Courier Square Phase II, Building 04). The panel includes materials like brick, fiber cement siding, and metal roof. The board will also approve minutes from the October 8, 2025 meeting.

architectural-reviewnew-constructioncharlesotnmockup-panel
Wed Nov 12, 2025

Board of Architectural Review

Board approves final design for mixed-use building at 578 Meeting St

The Board of Architectural Review acted on three applications at its November 12 meeting. It approved final plans for a mixed-use apartment building at 578 Meeting Street with conditions, gave preliminary approval for a new hotel at 245 Huger Street, and deferred a mockup panel review for a project at 230 Saint Philip Street. All decisions include staff and board conditions to be addressed before further review.

architectural-reviewdesign-reviewnew-constructionhotelmixed-usemockuphistoric-districtcharleston
Wed Nov 12, 2025

Traffic and Transportation Committee

Committee discusses transportation priorities for potential sales tax referendum

The Traffic and Transportation Committee will discuss Mayor Cogswell's transportation priorities in relation to a potential future transportation sales tax referendum. This is a discussion item only, no decisions are scheduled.

transportationsales-taxreferendumprioritiescity-council
✓ Decided: Committee unanimously approved the October 28, 2025 meeting minutes

The Traffic and Transportation Committee approved the October 28, 2025 meeting minutes by unanimous vote. The members then discussed transportation priorities for a possible sales‑tax referendum, covering bike‑ped projects, sidewalk extensions, and funding mechanisms, but no formal actions were taken. The meeting adjourned at 4:14 p.m.

Mon Nov 10, 2025

Design Review Board

Charleston Design Review Board reviews 11 building and sign permits

The Design Review Board is reviewing 11 staff approvals for new signs, commercial buildings, and multi-family developments. The agenda includes a restaurant at 2401 Maybank Hwy and a large 18-building project named LC at Point Hope.

zoningbuildingpermitsmulti-familysignscommercialdemolition
Mon Nov 10, 2025

City Council

Council holds budget workshop with no published details

The City Council is meeting for a budget workshop. The agenda contains only procedural items — call to order, workshop, and adjournment — with no specific proposals, figures, or decisions listed.

budgetworkshopcity-council
Mon Nov 10, 2025

Board of Architectural Review

Board of Architectural Review staff approvals for 41 property permits

The Board of Architectural Review staff processed 41 quick plan reviews for various residential and commercial properties. These actions involve routine maintenance, renovations, and signage updates across the city.

zoninghistoric-preservationpermitsrenovationscommercial-property
Fri Nov 7, 2025

Ad Hoc Budget Advisory Committee

Budget Advisory Committee to review 2026 fund updates

The Ad Hoc Budget Advisory Committee will meet to receive an update on the 2026 General Fund and Enterprise Funds Budget. The meeting is chaired by Mayor William S. Cogswell, Jr.

budgetfinancecity-government
Thu Nov 6, 2025

Charleston Basin Flood Action Committee

Charleston Basin Flood Action Committee to review flood and resilience updates

The committee will receive updates on flood statistics and resilience efforts. Discussions include partnerships with the Army Corps and water plan vulnerability analysis. No formal votes or decisions are listed on the agenda.

floodingresiliencestormwaterinfrastructurepublic-safety
Thu Nov 6, 2025

Technical Review Committee

TRC to review Somersby 703-unit mixed-use concept plan

The Technical Review Committee will review seven development proposals, including site plans, preliminary plats, and road construction plans. Notable items include the Somersby Subdivision concept plan for 703 residential units on 293.69 acres in West Ashley, and the Woodfield Ashley Landing mixed-use building with 285 units at 1401 Sam Rittenberg Blvd. Several items are returning for revised review or are open pending delivery of ADA comments.

zoningsite-planssubdivisionsmixed-usewest-ashleyjames-islanddaniel-islandcharleston
Thu Nov 6, 2025

Technical Review Committee

Technical Review Committee to review 704-lot Somersby Subdivision concept plan

The City of Charleston Technical Review Committee will review seven development applications at its November 6, 2025 meeting. Projects include a 704-lot mixed-use subdivision, a 285-unit mixed-use building, and new commercial and residential developments across several districts. The committee conducts technical reviews of site plans, subdivision plats, and road construction plans.

site-planssubdivisionszoningdevelopmentwest-ashleyjames-islanddaniel-islandcharleston
Thu Nov 6, 2025

Special Facilities

Committee to discuss Powder Magazine

The Special Facilities Committee will meet via conference call to approve prior minutes, receive a facilities update from Director Romaine Heyward, and hold a discussion regarding the Powder Magazine. No votes or action items are scheduled on the agenda.

committeespecial-facilitiespowder-magazinediscussionmeeting
✓ Decided: Committee authorizes staff to develop Powder Magazine management agreement

The Committee unanimously approved the August 7, 2025 Special Facilities meeting minutes and moved Agenda Item 4 to the top of the agenda without objection. Staff were given permission to prepare a draft management agreement for the Powder Magazine with the Colonial Dames, including financial hold‑harmless provisions, and to present it to the Mayor and full Council later. No other substantive actions were taken.

Thu Nov 6, 2025

Resilience & Sustainability Advisory Committee

Just Corridor update and ReLeaf Tree Initiative announced

The committee will hear a status update on the Just Corridor and an announcement on the ReLeaf Tree Initiative, followed by public comment. No votes or formal decisions are on the agenda.

resiliencesustainabilityjust-corridortreespublic-comment
Wed Nov 5, 2025

License Committee

Adopting latest standardized business license schedules

The License Committee is considering an ordinance to adopt the latest Standardized Business License Rate and Class Schedules, including new subclassifications 9.10 and 9.11, as required by state law. The ordinance would take effect May 1, 2026.

business-licensestaxationordinancefeesmunicipal-code
Wed Nov 5, 2025

Board of Zoning Appeals Site Design

Board to consider variance to remove 18 grand trees on Southwick Drive

The Board of Zoning Appeals – Site Design will hear several variance and special exception requests related to tree removal and landscape requirements. Key items include a request to remove 18 grand trees on Southwick Drive (Johns Island) and a request to remove one grand tree at 106 Coming St. & 99 St. Philip St. (Radcliffeborough). One application (3097 South Shore Drive) has been deferred by the applicant. The board will also approve minutes from previous meetings.

board-of-zoning-appealszoningvariancestree-removallandscapepublic-hearingcharleston
Wed Nov 5, 2025

Board of Zoning Appeals Site Design

Board reviews multiple tree‑removal variances for properties on 106 Coming St and Southwick Dr

The Board will first approve minutes from its August 6 and October 1, 2025 meetings. It will then consider three applications requesting variances or special exceptions under Sec 54‑327 to permit removal of protected grand trees at 106 Coming Street, 99 St. Philip Street, and Southwick Drive. Each request seeks to waive tree‑protection requirements for the listed parcels.

zoningtree-removalvariancesenvironmentplanning
Wed Nov 5, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals approves tree removals and site variances

The Board of Zoning Appeals – Site Design decided on several requests for tree removal variances and site design exceptions. The board approved requests for the College of Charleston and two other private developments while one application was deferred.

zoningtree-removalvariancesland-usesite-design
Wed Nov 5, 2025

Board of Zoning Appeals Site Design

BZA-SD weighs removal of 18 grand trees on Johns Island

The Board of Zoning Appeals – Site Design will consider requests for variances and special exceptions related to tree removal and site design standards. The most notable item is a proposal to remove 18 grand trees and 12 grand trees on Southwick Drive, Johns Island, which has drawn public opposition. Also on the agenda is a variance for a reduced landscape buffer and gravel parking lot at 126 Romney Street, supported by the North Central Neighborhood Association. One application at 3097 South Shore Drive has been deferred by the applicant.

zoningtree_removalvariancespublic_hearingcharlestonboard_of_zoning_appealsjohns_islandnorth_central
Wed Nov 5, 2025

Commission on History

Commission on History to discuss burial ground preservation at 106 Coming Street

The Commission on History will discuss a resolution regarding the stewardship and development of a burial ground at 106 Coming Street. The body will also consider resolutions for the America 250th Anniversary and a memorial for a police horse.

historypreservationmemorialspublic-recordstourism
✓ Decided: History Commission adopts resolution on 106 Coming Street burial ground

The Commission approved a multi‑paragraph resolution concerning the proposed development of the burial ground at 106 Coming Street. The first and second paragraphs were adopted unanimously, the additional second paragraph passed with a non‑unanimous vote (Commissioner David McCormack voted against). The final paragraphs and the full text of the resolution were also approved, with one dissenting vote from Commissioner McCormack. The Commission also approved the Revolutionary Charleston America 250th Anniversary Resolution, tabled the Moonshine Marker item, and unanimously approved agenda item B1.

Wed Nov 5, 2025

Ad Hoc Budget Advisory Committee

Ad Hoc Budget Advisory Committee to review 2026 budget update

The committee will meet to receive an update on the 2026 General Fund and Enterprise Funds budgets. No other specific actions or decisions are listed on the agenda.

budgetfinancecity-government
Tue Nov 4, 2025

Board of Zoning Appeals Zoning

Board to consider variance for 28.5-foot tall, 2,736 sqft temporary sign at 0 Braswell St.

The Board of Zoning Appeals – Zoning will hear 8 applications on November 4, 2025, including several variance and special exception requests. The most notable items are a request for a massive temporary sign at 0 Braswell St. and a multi-property parking variance at 83-91 Nassau St. & 474 Meeting St. Other items involve residential additions, fences, and a tattoo parlor use variance.

zoningboard-of-zoning-appealsvariancespecial-exceptionsignparkingwest-ashleyeast-side
Tue Nov 4, 2025

Board of Zoning Appeals Zoning

Board to rule on three zoning appeals including special exceptions and a fence variance

The Board of Zoning Appeals will hear two special exception requests to vertically extend non-conforming side setbacks for rear additions at 10 Parkwood Ave and 3 Saint Margaret St, and a variance request for an 8-foot fence at 7 Lavington Rd. The board will also approve minutes from the October 7 and October 21 meetings.

zoningvariancesspecial-exceptionssetbacksfencecharleston
Tue Nov 4, 2025

Board of Zoning Appeals Zoning

Star Gospel Mission gets parking, setback variances from board

The Charleston Board of Zoning Appeals approved seven of eight applications at its November 4 meeting, including a variance to allow only 11 parking spaces instead of 27 for Star Gospel Mission properties on Nassau and Meeting Streets, and a use variance for a tattoo parlor on Daniel Street. One application was deferred for neighborhood consultation. Minutes from two previous meetings were also deferred due to lack of quorum.

zoningvariancesboard-of-zoning-appealscharlestonparkingsigntattoo-parlorsetback
Tue Nov 4, 2025

Board of Zoning Appeals Zoning

Board will consider a use variance for a tattoo business at 3 Daniel St.

The Charleston Board of Zoning Appeals will review several special exception and variance requests at its November 4 meeting. Items include setback extensions for 10 Parkwood Ave and 3 Saint Margaret St, a setback variance for 363 W. Confederate Circle, and a use variance for tattoo services at 3 Daniel St. Public comments have been submitted for each application.

zoningspecial-exceptionvariancedevelopmentcommunity-comments
Mon Nov 3, 2025

Design Review Board

Design Review Board meeting cancelled due to lack of applications

The Design Review Board meeting scheduled for November 3, 2025, has been cancelled because no applications were submitted for review. The Department of Planning & Preservation issued the notice.

cancelledplanningboilerplate
Mon Nov 3, 2025

Design Review Board

Design Review Board to review 11 sign and construction projects

The Design Review Board will review 11 items, including sign permits for locations like Rittenberg Boulevard and Folly Road, and a temporary construction trailer at Laurel Oak Lane.

signsconstructionpermitsreview-boardcharleston
Mon Nov 3, 2025

Board of Architectural Review

BAR staff approves quick plan reviews including historic variance for Hanover St flood elevation

The Board of Architectural Review staff has approved a series of quick plan reviews for work in Charleston's historic districts from November 3-7, 2025. Items include routine repairs, painting, roofing, and demolitions, as well as a substantial improvement with a historic variance for two units at 88 Hanover St requiring elevation to 11 feet DFE.

historic-preservationbuilding-permitsdemolitionsrenovationsflood-elevationarchitectural-review
Thu Oct 30, 2025

Ad Hoc Budget Advisory Committee

Committee to receive 2026 budget update

The Ad Hoc Budget Advisory Committee will hear a 2026 Budget Update as its primary agenda item. No decisions or votes are listed; the session also includes a moment of silence and other business before adjournment.

budgetadvisory-committeefiscal-year-2026
Tue Oct 28, 2025

City Council

City Council to receive public input on proposed 2026 City Budget

City Council will hold public hearings on the 2026 City Budget and several zoning changes. The body will also consider land acquisitions for a public elementary school and a 62-acre donation on Daniel Island.

budgetzoningreal-estateparkseducation
✓ Decided: Council unanimously approved reinterment of 74 graves at Bethany Cemetery

The City Council voted unanimously to approve a resolution allowing the 74 remains discovered at the former St. James United Methodist Church site to be reinterred at Bethany Cemetery. The Council also voted unanimously to consider Items E‑3 through E‑9 together in a single public hearing. Item E‑3 on short‑term rentals had been deferred by the Planning Commission and was not heard.

Tue Oct 28, 2025

City Council

City to accept donation of ~62 acres on Daniel Island for future use

The Ways & Means Committee will consider several financial approvals, including an amended $42,500 arts grant and two $25,000 fee amendments for park projects. It will also approve a $47,738.86 grant for the Stephen Washington Park Playground with a 20% city match. Additionally, the committee will authorize the purchase of about 11.5 acres for a public elementary school and the acceptance of a donation of roughly 62 acres on Daniel Island.

parksreal-estateeducationartsfinance
✓ Decided: Committee approved city to accept 62‑acre land donation on Daniel Island

The Ways and Means Committee unanimously approved the minutes from the October 14 meeting. It accepted an amended $42,500 arts grant, approved fee amendments for two park projects, and approved a $47,738.86 park development grant. The committee also authorized the mayor to enter a donation agreement for roughly 62 acres on Daniel Island. The proposed purchase of 11.5 acres for a new elementary school was deferred.

Tue Oct 28, 2025

Traffic and Transportation Committee

Transportation sales tax initiative to be discussed

The Traffic and Transportation Committee will discuss a potential transportation sales tax initiative and a proposal to restrict motorcoach buses south of Broad Street. The committee also considers approving road maintenance transfers for Bear Swamp Road and Ingram Road, appointing a code enforcement officer, and installing traffic calming on Wabeek Way.

transportationtrafficsales-taxpublic-workscode-enforcementbuses
✓ Decided: Committee unanimously approved road maintenance transfers for Bear Swamp and Ingram Roads

The Traffic and Transportation Committee voted unanimously to approve SCDOT road maintenance transfer requests for Bear Swamp Road (S-394) and Ingram Road (S-1650). The committee also unanimously approved traffic calming measures for Wabeek Way and appointed Louis Staggers III as Code Enforcement Officer. Earlier minutes from October 14, 2025, were approved unanimously as well.

Mon Oct 27, 2025

Design Review Board

Approval of 62‑unit multifamily construction at 205 Promenade Vista St

The Design Review Board will consider five quick‑plan permit applications. The most significant is a new 62‑unit multifamily building at 205 Promenade Vista St using VA construction methods. Other items include a commercial demolition/renovation at 3575 Maybank Hwy, a manufactured retail sales office at 2051 Savannah Hwy, foundation pier work at 109 Wappoo Creek Dr Unit 1A, and signage for an HOA at 2083 River Rd.

zoninghousingdevelopmentconstructiondesign-review
Mon Oct 27, 2025

Public Works and Utilities Committee

Committee approves $500k contract for pump station sediment removal

The Public Works and Utilities Committee will meet on October 27, 2025, to discuss temporary encroachments and approve a change order for sediment removal at the Spring-Fishburne Pump Station. The change order authorizes Harper General Contractors, Inc. to perform the work for $500,020.96.

public-worksutilitiespump-stationcontractchange-ordersediment-removalstormwatergrant
✓ Decided: Committee unanimously approved $500,020.96 change order for Spring/Fishburne project

The Public Works and Utilities Committee approved the September 22, 2025 meeting minutes. It also approved Change Order No. 1 for the Spring/Fishburne project, authorizing $500,020.96 for sediment removal from the pump‑station shaft. No public hearing or permanent encroachments were requested, and the temporary encroachments listed were for information only.

Mon Oct 27, 2025

Commission on Women

Commission on Women holds routine procedural meeting

The agenda includes only call to order, approval of minutes from September 22, 2025, general discussion, and adjournment. No specific proposals, ordinances, or public hearings are listed.

womencommissionmeetingprocedural
Mon Oct 27, 2025

City Council

Committee to vote on land purchase for new elementary school

The City Council's Committee on Real Estate will consider several property transactions, including the purchase of 11.5 acres for a public elementary school on Bear Swamp Road. The committee also will discuss a $550,000 land purchase from Jerusalem Baptist Church, a 62-acre donation on Daniel Island, and a lease agreement with Ronald McDonald House. Additionally, 16 annexation requests are on the agenda.

real-estateland-acquisitionschoolsannexationdonations
✓ Decided: City approved donation of 62 acres on Daniel Island

The Real Estate Committee unanimously approved six actions: extending the Ronald McDonald House lease through June 30 2027; amending the Courthouse Square intergovernmental agreement; authorizing a $550,000 purchase from Jerusalem Baptist Church; approving the purchase of 11.5 acres for a new elementary school; accepting a donation of four parcels totaling about 62 acres on Daniel Island; and approving a list of annexations for various parcels city‑owned or privately owned.

Mon Oct 27, 2025

Board of Architectural Review

BAR staff approvals for 49 quick plan reviews, including major floodproofing at 90 Cannon St

This meeting agenda consists of staff-level approvals for 49 quick plan review items, covering minor building alterations, repairs, roofing, and interior renovations. No items require full board deliberation. Notable among them is a substantial improvement at 90 Cannon Street combining dry floodproofing and a second-floor addition for a short-term rental unit, and a conversion of four units at 218 1/2 Rutledge Avenue into short-term rentals at $36,250 per unit.

architectural-reviewbuilding-permitsshort-term-rentalsfloodproofingcommercial-renovationresidential-renovationstaff-approvals
Thu Oct 23, 2025

Technical Review Committee

TRC reviews preliminary plat for 122-lot Point Hope Tract 7 Phase 2

The Technical Review Committee will review nine items including preliminary plats, road construction plans, and site plans for developments across Charleston. Major items include a 122-lot subdivision at Point Hope Tract 7 in Cainhoy, stormwater improvements in the Central Park Watershed, and an early site package for The Lowline project on King Street. All items are under review; no final decisions are made at this meeting.

technical-review-committeesite-planssubdivisionspreliminary-platroad-constructionstormwatercainhoycharleston
Thu Oct 23, 2025

Technical Review Committee

TRC reviews Point Hope Tract 7 (122 lots) and Lowline Phase 1 early site package

The Technical Review Committee is reviewing nine development applications, including a preliminary plat and road construction plan for Point Hope Tract 7 Phase 2 (122 lots) at 5000 Kitty Hawk Drive, a stormwater improvement project in the Central Park watershed on James Island, road construction for Magnolia Phase 1C on the Peninsula, the Lowline Phase 1 early site package at 678 King Street, a new athletic equipment storage building for West Ashley High School at 4084 UT West Wildcat Boulevard, an amenity center for Marshes at DI subdivision on Daniel Island, and a preliminary plat and road construction for Long Savannah N9 Phase 3 (35 lots) on the Peninsula. Most items have been previously submitted and are returning for further review with results such as 'Revise and Return' or 'Open pending delivery of Stormwater comments.'

technical-review-committeesite-planssubdivisionszoningdevelopmentinfrastructurestormwatercharleston
Thu Oct 23, 2025

Board of Architectural Review

Board to rule on appeal of staff decision, solar panels, and historic brick painting

The Board of Architectural Review – Small will consider 15 applications for exterior alterations, partial demolitions, and new construction in Charleston's historic districts. Notable items include an appeal of a staff decision to replace a door, a request to paint historic brick, and a proposal for roof-mounted solar panels. The board will also review minutes from previous meetings.

architectural-reviewhistoric-preservationdemolitionsolar-panelscharlestonboard-of-architectural-reviewold-city-districthistoric-corridor-district
Thu Oct 23, 2025

Board of Architectural Review

Board reviews three historic‑material demolition requests

The Charleston Board of Architectural Review will consider three applications to partially demolish exterior elements of historic homes that are visible from the public right‑of‑way. Each request seeks approval for specific roof eaves, siding, windows or additions at 178 Sans Souci St, 115 Peachtree St, and 4 Percy St. The board will vote on whether to grant the proposed demolitions.

historic-preservationdemolitionarchitecturezoningcity‑council-district-6
Thu Oct 23, 2025

Board of Architectural Review

Board denies demolition of historic gas station at 211 Rutledge Avenue

The Board of Architectural Review–Small voted on five applications for partial demolitions and alterations. Key decisions included approval of demolitions at 178 Sans Souci Street and 115 Peachtree Street, and denial of a proposal to demolish a historic former gas station at 211 Rutledge Avenue, citing preservation-in-situ concerns. A conceptual approval was also granted for a rear addition at 4 Percy Street.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonland-usegas-station
Thu Oct 23, 2025

Board of Architectural Review

BAR-S to review demolition request for 211 Rutledge Avenue

The Board of Architectural Review – Small is reviewing multiple applications for exterior alterations and demolitions. A request for partial demolition at 211 Rutledge Avenue has received 231 public comments, with 203 in opposition.

zoningdemolitionhistoric-preservationarchitecturepublic-comment
Wed Oct 22, 2025

Special Events Committee

Committee will discuss the 2026 Paws in the Park event at Brittlebank Park

The Special Events Committee will approve minutes from the September 24 and October 8 meetings, receive an update that only two more committee meetings remain this year, and discuss several upcoming events. Topics include Paws in the Park, the Charleston Dragon Boat Festival, Evacuation Day Commemoration, the Anson African Burial Memorial dedication, the Stoney 100 foot race, and YALL Fest. No formal actions are noted beyond discussion of these events.

special-eventsfestivalscommunityparkspublic-venues
Wed Oct 22, 2025

Special Events Committee

U.S. Coast Guard unable to lead Trident Swim due to federal shutdown

The Special Events Committee met to approve several event permits and receive updates. The U.S. Coast Guard cannot support the Trident Swim due to the federal government shutdown, and the Citadel Rucksack Challenge was cancelled. The committee also discussed the final version of the Special Events Action Plan and approved multiple events with conditions.

special-eventspermitsfederal-shutdownpublic-safetyparks
Wed Oct 22, 2025

Planning Commission

Planning Commission to consider aquarium site rezoning and STR ordinance changes

The Planning Commission will vote on a rezoning request for the 24 Calhoun Street aquarium site to allow mixed-use workforce housing, and consider amendments to the short-term rental ordinance, historic demolition district, and tree protection exemptions. Several items have been deferred: the short-term rental ordinance amendment is deferred by staff, and the zoning request for 0 Folly Road is deferred by the applicant.

zoningplanningshort-term-rentalshistoric-preservationtree-protectionworkforce-housingrezoning
✓ Decided: Planning Commission approved rezoning of 24 Calhoun St to mixed-use for workforce housing

The commission unanimously approved the rezoning of 24 Calhoun St from General Business & 56/30V to Mixed-Use 1/Workforce Housing & 7. It also unanimously approved rezoning 715 St. Andrews Blvd to General Office, two ordinance amendments, and several zoning changes. Minutes from the August 26 and September 17 meetings were approved, with the August minutes passing with one abstention.

Wed Oct 22, 2025

Planning Commission

Planning Commission reviews two rezoning proposals and minutes approval

The Charleston Planning Commission will consider approval of the August and September meeting minutes. It will discuss a rezoning request for 715 St. Andrews Blvd to change from Residential Office (RO) to General Office (GO). It will also consider a rezoning request for 24 Calhoun St (Aquarium Site) to change from General Business & 56/30V to Mixed‑Use 1/Workforce Housing & 7. Staff recommendations for both rezoning items are for approval.

zoningrezoningplanningdevelopmentland-use
Wed Oct 22, 2025

Planning Commission

Planning Commission approves aquarium site rezoning for workforce housing

The Charleston Planning Commission approved several rezoning requests and ordinance amendments. Key actions include rezoning the aquarium site at 24 Calhoun St to Mixed-Use 1/Workforce Housing with a 7-story height limit, and rezoning 715 St. Andrews Blvd from Residential Office to General Office. The commission also approved amendments to tree protection exemptions for city-funded capital projects and to allow Board of Architectural Review consent in the Historic Materials Demolition District. An amendment to the Short-Term Rental Ordinance was deferred by staff, and a zoning request for 0 Folly Road was deferred by the applicant.

planning-commissionrezoningworkforce-housingshort-term-rentalstree-protectionhistoric-preservationwest-ashleypeninsula
Wed Oct 22, 2025

Planning Commission

Planning Commission to consider amendments to Short-Term Rental Ordinance

The Planning Commission is reviewing proposed changes to Sections 54-208 and 54-227 of the Zoning Ordinance. These amendments aim to clarify definitions, submittal and review criteria, and penalties for short-term rentals and bed and breakfasts.

zoningshort-term-rentalsordinancehousing
Wed Oct 22, 2025

Ad Hoc Budget Advisory Committee

Committee to review 2026 budget update, general fund revenues

The Ad Hoc Budget Advisory Committee will discuss the 2026 Budget Update, focusing on General Fund Revenues, and receive September Monthly Reports. No votes or decisions are listed on the agenda.

budgetadvisory-committeerevenuegeneral-fundcharleston
Tue Oct 21, 2025

Public Safety Committee

Committee to vote on $832,600 port security grant for fire pump and underwater drone

The Public Safety Committee will vote on accepting an $832,600 federal port security grant for a portable fire pump for the Fire Department and a remotely-operated underwater vehicle for the Police Department. The grant requires a 25% city match of $208,150, to be budgeted in FY26. The committee will also receive an update on the juvenile curfew ordinance.

public-safetypolicefiregrantjuvenile-curfewport-security
✓ Decided: Committee unanimously approved $832,600 Port Security Grant award

The Public Safety Committee approved the minutes from the September 16, 2025 meeting by unanimous vote. The Committee also unanimously approved accepting the FY25 Port Security Grant Program award of $832,600, which will fund a portable fire pump/marine firefighting training for the fire department and a remotely operated underwater vehicle for the police department. No other actions were voted on during the meeting.

Tue Oct 21, 2025

Board of Zoning Appeals Zoning

BZA to hear 13 zoning appeals; one withdrawn, includes STR permit revocation

The Board of Zoning Appeals will consider 13 applications, including one withdrawn request (61 Broad St.) and one appeal of a short-term rental permit revocation (107 America St.). Other items involve special exceptions for restaurant parking and variances for residential setbacks and additions. The board will also review minutes from prior meetings.

zoningboard-of-zoning-appealsvariancesspecial-exceptionsshort-term-rentalsparkingsetbackscharleston
Tue Oct 21, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to consider special exceptions and density variance

The Charleston Board of Zoning Appeals will meet to consider special exceptions for restaurant parking and building setbacks, as well as a request to amend a density variance. The agenda also includes the approval of previous meeting minutes.

zoningspecial-exceptionvariancerestaurantparkingsetbackcharleston
Tue Oct 21, 2025

Board of Zoning Appeals Zoning

Board approves appeal reversing short-term rental permit revocation

The Board of Zoning Appeals decided on 13 items, including variances and special exceptions for parking, setbacks, and density. Notably, it approved an appeal to reverse a zoning administrator's decision to revoke a short-term rental permit at 107 America St. Several parking-related special exceptions were approved or withdrawn, and a special exception for a non-conforming setback at 170 Wentworth St. was denied.

zoningvariancesspecial-exceptionparkingshort-term-rentalappealsboard-of-zoning-appealscharleston
Tue Oct 21, 2025

Board of Zoning Appeals Zoning

Board to consider special exception and variance for 2-story addition at 170 Wentworth St.

The Board of Zoning Appeals – Zoning will hear six requests for variances and special exceptions at its October 21, 2025 meeting. The most contested item is a proposal at 170 Wentworth St. to extend a non-conforming setback and reduce a side setback for a two-story addition, which has drawn both support and opposition from neighbors. Other items involve requests to reduce rear, side, and front setbacks for additions, a deck, and new construction on properties across Charleston.

zoningvariancesspecial-exceptionboard-of-zoning-appealscharlestonpublic-hearingland-usehousing
Mon Oct 20, 2025

Design Review Board

Design Review Board reviews six commercial exterior and signage requests

The Design Review Board is processing staff approvals for various commercial property modifications. These items include signage updates, exterior repairs, and the installation of a commercial pool.

design-reviewsignagecommercial-developmentpermits
Mon Oct 20, 2025

Board of Architectural Review

Raising historic house at 4 COUNCIL ST for FEMA flood grant approved

This is a list of 33 staff-level quick-plan reviews, not a board meeting with debate. The most notable item is a FEMA grant-funded project to raise a historic structure at 4 COUNCIL ST above the design flood elevation, including foundation demolition and new stairs. Other items cover routine roofing, painting, siding, window, sign, and deck permits across Charleston.

architectural-reviewpermitshistoric-preservationfemaroofingsignageflood-mitigation
Fri Oct 17, 2025

Commission on Disability Issues

Commission on Disability Issues to plan 2026 topics and review retail handout

The Mayor’s Commission on Disability Issues will meet to discuss scheduling topics for 2026. The body will also review a one-page handout intended for visits to restaurants and retail establishments.

disability-servicesada-compliancepublic-accessibilitycity-planning
✓ Decided: Commission defers past meeting minutes and adjourns session

The commission unanimously deferred the minutes from the August 15 and September 19 meetings. A motion by Vice‑Chair Jackson adjourned the meeting at 5:02 p.m. No other formal actions were taken.

Thu Oct 16, 2025

Technical Review Committee

Review of Dolphin Cove Redevelopment site plan at 2079 Austin Ave

The Technical Review Committee will consider seven applications, including site plans, subdivision concepts, and infrastructure projects. Items include the Dolphin Cove Redevelopment at 2079 Austin Ave, storm‑water upgrades on Hazelwood Dr, and several mixed‑use and residential projects on the Peninsula. The committee will review the plans and determine any required approvals.

zoningdevelopmentstormwatermixed-usesubdivision
Thu Oct 16, 2025

Technical Review Committee

Seven-story mixed-use project at 162 Ashley Ave returned for revisions

The Technical Review Committee reviewed seven site plans and subdivisions, with most items receiving 'Revise and Return' results or pending comments. Key projects include a 7-story mixed-use development, a marina redevelopment, and stormwater infrastructure upgrades.

technical-review-committeesite-planssubdivisionszoninghousingmixed-usestormwaterinfrastructure
Thu Oct 16, 2025

Community Development

Committee to discuss affordable housing transfers and rural development

The Community Development Committee will approve the transfer of fee-in-lieu funds to the Star Gospel Mission for affordable housing and discuss the Charleston Housing Authority Partnership Request. The committee will also discuss rural housing and Esau Jenkins Village.

housingaffordable-housingcharleston-housing-authorityrural-housingesau-jenkins-villagecommunity-development
✓ Decided: Committee unanimously approved transfer of fee-in-lieu funds to Star Gospel Mission

The Community Development Committee approved the September 18, 2025 meeting minutes unanimously. It also unanimously approved transferring fee-in-lieu funds from Courier Square to the Star Gospel Mission for affordable housing development. Other items, such as the Charleston Housing Authority partnership and rural housing updates, were discussed but no decisions were made.

Thu Oct 16, 2025

Livability Review Board

Board to review vacant structures at two properties

The Livability Review Board will hold a hearing to review and discuss the status of vacant structures at 113 Harris St. (Upper East Side, c. 1940) and 11 Sires St. (Cannonborough/Elliotborough, c. 1952). Staff will also provide updates on previously discussed properties.

livabilityvacant-structureshearingscharleston
Thu Oct 16, 2025

Recreation Committee

Committee to discuss tennis complex concerns, dogs at baseball fields

The Recreation Committee will hold discussions on three specific topics: concerns at the Alan Fleming Tennis Complex, a proposed ban on dogs at Johns Island Park baseball fields, and adding a tennis professional at the Peggy Bohne Tennis Center. No votes or decisions are scheduled; the items are listed for discussion.

recreationtennisparksbaseballdogsjohns-island-park
✓ Decided: Recreation Committee unanimously approved September 18 minutes

The committee approved the minutes from the September 18, 2025 meeting after a motion by Councilmember Parker and a second by Councilmember McBride. The vote was unanimous. No other actions were formally decided during the meeting; the remaining agenda items were informational updates and discussions.

Tue Oct 14, 2025

City Council

City Council to review $31 million healthcare budget and various infrastructure grants

City Council will consider the 2026 Healthcare Budget and several committee reports involving public safety, stormwater management, and transportation. The body will also review appointments for the Housing Authority and Arts Commission.

budgethealthcarepublic-safetyzoninginfrastructuregrants
✓ Decided: City Council unanimously approved new appointments and reappointments

The council voted unanimously to approve the minutes of the September 23, 2025 meeting. They also voted unanimously to approve a list of appointments and reappointments to the Charleston Housing Authority, Accommodations Tax Advisory Committee, Commission on the Arts, and Code Enforcement Officers.

Tue Oct 14, 2025

City Council

Council to vote on $31M healthcare renewal with 12.6% increase per enrollee

The Ways and Means Committee will consider approving a $31.07 million healthcare budget renewal with CIGNA, including a 12.6% per-enrollee increase. Other items include a $570,515 agreement for Workday ERP support, $276,000 for Ashley River Crossing wetland mitigation credits, and multiple contracts and change orders. The committee will also review lease agreements and annexations forwarded from the Real Estate Committee.

budgethealthcarefinancecontractsgrantspublic-safetyinfrastructure
✓ Decided: Committee approved 2026 healthcare budget and multiple contracts

The Ways and Means Committee unanimously approved the 2026 healthcare budget and CIGNA renewal, a three‑year Cognizant support agreement, and several infrastructure contracts and grants. It also authorized the mayor to execute an MOA for the Hagood Improvement Plan and approved the Ashley River Crossing mitigation credit purchase, which was not unanimous. All other items were approved unanimously.

Tue Oct 14, 2025

Traffic and Transportation Committee

Committee to discuss transportation priorities for potential sales tax referendum

The Traffic and Transportation Committee will meet to discuss Mayor Cogswell's transportation priorities. These priorities relate to a potential future transportation sales tax referendum.

transportationtaxesinfrastructure
✓ Decided: Committee unanimously approved September 23, 2025 meeting minutes

The Traffic and Transportation Committee met on October 14, 2025. The committee approved the September 23, 2025 meeting minutes by unanimous vote after a motion by Mayor Cogswell and a second by Councilmember Gregorie. No other formal actions or votes were recorded before the meeting adjourned.

Mon Oct 13, 2025

Design Review Board

Design Review Board to process 12 staff approvals for signs and building updates

The Design Review Board is reviewing 12 staff approval requests for commercial signage and building modifications. These items include rebranding for gas stations and interior tenant upfits. The reviews are scheduled between October 13 and October 15, 2025.

signagecommercial-buildingroofingtenant-upfitdesign-review
Mon Oct 13, 2025

Board of Architectural Review

Staff approvals for architectural reviews including a substantial improvement at 52 Cooper St

This agenda consists of 60 staff-level quick plan reviews for architectural permits in Charleston's historic district. No public hearings or board decisions are scheduled. Items include new construction, substantial improvements, and routine repairs, with approvals considered from October 13-17, 2025.

architectural-reviewhistoric-districtstaff-approvalspermitsquick-plan-reviewsubstantial-improvementresidential
Thu Oct 9, 2025

Human Affairs and Racial Conciliation Commission

Commission will discuss unhoused, rapid housing, youth initiatives, and street commons

The Human Affairs and Racial Conciliation Commission will review updates on unhoused and affordable housing, youth programs, the proposed street commons, the HARCC ordinance, and the Open Data Initiative. A presentation by city staff will precede the discussion. The meeting includes a public comment period and open discussion.

housingyouthpublic-spaceordinancedata
Thu Oct 9, 2025

Technical Review Committee

Review of Cainhoy First Light Phase 3 road construction project (58.1 acres)

The Technical Review Committee will consider three applications: a road construction revision for the Cainhoy First Light Phase 3 project (58.1 acres, 76 lots) in Council District 1; a mixed‑use site plan for 12 Oliver Court (0.1 acre, 2 units) in Council District 6; and a townhome redevelopment of a parking lot at 1990 Daniel Island Dr (24 units) in Council District 1. Each item will be reviewed for compliance with zoning and required board approvals.

zoningroad-constructionsite-plansdevelopmentplanning
Thu Oct 9, 2025

Technical Review Committee

TRC to review revised road construction for 58-acre Cainhoy subdivision

The Technical Review Committee will review three development applications: a revised road construction plan for the 58.1-acre Cainhoy First Light Phase 3 (76 lots), a mixed-use redevelopment at 12 Oliver Court (2 units), and a 24-unit townhome redevelopment at 1990 Daniel Island Drive. These are site plan and subdivision reviews with decisions or recommendations pending.

developmentsite-planssubdivisionszoningroad-constructionmixed-usetownhomes
Thu Oct 9, 2025

Board of Architectural Review

Board to consider complete demolition of 1860s building at 153 ½ Queen Street

The Board of Architectural Review – Small will review 15 applications for demolition, exterior alterations, new construction, and an appeal of a staff condition. Items include partial and complete demolitions in historic districts, after-the-fact approvals, and conceptual approvals for new dwellings and accessory units.

historic-preservationdemolitionarchitectural-reviewcharlestonpublic-hearingboard-of-architectural-review
Thu Oct 9, 2025

Board of Architectural Review

Board to decide on partial demolition at 2315 Mt. Pleasant Street

The Board of Architectural Review will consider an application for partial demolition of exterior elements at 2315 Mt. Pleasant Street, including window replacements, removal of metal porch posts and railings, and infill of the rear porch. The board will also approve minutes from the September 25, 2025 meeting.

architectural-reviewdemolitionhistoric-preservationcharlestonwagener-terrace
Thu Oct 9, 2025

Board of Architectural Review

BAR denies complete demolition of 1860 Queen Street building

The Board of Architectural Review – Small met on October 9, 2025, and decided on eight applications for demolition, after-the-fact demolition, and conceptual alterations. The board denied a request to completely demolish a c. 1860 building at 153 ½ Queen Street, and approved most other requests with conditions. One after-the-fact demolition approval at 101 Gordon Street passed with a 3-1 vote over staff recommendation for denial.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonwagener-terraceharleston-villageold-and-historic-district
Thu Oct 9, 2025

Board of Architectural Review

Board to review historic demolition and construction permits

The Board of Architectural Review – Small will review 15 applications for demolition, construction, and alterations in historic districts. The meeting is scheduled for October 9, 2025, at 4:30 p.m. in the Public Meeting Room at 2 George Street.

historic-preservationdemolitionconstructionzoningboard-meeting
Wed Oct 8, 2025

Special Events Committee

Special Events Committee reviews Reindeer Run 5K street closure and RiverDogs 2026 permits

The Special Events Committee will meet on October 8, 2025, via Zoom to approve minutes from September 10, receive an update from the Special Event Manager, and hold discussions on several event applications. No formal decisions are scheduled; items are presented for discussion, including multiple street closures and event permits for 2025 and 2026.

eventsspecial-eventsstreet-closurespermitsparadesfoot-racespublic-hearings
Wed Oct 8, 2025

Special Events Committee

Committee approves street closure for the 34th Annual Reindeer Run 5K

The Special Events Committee reviewed and approved several event requests with conditions, including the 34th Annual Reindeer Run, multiple Charleston RiverDogs events, and other community walks and parades. Approvals required event safety plans, EMS coverage, and police staffing details. The committee also provided updates on the CPC Bloom Charleston Parking/Plant Pick Up and noted potential flooding impacts on upcoming events.

special-eventsstreet-closurespublic-safetyevent-permitsparadesfestivals
Wed Oct 8, 2025

Commission on History

Update on bodies under YWCA at 106 Coming Street

The Commission on History will discuss an update on the 'Protect and Respect the Bodies Under the YWCA' project at 106 Coming Street. The commission will also approve minutes from September 3, 2025, and introduce new members.

historypreservationywcacoming-streetburial-groundsmeeting
✓ Decided: Commission unanimously approved amended minutes (item B1)

The History Commission voted unanimously to approve item B1 as amended, finalizing the September 3, 2025 minutes. Members agreed to send requested changes to the Protect and Respect the Bodies resolution to the Chair and Assistant Clerk by Friday, Oct 31. The Commission also agreed that it and the Human Affairs and Racial Conciliation Commission may endorse each other's proposals and will work separately on related matters.

Wed Oct 8, 2025

Board of Architectural Review

Board to consider final approval of affordable housing at 275 Huger Street

The Board of Architectural Review – Large will consider applications for new construction, demolition, and alterations in historic districts. Key items include final approval of a new affordable housing building at 275 Huger Street and full demolition of structures at 280 Meeting Street.

architectural-reviewnew-constructiondemolitionaffordable-housinghistoric-districtalterationscharleston
Wed Oct 8, 2025

Board of Architectural Review

Board to consider demolition of 280 Meeting Street and new affordable housing at 275 Huger Street

The Board of Architectural Review will consider two applications: demolition approval for a 1918 building at 280 Meeting Street and final approval for a new affordable housing building at 275 Huger Street.

zoningdemolitionaffordable-housinghistoric-preservationplanning
Wed Oct 8, 2025

Board of Architectural Review

Board denies demolition of 280 Meeting Street main structure

The Charleston Board of Architectural Review denied the full demolition of a two-story brick structure at 280 Meeting Street but approved the demolition of a rear 1952 CMU building. The decision was made by a split vote of 3-2.

zoningdemolitionhistoric-preservationcharlestonmeeting-streetboard-of-architectural-review
Wed Oct 8, 2025

Board of Architectural Review

Board to discuss demolition of historic 280 Meeting Street building

The Charleston Board of Architectural Review will meet to consider a request to demolish a 1918 building at 280 Meeting Street. The board will also review permits for new construction, affordable housing, and exterior renovations across the city.

zoninghistoric-preservationdemolitionaffordable-housingconstructionpublic-hearing
Wed Oct 8, 2025

Ad Hoc Budget Advisory Committee

Committee to discuss 2026 budget update including lease purchase

The Ad Hoc Budget Advisory Committee will receive an update on the 2026 city budget. Discussion topics include fact-of-life increases, a lease purchase item, and the overall budget framework. No specific dollar amounts or proposals are detailed in the agenda. The meeting is primarily informational and procedural.

budgetcommitteecivic-affairs
Tue Oct 7, 2025

Human Resources Committee

Committee to vote on 2026 Healthcare Budget amendments

The Human Resources Committee will consider approving amendments to the 2026 Healthcare Budget as old business. The meeting also includes a presentation on the city's Mission, Vision, and Values. Approval of prior meeting minutes is also on the agenda.

human-resourcesbudgethealthcaremeeting
✓ Decided: Human Resources Committee approves 2026 healthcare budget amendments

The committee unanimously approved the August 21, 2025 meeting minutes. It also unanimously approved amendments to the 2026 Healthcare Budget, which add a $125,000 cost to the city's budget. No other actions were decided at this meeting.

Tue Oct 7, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to review 14 property applications

The Board of Zoning Appeals is meeting to consider various requests for zoning variances, special exceptions, and appeals. The board will decide on property modifications, parking requirements, and operational hour changes for several city locations.

zoningvariancesparkinghousingland-use
Tue Oct 7, 2025

Board of Zoning Appeals Zoning

Board to decide on bedroom addition in non-conforming dwelling

The Board of Zoning Appeals will hold a public hearing on three requests: a special exception to add a bedroom in a non-conforming two-family dwelling at 105 ½ King St, a special exception to extend a non-conforming north side setback at 4 Percy St, and a one-year extension of vested rights at 1 Michel Pl. The board will also approve minutes from the previous meeting. Staff recommends approval for all three items.

zoningboard-of-zoning-appealsvariancesspecial-exceptionsnon-conforming-usesetbackcharleston
Tue Oct 7, 2025

Board of Zoning Appeals Zoning

BZA approves 5 new sleeping units, spa without parking, and multiple zoning variances

The Board of Zoning Appeals voted on 14 applications at its October 7, 2025 meeting, approving most requests including a use variance for a 5-unit expansion at 0 George St., a special exception for spa and residential space with no parking at 123 Meeting St., and several setback and lot-coverage variances. One application was denied (lot frontage variance at 0 Pineneedle Way) and two were deferred (minutes and a variance at 4 Henrietta St.).

zoningvariancespecial-exceptionuse-varianceparkingaccommodationssetback
Tue Oct 7, 2025

Board of Zoning Appeals Zoning

Bar Rollins seeks earlier hours; Percy St. addition variance

The Board of Zoning Appeals will consider two requests: amending conditions for Bar Rollins at 194-A Jackson St. to extend operating hours from 4pm-10pm to 7am-10pm, allowing it to operate as a café, and a special exception at 4 Percy St. to extend a non-conforming north side setback for a rear two-story addition.

zoningvariancespecial-exceptionbar-rollinspercy-stcharleston
Mon Oct 6, 2025

Design Review Board

Design Review Board to consider new 10,000 sq ft child daycare on Johns Island

The Design Review Board is considering preliminary approval for a new 10,000 sq ft child daycare at 3309 Maybank Hwy on Johns Island. Also on the agenda: conceptual approvals for a youth learning center with a 9-hole golf course, a 4-story storage building, and two retail/restaurant buildings. Two applications for demolition and rebuild at 534 Savannah Hwy have been deferred by the applicant.

design-reviewdevelopmentchildcareretailcommercialgolf-coursestorage
✓ Decided: Design Review Board denies 4‑story storage project at 1647 King St. Ext.

The Board denied the proposed 4‑story storage building at 1647 King St. Ext. after a 7‑0 vote. It granted preliminary approval to a child‑daycare at 3309 Maybank Hwy., to two grey‑shell retail buildings at 1702‑1704 Hollydale Ct., and to a conceptual 1‑story building at 1109 Wappoo Rd., each with specific board comments. A conceptual approval was also given for a youth learning center at 2275 Henry Tecklenberg Dr. The minutes from the September 2, 2025 meeting were approved unanimously.

Mon Oct 6, 2025

Design Review Board

Preliminary approval sought for new daycare at 3309 Maybank Hwy

The Design Review Board will consider two items at its October 6, 2025 meeting. First, a request for preliminary approval of a new 10,000-square-foot child daycare facility at 3309 Maybank Highway on Johns Island. Second, a request for full demolition of an existing two-story brick building over 50 years old at 534 Savannah Highway, with salvaging of brick.

design-review-boardday-caredemolitionmaybank-highwaysavannah-highwayjohns-islandcharleston
Mon Oct 6, 2025

Design Review Board

Design Review Board denies 4-story storage building on King St. Ext.

The Design Review Board made decisions on seven applications, approving five projects and denying one. Approved items include a new child daycare at 3309 Maybank Hwy., two retail/restaurant shells at 1702-1704 Hollydale Ct., a retail building at 1109 Wappoo Rd., and a youth learning center with golf course at 2275 Henry Tecklenberg Dr. The board denied conceptual approval for a 4-story storage building at 1647 King St. Ext. due to architectural direction. Two applications for demolition and rebuild at 534 Savannah Hwy. were deferred by the applicant.

design-reviewdevelopmentcommercialchild-daycarestoragegolf-coursecharleston
Mon Oct 6, 2025

Design Review Board

Historic building demolition and rebuild at 534 Savannah Hwy considered

The Design Review Board will consider several development proposals, including the full demolition of a historic brick bungalow at 534 Savannah Highway and a rebuild identical to the existing structure. Also up for review are a new 10,000 sq ft child daycare on Johns Island, a youth learning center with a 9-hole golf course in West Ashley, and multiple retail buildings. Public comments were submitted opposing the demolition and raising concerns about tree removal and flooding at the youth center site.

design-reviewhistoric-preservationdemolitiontree-removalfloodingtrafficcommercial-development
Mon Oct 6, 2025

Design Review Board

DRB reviews 6 quick-plan items for renovations, signs, and equipment

The Design Review Board is considering six staff-level quick plan reviews, including interior renovations, signage, mechanical upgrades, and antenna additions. No public hearings or major policy decisions are on the agenda.

design-reviewcommercial-renovationssignagemechanical-permitscommunication-towerhvac-upgradestaff-approvals
Mon Oct 6, 2025

Board of Architectural Review

BAR staff approves 44 quick-plan reviews including 7-story multifamily project

This is a list of 44 staff-level quick-plan approvals for the week of October 6-10, 2025, covering minor alterations, roofing, painting, mechanical work, and a few larger projects. The most notable items include a seven-story multi-family project at 500 E Bay Street and a substantial historic renovation at 1 Henrietta Street involving a 3-story addition.

historic-preservationbuilding-permitsresidential-renovationszoningconstructionstaff-approvals
Thu Oct 2, 2025

Technical Review Committee

Long Savannah 130-lot subdivision phase reviewed by TRC

The Technical Review Committee will review 18 site plans, subdivision plats, and road construction proposals. Items include second reviews for the Huger Street Affordable Housing (86 units at 275 Huger St), Primus Park (102 lots in Cainhoy), and Long Savannah Neighborhood 5 Phase 3 (130 lots in West Ashley). Other items include early site packages, pedestrian safety improvements, and amenity centers.

technical-review-committeesite-planssubdivisionsaffordable-housingzoningroadscharleston
Thu Oct 2, 2025

Technical Review Committee

TRC reviews Huger Street affordable housing revisions and 17 other development plans

The Technical Review Committee will review 18 site plans, subdivisions, and road construction proposals. Several items are returned for revisions, while some are approved or pending stormwater comments. Notable is the revised plan for 86 affordable housing units at 275 Huger Street and the early site package for College of Charleston student housing demolition at 106 Coming Street.

zoningaffordable-housingsite-planssubdivisionsroad-constructionpedestrian-safetydevelopment
Wed Oct 1, 2025

Board of Zoning Appeals Site Design

Board to vote on multiple tree-removal variances including 30 trees on Southwick Drive

The Board of Zoning Appeals Site Design will consider several applications for variances and special exceptions to remove grand and protected trees and reduce impervious construction setbacks. The largest request is on Southwick Drive, seeking removal of 30 grand trees. Other proposals involve tree removal at College of Charleston, Star Gospel Mission, and along Morrison Drive. The meeting also includes review of past minutes and a deferred application.

zoningtree-removalvariancesspecial-exceptionsboard-of-zoning-appealscharleston
Wed Oct 1, 2025

Board of Zoning Appeals Site Design

Board reviews variances to remove protected trees on Coming St., Nassau St., and Murray Blvd.

The Charleston Board of Zoning Appeals – Site Design will approve the minutes from its August 6 and September 3, 2025 meetings. It will consider three variance requests that seek to remove grand trees and adjust setback requirements at specific properties on Coming St. & St. Philip St., Nassau St. & Meeting St., and William E. Murray Boulevard. All items are listed under the board's agenda for the October 1, 2025 meeting.

zoningtreesvarianceplanningsite-design
Wed Oct 1, 2025

Board of Zoning Appeals Site Design

BZA denies tree removal variance for 18 grand trees on Johns Island

The Board of Zoning Appeals – Site Design approved four tree removal variances and denied one. A request to remove up to 18 grand trees on Southwick Drive failed on a 2-4 vote. The College of Charleston's request for tree removal at 106 Coming St. was deferred. Minutes from the September 3, 2025 meeting were approved.

zoningtree-removalvariancesboard-of-zoning-appealscharlestonjohns-island
Wed Oct 1, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to review tree removal requests at five sites

The Board of Zoning Appeals – Site Design will consider several requests for variances and special exceptions regarding the removal of grand and protected trees. The meeting includes a high-volume request for tree removal on Johns Island and a request involving a historic burial ground.

zoningtree-removalenvironmentjohns-islandhistoric-preservation
Wed Oct 1, 2025

Ad Hoc Budget Advisory Committee

Budget committee reviews IT and Executive department requests

The Ad Hoc Budget Advisory Committee will review budget requests from the Information Technology and Executive departments. No specific dollar amounts or proposals are listed on the agenda. The meeting also includes a moment of silence and other business.

budgetinformation-technologyexecutiveadvisory-committeecharleston
Mon Sep 29, 2025

Design Review Board

Design Review Board reviews ten commercial renovation and signage projects

The Charleston Design Review Board will conduct quick plan reviews of ten commercial projects. Items include interior renovations, signage installations, a solar panel system, and a temporary fire‑station trailer. All reviews are scheduled for October 1‑2, 2025.

design-reviewcommercial-renovationsignagesolarpublic-safety
Mon Sep 29, 2025

Board of Architectural Review

Board of Architectural Review staff reviews 40 property permits

The Board of Architectural Review staff is reviewing a series of quick plan permits for residential and commercial properties. These requests include roofing repairs, exterior painting, and structural additions.

zoningpermitsarchitecturedemolitionconstruction
Fri Sep 26, 2025

City Council

City Council to brief on Invest 94L storm preparations

The Charleston City Council will hold an emergency meeting to receive a briefing on Invest 94L and storm preparations. The session is scheduled for 10:30 A.M. on September 26, 2025.

emergencystormweathercity-council
Thu Sep 25, 2025

Redevelopment and Preservation Commission

Commission to consider housing rehab and mortgage reduction requests

The Redevelopment and Preservation Commission will consider multiple requests for approval, including a subordination request at 12 H Street, roof replacement at 930 Main Street, substantial rehabilitation at 1014 High Street, limited substantial rehabilitation at 21 Martin Luther King Boulevard, additional funds for 380 Race Street, and reduction of mortgage balances. No dollar amounts are specified in the agenda. Public comment and approval of previous minutes are also scheduled.

redevelopmentpreservationhousingpublic-meetingcommission
Thu Sep 25, 2025

Technical Review Committee

Technical Review Committee to review Robert Mills Manor renovation and other developments

The City of Charleston Technical Review Committee will meet via Zoom to review site plans, subdivision plats, and road construction plans for seven projects. Items include a 222-unit renovation of Robert Mills Manor, a 13-unit townhome development at 228 President St, revisions to Grace Episcopal Church Parish Hall, and preliminary plats and road plans for Magnolia PUD and Long Savannah phases.

site-planssubdivisionshousingdevelopmenttechnical-review-committeecharleston
Thu Sep 25, 2025

Technical Review Committee

Technical Review Committee reviews Robert Mills Manor renovation and other site plans

The Technical Review Committee will review seven items including site plans, preliminary plats, and road construction plans. All applications remain open pending delivery of stormwater comments, meaning no final decisions are expected at this meeting. The most notable project is the Robert Mills Manor renovation (222 units at 20 Franklin St), along with a 13-unit townhome development at 228 President St and a 104-lot preliminary plat in the Long Savannah neighborhood.

site-planssubdivisionsstormwaterdevelopmenthousingcharlestonzoningtransportation
Thu Sep 25, 2025

Board of Architectural Review

Board to review historic demolition and construction applications

The Board of Architectural Review – Small will review minutes from recent meetings and consider applications for historic materials demolition and new construction. The meeting will be held at 2 George Street.

charlestonboard-of-architectural-reviewhistoric-preservationzoningdemolitionconstructioncouncil-district-4council-district-6
Thu Sep 25, 2025

Board of Architectural Review

Board of Architectural Review to consider demolition and modification requests

The Board of Architectural Review - Small will review requests for partial demolitions at two residential properties and modifications to a previously approved restroom building. The board will also review meeting minutes from August 28 and September 11, 2025.

demolitionhistoric-preservationzoningarchitecture
Thu Sep 25, 2025

Board of Architectural Review

Board of Architectural Review - Small approves several historic property modifications

The Board reviewed applications for partial demolitions, new constructions, and exterior modifications in historic districts. The body decided on several approvals with specific conditions regarding materials and design, while deferring other requests for further study.

zoninghistoric-preservationdemolitionconstructionarchitecture
Thu Sep 25, 2025

Board of Architectural Review

BAR to review 11 applications including new homes, demolitions, and alterations

The Board of Architectural Review – Small will consider 11 applications for projects in historic districts. Items include partial demolition of historic materials, new single-family dwellings, exterior modifications, and a rear duplex. One public comment has been submitted for the proposed new home at 2 Kennedy Court, questioning its design.

historic-preservationboard-of-architectural-reviewcharlestondemolitionsnew-constructionpublic-commentold-and-historic-district
Wed Sep 24, 2025

Tourism Commission

Commission to discuss evening carriage tours

The Tourism Commission will meet to discuss evening carriage tours, with possible action. The agenda also includes an update from the Department of Livability and Tourism and public input. Items are limited to discussion and routine procedural matters.

tourismcarriage-tourspublic-meeting
✓ Decided: Tourism Commission unanimously approves meeting minutes

The commission approved the meeting minutes after Mr. Teagle moved and Mr. Laramy seconded the motion. The approval was unanimous. No other formal actions or votes were recorded.

Wed Sep 24, 2025

Special Events Committee

Credit One Stadium Concert on Oct 24 draws over 10,000 attendees

The Special Events Committee will approve August 27 minutes, receive an update on the withdrawn Victory Day application, and discuss a series of upcoming events ranging from film shoots to parades and festivals. Most items are for discussion only, with no formal action required at this meeting.

special-eventsparadesfestivalsfilm-shootspublic-safety
Wed Sep 24, 2025

Special Events Committee

Turkey Day Run tabled; route revision needed due to intersection closure

The Special Events Committee approved most event permits but tabled the Turkey Day Run and Gobble Wobble (11,300 attendees) because its planned route may conflict with an intersection closure. Light the Lake (1,000 attendees), now city-run, was also tabled for more details on street closure. Other events—including an Outer Banks film shoot, parades, and holiday celebrations—were approved with conditions.

special-eventsparadesfilm-permitsstreet-closurespublic-safetyholidaypeninsula
Wed Sep 24, 2025

Ad Hoc Budget Advisory Committee

Ad Hoc Budget Committee reviews city budget requests

The Ad Hoc Budget Advisory Committee will review budget requests from the Budget, Finance and Revenue Collections and Human Resources and Organizational Development departments. The meeting is scheduled for Wednesday, September 24, 2025, at 3:00 p.m.

budgetfinancead-hoc-committeecity-councilcharleston
Wed Sep 24, 2025

Ad Hoc Budget Advisory Committee

Committee to review budget requests for two city departments

The Ad Hoc Budget Advisory Committee will review August monthly reports and budget requests for Budget, Finance and Revenue Collections, and for Human Resources and Organizational Development. The agenda also includes a moment of silence and other business. No specific dollar amounts or proposals are detailed in the agenda.

budgetfinancehuman-resourcescity-governmentadvisory-committeecharleston
Tue Sep 23, 2025

City Council

Charleston Council to discuss medical district, budget, and annexation

The City Council will hold a public hearing on a proposed medical university district overlay and consider the 2026 healthcare budget with a 12.2% increase. The body will also discuss park maintenance and a loan for senior housing.

zoningbudgethealthcarehousingroadsannexationparks
✓ Decided: Council defers 0 Folly Road agenda item at applicant's request

The council announced that the agenda item for 0 Folly Road was deferred at the applicant's request, so it was not heard at this meeting. No other substantive actions, approvals, or denials were recorded. The meeting included a public hearing on a proposed Medical University District overlay, but no vote or decision was taken on that matter.

Tue Sep 23, 2025

City Council

Committee to vote on $30.9M healthcare renewal and $2.6M senior housing loan

The Committee on Ways and Means will consider several financial approvals, including a $30.9 million healthcare budget renewal with CIGNA, a change order for path maintenance at White Point Garden, a loan modification to preserve North Central Apartments for low-income seniors, and a $314,118 cloud software platform. All items are up for approval.

budgethealthcarehousingsenior-housingaffordable-housingparksinfrastructuretechnology
✓ Decided: Mayor authorized to pursue 11.5‑acre school site in Long Savannah

The Committee on Ways and Means unanimously approved several contracts, including fire uniforms, storm‑debris services, and a cloud‑based software platform. It also authorized a change order for path maintenance in White Point Garden and a loan modification to preserve senior housing at North Central Apartments. The committee unanimously authorized the mayor to execute a Letter of Intent for 11.5 acres in Long Savannah for a future Charleston County school site. All actions were approved without dissent.

Tue Sep 23, 2025

Traffic and Transportation Committee

Committee to discuss transportation sales tax and traffic calming

The Traffic & Transportation Committee will discuss a transportation sales tax initiative and a Target Zero resolution. Members will also review traffic calming measures for two locations on Johns Island.

transportationtaxestraffic-calmingpublic-safetyjohns-island
✓ Decided: Committee unanimously approves Target Zero safety policy and other projects

The Traffic and Transportation Committee unanimously approved the Target Zero Resolution Policy, a safety plan that will support $13 million in federally funded projects with a $2.5 million city match. The committee also approved several specific actions, including adding a $245,680 Financial Participation Agreement with SCDOT for the Morrison Drive Median Safety Project, approving traffic‑calming measures on Grand Bay Lane and Timberline Drive on Johns Island, and confirming Ms. Eliza Story as a Code Enforcement Officer. Earlier agenda items were approved, such as amending the agenda to include the SCDOT agreement and adopting the August 19, 2025 meeting minutes, all by unanimous vote.

Mon Sep 22, 2025

Design Review Board

DRB to review large gymnasium addition and fire-damaged apartment repairs

The Design Review Board will consider 12 staff-level plan reviews, including a 25,865 sq ft addition to a gymnasium at 20 Sawgrass Rd, repairs to eight fire-damaged apartment units at 1800 William Kennerty Dr, and a new amenity center for Del Webb Point Hope. Other items include sign changes, HVAC replacements, and an after-the-fact fence replacement with a doubled fee.

design-review-boardstaff-approvalscommercial-constructionfire-damage-repairsnew-constructionsignagemechanical-permitsbuilding-additions
Mon Sep 22, 2025

Public Works and Utilities Committee

City approves $128,750.30 change order for Forest Acres Phase 2 stormwater work

The Public Works and Utilities Committee will approve a $128,750.30 change order for the Forest Acres Phase 2 channel bank stabilization. It will also accept and dedicate several rights‑of‑way and easements for curb and drainage maintenance, and add the 56 State Street undergrounding project to the Non‑Standard Service Fund. The committee will authorize the mayor to sign an agreement with 56 State SC Property, LLC for funding underground electric work, and discuss revisions to the 2020 Stormwater Design Standards Manual.

stormwaterinfrastructurefundingrights-of-wayundergroundingpublic-works
✓ Decided: Committee unanimously approved four rights‑of‑way and easement agreements

The Public Works & Utilities Committee approved the August 18, 2025 meeting minutes unanimously. On a motion by Mayor Cogswell and seconded by Councilmember Gregg, the committee unanimously approved Items E1‑E4, authorizing acceptance and maintenance of rubber curbing, a CCSD West Ashley Campus subdivision dedication package, a temporary construction easement for the Windermere Drainage Improvement Project, and maintenance of several box culverts. No other substantive actions were taken.

Mon Sep 22, 2025

Commission on Women

Commission on Women to hear from Mamava Lactation Pods speaker

The Commission on Women will meet to approve minutes from August 25, 2025, and host a special speaker. The meeting includes a general discussion period.

womenpublic-healthcommission
✓ Decided: Commission unanimously approved August 25, 2025 minutes

The Commission on Women voted unanimously to approve the minutes from the August 25, 2025 meeting. A guest from Mamava presented information about lactation pods and potential partnerships, but no actions or votes were taken on those topics. The meeting adjourned at 5:00 p.m.

Mon Sep 22, 2025

City Council

Committee on Real Estate to review property leases and annexations

The Committee on Real Estate is meeting to consider several lease agreements, easements, and property transfers. The body will also review two annexation requests in West Ashley.

real-estateleasingannexationhousingpublic-land
✓ Decided: Committee approved a two‑year renewable license for 5½ Alexander Street

The Committee on Real Estate unanimously approved the August 18, 2025 meeting minutes. It also unanimously approved an amendment to the Calhoun Monument Society lease to a six‑month term with an option to renew six months, and a transfer ordinance for a two‑year renewable license at 5½ Alexander Street. Additional approvals included a contract template for selling ten affordable townhomes at 1555 Juniper Street and an easement for a permanent bicycle and pedestrian counter on the West Ashley Bikeway.

Mon Sep 22, 2025

Board of Architectural Review

BAR staff reviews 52 permits for roofs, signs, renovations

This is a list of 52 staff-level permit approvals for the week of September 22-26, 2025. Items include roof replacements, sign installations, painting, and renovations requiring architectural review. No public hearings or board discussions are scheduled.

architectural-reviewpermitshistoric-preservationcharlestonstaff-approvals
Fri Sep 19, 2025

Commission on Disability Issues

Disability commission to discuss retail accessibility, tourism

The Mayor's Commission on Disability Issues will hear a presentation on city tourism from Amy Southerland, Livability and Tourism Director. The commission will also discuss planning visits to retail establishments and restaurants, likely to assess accessibility. The ADA Coordinator will provide a report. Public comment is invited.

disabilitytourismaccessibilityadapublic-commentretail
Thu Sep 18, 2025

Charleston Basin Flood Action Committee

Army Corps partnership, Battery Extension update on flood committee agenda

The Charleston Basin Flood Action Committee will receive updates on flood statistics, stormwater management, and resilience projects, including a groundwater monitoring partnership with the College of Charleston, the Rosemont & Bridgeview Resilience Plan by Black & Veatch, and an Army Corps partnership update on the Battery Extension and Tidal & Inland Flood Risk Study. Committee discussion and a public comment period follow.

floodresiliencearmy-corpsstormwatergroundwaterbattery-extensioncommitteecharleston
Thu Sep 18, 2025

Technical Review Committee

Review of Standard Grove multi‑family site plan at 205 Promenade Vista St

The Technical Review Committee will consider eight site‑plan, subdivision, and road‑construction applications, including a new 62‑unit multi‑family project (Standard Grove) and several Magnolia and Tuxbury Farm developments. Each item will be reviewed for compliance with zoning, engineering, and planning requirements. No decisions are recorded in the agenda; the committee will discuss and potentially approve the proposals.

zoningsite-planssubdivisionshousingroads
Thu Sep 18, 2025

Technical Review Committee

TRC reviews Magnolia Townhome infrastructure (187 lots) and Tuxbury Farm (83 lots)

The Technical Review Committee will review nine site plans and subdivision applications via Zoom. Most items, including the Magnolia Townhome and Tuxbury Farm projects, are pending stormwater comments. No final decisions are made at this stage; results are either 'Revise and Return' or 'Open pending delivery of Stormwater comments.'

site-planssubdivisionshousingroadsstormwatercharleston
Thu Sep 18, 2025

Community Development

Committee to review Zoning Ordinance changes and HARCC legislation

The Community Development Committee will discuss proposed changes to the Zoning Ordinance and HARCC enabling legislation. The body will also consider a resolution to certify a specific property as an abandoned building.

zoningordinanceshort-term-rentalstree-protectionabandoned-buildings
✓ Decided: Committee certified 179 & 181 Fishburne St as abandoned building

The Community Development Committee approved the August 21, 2025 minutes and deferred consideration of the HARCC enabling legislation changes. It also voted to expedite the proposed zoning ordinance updates and certified the property at 179 and 181 Fishburne Street as an abandoned building. The meeting adjourned at 3:41 p.m.

Thu Sep 18, 2025

Livability Review Board

Board reviews vacant structure at 8 Ducs Ct.

The Livability Review Board will hold a hearing to review the status of a vacant structure at 8 Ducs Ct. (circa 1940) on the East Side. Staff will also update the board on previously reviewed properties.

vacant-structureslivabilityhousingproperty-maintenanceeast-side
Thu Sep 18, 2025

Recreation Committee

Committee to discuss private teams and field usage recommendations

The Recreation Committee will hear a presentation and recommendations on private teams and field usage, and receive an update on Parks and Recreation Master Plan General Obligation Bonds. They will also review recreation and parks updates, sponsorship information, and field reservation/website information.

recreationparksfield-usageprivate-teamsbondsmaster-plan
✓ Decided: Recreation Committee unanimously approved the August 21 minutes

The Committee voted unanimously to approve the minutes from the August 21, 2025 Recreation Committee meeting. No other motions or votes were recorded. The meeting included updates on the Parks and Recreation Master Plan and bond financing, but no decisions were made on those items.

Wed Sep 17, 2025

Planning Commission

Planning Commission to consider short-term rental ordinance amendments

The Planning Commission will consider amendments to the short-term rental ordinance to clarify terms, submittal and review criteria, and penalties. They will also vote on declaring the city GIS as the official method for measuring zoning district boundaries. A concept plan for a subdivision on Clements Ferry Road is up for approval, and the commission will discuss potential zoning approaches for payday lenders and title loans.

planning-commissionzoningshort-term-rentalssubdivisiongispayday-lendersmedical-district
✓ Decided: Planning Commission unanimously approves major subdivision and multiple zoning changes

The commission approved the concept plan for the Atlantic St. Thomas subdivision, creating a public right‑of‑way. It also approved an amendment to Chapter 54 of the city code to make the GIS scale the official measurement method. Zoning for 1251 Wisteria Road and dozens of properties on Teracotta, Ironstone, Amethyst, and Kaolin streets was approved as Single‑Family Residential. The short‑term rental ordinance amendments were deferred for further review.

Wed Sep 17, 2025

Planning Commission

Planning Commission to consider short-term rental ordinance amendments

The Planning Commission will vote on recommendations for two ordinance amendments, including clarifying short-term rental definitions, submittal criteria, and penalties, and declaring the city GIS scale as the official method for measuring zoning district boundaries. They will also consider a concept plan for road dedication and subdivision at 2815 Clements Ferry Road (Atlantic St. Thomas), and hear updates on the Medical District Overlay and City Housing Strategy. Additionally, the commission will discuss how to approach payday lenders and title loans in the zoning ordinance and recommend zoning changes for several properties to Single Family Residential (SR-2).

zoningshort-term-rentalshousingplanningclements-ferrywest-ashleycainhoypayday-lenders
Wed Sep 17, 2025

Planning Commission

Planning Commission defers short-term rental ordinance amendments

The commission approved minutes and several rezonings from R-4 to SR-2, but deferred proposed wording changes to the Short-Term Rental Ordinance. They also discussed how to approach payday lenders through zoning and received updates on the Medical District Overlay and housing strategies.

planning-commissionzoningshort-term-rentalsmedical-districtpayday-lenderssubdivisioncharleston
Wed Sep 17, 2025

Ad Hoc Budget Advisory Committee

Budget committee to review planning, engineering, facilities requests

The Ad Hoc Budget Advisory Committee will meet to review budget requests from the Planning, Permitting and Engineering Section and the Facilities and Capital Projects Section. The meeting is a conference call with no public hearing or voting items listed.

budgetplanningpermittingengineeringfacilitiescapital-projectsad-hoc-committee
Tue Sep 16, 2025

Public Safety Committee

Police seeks $298K DNA grant, microchipping rule, Fire Station 20 site

The Public Safety Committee will vote on applying for a $298,063.85 federal grant to hire a forensic examiner and buy DNA analysis software. It will also consider an ordinance allowing animal shelter staff to microchip pets. An executive session is scheduled to discuss a location for Fire Station 20 and potential land acquisition, including condemnation.

public-safetypolicedna-labgrantmicrochippingfire-stationland-acquisition
✓ Decided: Police DNA grant application approved; animal microchipping ordinance ratified

The Public Safety Committee approved the police department's request to apply for a $298,063.85 DNA Capacity Enhancement grant. The committee also ratified an ordinance amending Chapter 5 to require microchipping of dogs and cats by animal shelter personnel. No vote tallies were recorded in the minutes.

Tue Sep 16, 2025

Board of Zoning Appeals Zoning

Board to consider special exception for office expansion at 80 Ashley Ave

The Board of Zoning Appeals will hear requests for variances and special exceptions to zoning rules, including an office expansion at 80 Ashley Ave and several residential projects. They will also review minutes from the previous meeting.

zoningvariancesspecial-exceptionsboard-of-zoning-appealscharleston
Tue Sep 16, 2025

Board of Zoning Appeals Zoning

Board to decide on two zoning appeals: office expansion and off-site sign

The Board of Zoning Appeals will hear two deferred applications: a request for special exceptions to vertically extend non-conforming rear and side setbacks at 80 Ashley Ave. for a second-floor office, and a variance to allow an off-site sign at 1705 Hollydale Ct. Both items were previously deferred for re-noticing or corrections. The board may approve, approve with conditions, deny, or defer each application.

zoningboard-of-zoning-appealsvariancesspecial-exceptionscharlestonsignsnon-conforming
Tue Sep 16, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves several property requests and denies others

The Charleston Board of Zoning Appeals met on September 16, 2025, to review and decide on various zoning applications. The board approved requests for property modifications, including a variance for a rear addition and a special exception for an off-premises sign, while denying requests for a variance to exceed lot occupancy and a variance for a rear addition.

zoningboard-of-appealsvariancespecial-exceptioncharlestonproperty-approvalconstruction
Tue Sep 16, 2025

Board of Zoning Appeals Zoning

Board to decide variance for historic 56 Bull St. addition despite opposition

The Board of Zoning Appeals will hear two variance requests. At 56 Bull St., owner Kevin Mills seeks to build a rear addition with a 10'8" setback (25' required) on a National Register property. More than 71 neighbors signed a petition opposing the variance, citing hardship concerns and impact on adjacent properties. At 1850 Central Park Rd., Terri Thomas requests a variance to create a lot with 0 feet of frontage (50' required). The board will also consider public comments submitted in advance.

zoningvariancehistoric-preservationboard-of-zoning-appealscharlestonpublic-hearinglot-frontageland-use
Mon Sep 15, 2025

Design Review Board

Design Review Board to review 8 commercial projects

The Design Review Board will review eight commercial projects, including a hotel, a bank, and a community center, on September 15 and 16, 2025.

charlestondesign-review-boardcommercialzoningconstructionhotelsigns
Mon Sep 15, 2025

Board of Architectural Review

Board reviews substantial interior renovation at 32 Cumberland St with historic variance

The Charleston Board of Architectural Review will hold a staff‑approval meeting to consider 61 quick‑plan permit applications. Items include fence replacements, roof repairs, mechanical system installations, interior renovations, and demolitions. The board will decide whether to approve each application as submitted, including a substantial commercial interior renovation at 32 Cumberland St that requires an approved historic variance.

historic-preservationrenovationdemolitionroofingmechanicalbuilding-code
Thu Sep 11, 2025

Accommodations Tax Advisory Committee

Committee to approve CVB accommodations tax spending plan

The State Accommodations Tax Advisory Committee will meet on August 14, 2025, to consider approving the 2025-2026 Charleston Area Convention and Visitors Bureau spending plan for state accommodations tax. The committee will also vote on minutes from its November 2024 meeting and handle other business.

accommodations-taxcvvbtourismspending-plancommitteecharleston
✓ Decided: Committee unanimously approved 2025‑2026 Visitors Bureau spending plan

The State Accommodations Tax Advisory Committee voted unanimously to approve the 2025‑2026 Charleston Area Convention and Visitors Bureau Spending Plan. The committee also voted unanimously to approve the minutes from the November 18, 2024 meeting. No other actions were taken.

Thu Sep 11, 2025

Human Affairs and Racial Conciliation Commission

Commission to hear homelessness/housing presentation, discuss affordable housing

The Human Affairs and Racial Conciliation Commission will hear a joint presentation from multiple organizations on homelessness and housing strategies. Old business items include discussions on unhoused/rapid/affordable housing, youth initiatives, Commons St Commons, and a proposed HARCC Ordinance. The meeting also includes a public comment period and approval of previous minutes.

homelessnesshousingaffordable-housingyouthordinanceracial-conciliationpublic-comment
✓ Decided: Commission unanimously affirmed History Commission recommendations

The commission approved the minutes of the August 14, 2025 meeting unanimously. The commission also voted unanimously to affirm the list of recommendations adopted by the Commission on History regarding the Coming St. Commons Project.

Thu Sep 11, 2025

Technical Review Committee

TRC reviews multiple site and road plans, including Jubilee Road mixed‑use project

The Technical Review Committee will consider early site plans, preliminary plats, and road construction plans for several developments across Charleston. Items include a Phase 3 site plan for Courier Square, a mixed‑use project on Maybank Highway, and various single‑family residential plats and road plans. The committee will discuss the proposals but no final approvals are indicated in the agenda.

zoningsite-planssubdivisionsroad-constructiondevelopment
Thu Sep 11, 2025

Technical Review Committee

Technical Review Committee to review 13 site and subdivision plans

The City of Charleston Technical Review Committee is reviewing site plans, subdivision plats, and road construction plans. The committee evaluates these proposals for future residential and mixed-use developments across several city districts.

zoningsubdivisionssite-planshousingroadsdevelopment
Thu Sep 11, 2025

Board of Architectural Review

Partial demolition and new second-story addition at 1010 Ashley Avenue

The Board of Architectural Review – Small will consider 15 applications for alterations to historic properties, including partial demolitions, new construction, window replacements, and a roof replacement after the fact. Two items have been deferred (68 1/2 Lee Street by the applicant, 170 Wentworth Street by staff). Decisions on conceptual and final approvals will be made.

historic-preservationdemolitionnew-constructionwindow-replacementpublic-hearing
Thu Sep 11, 2025

Board of Architectural Review

Board to review partial demolition and second-story addition at 1010 Ashley Avenue

The Board of Architectural Review - Small will consider a request for partial demolition of the rear roof and conceptual approval for a new second-story addition at 1010 Ashley Avenue in Wagener Terrace. The existing c. 1938 bungalow would increase from 992 SF to 1,688 SF. The board will also review the minutes from the August 28, 2025 meeting.

historical-preservationarchitectural-reviewdemolitionsecond-story-additionwagener-terracecharleston
Thu Sep 11, 2025

Board of Architectural Review

Board denies historic demolition and window replacement requests

The Charleston Board of Architectural Review denied three requests to demolish portions of historic homes and replace original windows, citing concerns about the scale and character of the proposed changes. The board approved new construction projects and a preliminary design modification after reviewing site visits and public comments.

charlestonhistoric-districtzoningdemolitionarchitectureconstructionboard-of-architectural-review
Thu Sep 11, 2025

Board of Architectural Review

Board to review partial demolition and second-story addition at 1010 Ashley Avenue

The Board of Architectural Review Small will consider 15 applications for alterations, demolitions, and new construction in historic districts. Items include a partial demolition and second-story addition at 1010 Ashley Avenue, a new single-family home at 13 Trumbo Street, and an after-the-fact roof replacement at 23 America Street. One item (68 ½ Lee Street) has been deferred by the applicant. Public comments have been submitted for several properties.

board-of-architectural-reviewhistoric-preservationdemolitionnew-constructioncharlestonpublic-hearing
Wed Sep 10, 2025

Special Events Committee

Committee will discuss upcoming special events and road closures

The Charleston Special Events Committee meeting on September 10, 2025 will receive an update from the Special Event Manager and discuss a series of upcoming events. Items include the James Island Connector Run, St. John's High School Homecoming Parade, Burke High School Homecoming, Hispanic Heritage Celebration, and several later festivals and block parties. No formal actions are listed; the discussion will focus on event details and any required street closures.

special-eventsroad-closuresfestivalsparadescommunity-events
Wed Sep 10, 2025

Special Events Committee

St. John's High School homecoming parade tabled over police staffing conflict

The committee approved multiple special event permits including the James Island Connector Run, Burke High School homecoming, Hispanic Heritage Celebration, and others. A parade for St. John's High School was tabled due to police staffing conflicts with another permitted event. General updates were given including the return of the Special Event Manager from leave.

special-eventsparadesfoot-racesfestivalspolice-staffingdowntown-charlestonpermits
Wed Sep 10, 2025

Board of Architectural Review

BAR-L to review Citadel stadium upgrades, MUSC repairs, and more

The Board of Architectural Review – Large will consider several applications for work in historic districts, including a stadium upgrade at The Citadel, exterior repairs at MUSC properties, a storefront restoration, and new construction signage. A request for full demolition at 280 Meeting Street was deferred by the applicant. Public comment is accepted in person or by written submission.

architectural-reviewhistoric-districtcharlestoncitadelmuscsignagestorefrontstadium
Wed Sep 10, 2025

Board of Architectural Review

Board will consider demolition of historic 280 Meeting Street building

The Charleston Board of Architectural Review will review three agenda items. Item 1 requests full demolition of the two‑story principal structure (c. 1910s), one‑story addition (1951) and rear accessory structure (1952) at 280 Meeting Street, Council District 8, Height Districts 3‑4, Old and Historic District. Item 2 seeks final approval of a mock‑up panel for 244 Saint Philip Street, Council District 4, Height District 2.5‑3, Old City District. Item 3 presents a preliminary approval request to upgrade stadium seating and add additional facilities at 68 Hagood Avenue, Council District 6, Height District 4, Historic Corridor District.

demolitionhistoriczoningconstructionstadiumarchitecturepreservation
Wed Sep 10, 2025

Board of Architectural Review

BAR approves Citadel stadium upgrades, defers demolition at 280 Meeting St.

The Board of Architectural Review – Large approved several projects including stadium upgrades at The Citadel (68 Hagood Avenue), exterior restorations at MUSC properties (268 & 274 Calhoun Street) and 39 Broad Street, and a mock-up panel at 244 Saint Philip Street. A full demolition request at 280 Meeting Street was deferred by the applicant, and a signage package at 40 Line Street was deferred for restudy.

architectural-reviewhistoric-districtdemolitionnew-constructionrestorationsignagecitadelmusc
Wed Sep 10, 2025

Board of Architectural Review

Board to review Citadel stadium upgrades, cannon concerns

The Board of Architectural Review – Large will consider six applications, including a preliminary approval for stadium seating upgrades and new facilities at The Citadel (68 Hagood Avenue), which drew public comments about cannon vibrations affecting nearby homes. Other items include a deferred demolition at 280 Meeting Street, a mock-up panel at 244 Saint Philip Street, and conceptual approvals for exterior work at MUSC historic houses (268 & 274 Calhoun Street), a storefront restoration (39 Broad Street), and a signage package (40 Line Street). Public comments and Preservation Society position statements are included in the record.

architectural-reviewhistoric-districtcitadelstadiumpreservationpublic-commentdemolitionsignage
Wed Sep 10, 2025

Ad Hoc Budget Advisory Committee

Budget committee reviews police and fire department funding requests

The Ad Hoc Budget Advisory Committee will meet on September 10, 2025. The committee will review budget requests submitted by the Charleston Police Department and the Charleston Fire Department. The meeting also includes a moment of silence, other business, and adjournment.

budgetpolicefirecity-councilcharleston
Tue Sep 9, 2025

City Council

Council to consider $13.3M federal funding for Battery Extension flood project

The City Council will vote on several major flood resilience initiatives, including authorizing the mayor to execute a design agreement releasing $13.325 million in federal funding for the Battery Extension Project. Council will also consider a $4.56 million change order for the Municipal Operations Complex and multiple rezoning requests.

flood-resiliencebattery-extensionzoningbudgetcontractspublic-worksstormwater
✓ Decided: City Council unanimously renames Howle Avenue Park to Roman Myron Buck Park

The council approved the minutes from the August 19, 2025 meeting by unanimous vote. It also voted unanimously to rename Howle Avenue Park as "Roman Myron Buck Park." No other motions were adopted during the meeting.

Tue Sep 9, 2025

City Council

City Council considers $4.5M change order for Municipal Operations Complex

The Committee on Ways and Means is reviewing several funding requests for flood risk management and infrastructure projects. The body is deciding on contract amendments for the Battery Extension Project and the Municipal Operations Complex. Other items include grant applications for drainage improvements and police forensics.

infrastructureflood-managementbudgetcontractsstormwaterpublic-safety
✓ Decided: Committee approves $4.56M change order for Municipal Operations Complex

The Ways and Means Committee approved a $4,557,210 change order for the Municipal Operations Complex, authorized several resilience and flood‑risk projects totaling $5.89M, accepted an $81,467 forensic science grant, and deferred the 2025 holiday budget. All approvals were voted on, with most unanimous and one non‑unanimous vote.

Mon Sep 8, 2025

Design Review Board

Design Review Board to review 16 commercial and sign permit applications

The Design Review Board will review 16 staff-approved permit applications for commercial renovations, new construction, and signage across Charleston.

zoningpermitscommercialsignageconstructiondrbcharleston
Mon Sep 8, 2025

Board of Architectural Review

Board of Architectural Review staff review 51 permit applications

The Board of Architectural Review staff processed 51 quick plan reviews for various residential and commercial properties. The items consist of routine maintenance, renovations, and new construction approvals.

zoningrenovationpermitsarchitecturecommercial-development
Thu Sep 4, 2025

Technical Review Committee

TRC to review 70-lot Long Savannah N9 Phase 4 subdivision

The Charleston Technical Review Committee will review nine site plans, subdivision plats, and road construction plans. Items include a multi-family affordable housing project at 1890 Ashley River Rd, a building demolition for the College of Charleston at 159 Calhoun St, and a 70-lot single-family subdivision in the Long Savannah PUD on West Ashley.

technical-review-committeesite-planssubdivisionsaffordable-housingzoningdevelopmentcharleston
Thu Sep 4, 2025

Technical Review Committee

TRC reviews preliminary plat for 70-lot Long Savannah Phase 4

The Technical Review Committee is reviewing several site plans and subdivision plats, including a multi-family affordable housing project, a townhome development, drainage improvements, and a large single-family subdivision. Most items are at the revision or pending comment stage, with no final decisions expected at this meeting.

site-planssubdivisionsaffordable-housingtownhomesdrainagedemolitionparkssingle-family-development
Wed Sep 3, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to hear tree-removal variance requests on three properties

The Board of Zoning Appeals – Site Design will consider three variance requests related to tree removal at properties on North Market Street, Fenwick Hall Allee, and Henry Tecklenburg Drive. One previously advertised item for Doughty Street (MUSC Medical District) has been withdrawn. The meeting also includes review of minutes from prior meetings.

zoningtree-removalvarianceboard-of-zoning-appealscharlestonland-use
Wed Sep 3, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals reviews tree removal requests

The Board of Zoning Appeals-Site Design is meeting to consider variance requests for the removal of protected and grand trees. The board will also vote on the approval of meeting minutes from May, July, and August 2025.

zoningtree-removalvariancessite-design
Wed Sep 3, 2025

Board of Zoning Appeals Site Design

Board approves tree removal variances for three properties, including 15 grand trees

The Charleston Board of Zoning Appeals – Site Design approved a one-year extension of a variance for tree removal on North Market Street, and approved with conditions variances to remove grand trees at Fenwick Hall Allee and 2275 Henry Tecklenburg Drive. The Board also approved minutes from prior meetings and deferred one set of minutes. An application from MUSC to relocate trees on Doughty Street was withdrawn by the applicant.

board-of-zoning-appealssite-designtree-removalvariancescharlestonwest-ashleyjohns-island
Wed Sep 3, 2025

Commission on History

Commission will consider amending the city charter provision for the Commission on History

The Commission on History will review an ordinance to amend Chapter 2, Article IV, Division 9 of the City Code, which governs the Commission itself. The meeting will also set the date and time for the October session and discuss an update on the Protect and Respect the Bodies Under the YWCA issue requested by Commissioner Fraser. Additional items include routine matters such as minutes, new member introductions, and miscellaneous business.

historyordinancecity-codemeetinggovernance
✓ Decided: Commission adopted memo actions on the 106 Coming Street burial‑site project

The History Commission approved minutes item B1 and the ordinance amendment item D unanimously. It moved the October meeting to October 8, 2025 at 4:00 p.m. by unanimous vote. The commission also adopted five recommendations from the Protect and Respect the Bodies memo, with Commissioners David McCormack and Peg Eastman abstaining.

Wed Sep 3, 2025

Ad Hoc Budget Advisory Committee

Budget advisory committee reviews community services and public works requests

The Ad Hoc Budget Advisory Committee will review budget requests for the Community Services and Public Works sections. The meeting also includes a moment of silence and other business. No specific dollar amounts or proposals are detailed in the agenda.

budgetcommitteecommunity-servicespublic-works
Tue Sep 2, 2025

Design Review Board

DRB will consider preliminary approval for a market conversion at 1919 Maybank Hwy.

The Charleston Design Review Board will meet virtually on September 2, 2025 to review several design applications. The board will consider preliminary and conceptual approvals for renovations, additions, and new construction at sites in James Island, West Ashley, Johns Island, and Cainhoy. Public comments may be submitted online or in writing by the meeting day. The agenda also includes a review of minutes from the August 4, 2025 meeting.

design-reviewconstructionrenovationzoningpublic-comments
✓ Decided: Preliminary approval granted for 1,919 Maybank Hwy renovation

The Design Review Board gave preliminary approval to the Maybank Highway renovation project with a 6‑0 vote. It also approved the partial demolition of the St. Peter’s Church at 1393 Miles Dr. and gave conceptual approval for both phases of that church’s renovation. Additional projects receiving approval included the 1731 Savannah Hwy renovation, two grey‑shell buildings on Hollydale Ct., and four new medical buildings at Clements Ferry and Cainhoy Rd.

Tue Sep 2, 2025

Design Review Board

Design Review Board to consider market conversion at 1919 Maybank Hwy

The Design Review Board will review a request for preliminary approval to renovate and add to an existing building at 1919 Maybank Hwy. The project intends to convert the structure into a market.

zoningcommercial-developmentrenovationparkinglandscaping
Tue Sep 2, 2025

Design Review Board

Charleston Design Review Board approves 6 projects, defers 1

The Charleston Design Review Board approved preliminary and conceptual approvals for six development projects, including a market renovation, church repairs, and medical buildings. One storage building proposal was deferred due to design concerns.

design-reviewzoningconstructioncharlestoncouncil-districts
Tue Sep 2, 2025

Design Review Board

Design Review Board to consider church renovation and new commercial buildings

The Design Review Board will review several requests for conceptual and preliminary approval regarding building renovations and new constructions. A significant portion of the agenda focuses on the multi-phase restoration of a church in West Ashley.

zoningcommercial-developmentrenovationmedical-facilitieschurch
Tue Sep 2, 2025

Design Review Board

DRB reviews emergency department construction at 2080 Sam Rittenberg Blvd

The Design Review Board is processing staff approvals for several commercial projects. The most significant item involves the demolition of a former Red Lobster to build a new one-story freestanding emergency department.

commercial-developmenthealthcaresignagepermitsdesign-review
Tue Sep 2, 2025

Board of Architectural Review

Board reviews 39 staff permits including major roof replacement at 12 Moultrie St

The Charleston Board of Architectural Review will consider 39 staff‑approved permit applications. Items include roof replacements, HVAC changes, fence installations, demolition of asbestos siding, and interior remodels. Each application will receive a quick plan review on the scheduled dates.

roofinghvacfencingdemolitionrenovation
Tue Sep 2, 2025

Board of Zoning Appeals Zoning

Board considers wine bar parking variance and self-storage facility requests

The Board of Zoning Appeals will review minutes and eight new applications for variances and special exceptions. Items include requests to waive parking requirements for a wine bar and outdoor patron area, allow a self-storage facility with boat/trailer storage, and grant setback or lot occupancy relief for residential additions.

zoningvariancesspecial-exceptionsoff-street-parkingself-storagesetbackslot-occupancyboard-of-zoning-appeals
Tue Sep 2, 2025

Board of Zoning Appeals Zoning

Board considers no-parking variance for wine bar at 106 Columbus St.

The Board of Zoning Appeals will decide on a variance request to allow a proposed wine bar at 106 Columbus St. to operate with no off-street parking (4 spaces required). Staff recommends denial. The board will also consider a request for a one-year extension of vested rights for a property at 71 Bull St. to allow a 2-story addition and accessory building. Approval of previous meeting minutes is also on the agenda.

zoningvariancesparkingwine-barvested-rightsspecial-exceptionsboard-of-zoning-appealscharleston
Tue Sep 2, 2025

Board of Zoning Appeals Zoning

Board denies parking variance for proposed wine bar at 106 Columbus St.

The Board of Zoning Appeals met on September 2, 2025, and issued decisions on eight zoning applications. They denied a variance to allow a wine bar with no off-street parking at 106 Columbus St., and approved seven other requests, several with conditions. The board also approved minutes from the prior meeting.

zoningboard-of-zoning-appealsvariancesspecial-exceptionsparkingcharleston
Tue Sep 2, 2025

Board of Zoning Appeals Zoning

Charleston BZA considers four zoning requests for home additions

The Board of Zoning Appeals will consider four requests for special exceptions and variances to allow home additions that exceed current setback requirements. The items include a first-year extension of vested rights for a home at 71 Bull Street and requests for vertical setbacks and lot occupancy increases at 105 King Street, 20 Alberta Avenue, and 6 Trumbo Street.

zoningboard-of-appealshome-additionsetbacksspecial-exceptionvariancecharleston
Thu Aug 28, 2025

Technical Review Committee

TRC reviews Somersby subdivision, 704-lot mixed-use development in West Ashley

The Technical Review Committee is reviewing 10 site plans and subdivision concept plans, including several large-scale residential developments. Major items include the 293.69-acre Somersby Subdivision (704 lots, 703 units) in West Ashley, the 273-unit Woodfield Magnolia Phase 1 on the Peninsula, and a revised plan for 86 affordable housing units at 275 Huger Street. The committee also considers smaller projects such as multi-family units, single-family homes, storm drainage improvements, and an obstacle course for The Citadel. All items are reviewed via eReview.

technical-review-committeesite-planssubdivisionsaffordable-housingmixed-use-developmentwest-ashleypeninsula
Thu Aug 28, 2025

Technical Review Committee

Charleston TRC reviews 10 site plans and subdivisions

The Charleston Technical Review Committee will review ten site plans and subdivision concepts, including affordable housing and mixed-use developments, via Zoom.

zoninghousingdevelopmentstormwatersubdivisionplanning
Thu Aug 28, 2025

Board of Architectural Review

Board reviews 14 applications and adopts North Central Area Character Appraisal

The Charleston Board of Architectural Review – Small will review minutes from its August 14 meeting and consider fourteen separate applications for demolition, additions, and other alterations to historic properties. Several applications request partial or full demolition of existing structures, while others seek conceptual approval for new construction or modifications. The board will also vote on adopting the North Central Area Character Appraisal to guide future reviews in that neighborhood.

architectural-reviewhistoric-preservationdemolitionnew-constructionarea-appraisal
Thu Aug 28, 2025

Board of Architectural Review

Board to review partial demolition, second-story addition at 66 Cypress Street

The Board of Architectural Review – Small will consider an application for partial demolition of the rear façade and roof, window replacement, and removal of brick veneer on front porch columns at 66 Cypress Street in the North Central neighborhood. The board will also review minutes from its August 14 meeting. A separate item at 1010 Ashley Avenue has been deferred by the applicant.

barhistoric-preservationdemolitionnorth-centralcharlestonarchitectural-review
Thu Aug 28, 2025

Board of Architectural Review

Board of Architectural Review denies demolition of 148 Smith Street

The Board of Architectural Review reviewed several demolition and alteration requests. The board denied a full demolition request for 148 Smith Street, citing 'demolition by neglect,' and required stabilization within 60 days.

zoningdemolitionhistoric-preservationarchitecture
Thu Aug 28, 2025

Board of Architectural Review

BAR-S to consider adopting North Central Area Character Appraisal

The Board of Architectural Review Small (BAR-S) will consider adopting the North Central Area Character Appraisal, which would guide future development decisions in the neighborhood. The board also reviews multiple demolition and alteration applications, including full demolitions at 5 North Hanover Street and 148 Smith Street, and a partial demolition at 1010 Ashley Avenue. Several items have been deferred or withdrawn by applicants.

historic-preservationdemolitionarchitectural-reviewnorth-centralcharacter-appraisalcharleston
Wed Aug 27, 2025

Special Events Committee

Committee to discuss MOJA Arts Festival, Reindeer Run, and other event permits

The Special Events Committee will approve minutes from August 13, receive an update on a pending application for the Burke Homecoming Game, and discuss eight event permit applications. Applicants are present for the CofC Homecoming Parade and MOJA Arts Festival; the remaining applications are discussed without the applicant present.

special-eventspermitsparadesfestivalsstreet-closuresfoot-racescommunity-events
Wed Aug 27, 2025

Special Events Committee

Committee approves CofC parade, tables Reindeer Run

The Special Events Committee approved several event applications, including the College of Charleston Homecoming Parade and the MOJA Arts Festival concert, with conditions. Other applications, such as the St. John's High School parade, James Island Connector Run, Second Line Parade, and the Reindeer Run 5K, were tabled pending further details or logistical adjustments. The committee also received updates on a future application for the Burke Homecoming Game.

special-eventsparadesstreet-closuresfoot-racescharlestonapprovalstabling
Tue Aug 26, 2025

Planning Commission

Planning Commission to consider Medical District rezoning

The Planning Commission will hold a special meeting to consider a request to add approximately 61.89 acres to the Medical District Overlay Zone. The applicant for this rezoning is the City of Charleston.

rezoningmedical-districtland-use
✓ Decided: Planning Commission heard medical district overlay request but took no action

The commission reviewed a request to add a Peninsula Medical University Overlay Zone covering about 61.9 acres in Council Districts 6 & 8. Staff and MUSC presented the proposal and the public offered both support and concerns. No vote or formal decision was recorded during the meeting.

Tue Aug 26, 2025

Planning Commission

Planning Commission to consider expanding Medical District Overlay Zone

The Planning Commission will review a request to add approximately 61.89 acres on the Peninsula to the Medical District Overlay Zone. This action would apply specific land use and design standards to properties owned by the Medical University of South Carolina and affiliated entities.

zoningmedical-districtpeninsulaland-use
Tue Aug 26, 2025

Planning Commission

Planning Commission approves 61.89-acre Medical District overlay rezoning

At a special meeting, the Charleston Planning Commission voted 9-0 to add approximately 61.89 acres to the Medical District Overlay Zone on the Peninsula. The rezoning covers dozens of parcels owned by MUSC, MUHA, and other entities, and was proposed by the City of Charleston.

zoningmedical-districtoverlayplanning-commissionrezoningcharleston
Tue Aug 26, 2025

Planning Commission

Planning Commission to consider Medical District rezoning for MUSC

The Planning Commission is reviewing a request to add approximately 61.89 acres to the Medical District Overlay Zone. The applicant, City of Charleston, seeks this rezoning on behalf of owners including MUSC and other partners. Public comments express mixed views regarding the need for a specialized cancer hospital versus concerns over flooding, traffic, and building heights.

rezoningmedical-districtmuscurban-planningpublic-comment
Tue Aug 26, 2025

Planning Commission

Adopt Peninsula Medical University District Overlay Zone regulations

The Planning Commission will consider the Peninsula Medical University District Overlay Zone ordinance. The ordinance sets land‑use and design standards for Medical University properties, adds permitted uses, and modifies existing zoning rules. It also changes height limits, parking requirements, tree‑removal procedures, and storm‑water review processes.

zoningdevelopmenthousingparkingstormwatertreesheight
Mon Aug 25, 2025

Design Review Board

DRB reviews 12 quick-plan items including new commercial building and accessory structures

The Design Review Board is reviewing 12 staff-approved quick-plan permits at this meeting. Items include a new 1,726 sq ft commercial building for an auto oil change business, several accessory garages, a dog spa, a bike barn, a fence installation, and sign replacements. No public hearings or policy changes are on the agenda.

design-reviewcommercialresidentialaccessory-structuresfencessignsquick-plan-review
Mon Aug 25, 2025

Commission on Women

Commission on Women to discuss lactation access and school board issues

The Commission on Women will approve minutes from April 2025 and hear presentations from a Charleston County School Board member and a representative from WREN regarding lactation access in South Carolina.

commissionwomenschool-boardhealthpublic-meeting
✓ Decided: Commission unanimously approved April 28, 2025 minutes

The Commission on Women voted unanimously to approve the April 28, 2025 meeting minutes. Guest presenters discussed lactation‑access proposals and updates to the Charleston County School District budget and recovery efforts. The meeting was adjourned at 5:18 p.m.

Mon Aug 25, 2025

Board of Architectural Review

BAR staff to approve 59 permit applications, including triplex conversion at 20 King St

This is a review of 59 permit applications for exterior alterations, repairs, and new construction in historic districts. All items are staff-level Quick Plan Reviews; no public hearings are scheduled.

historic-preservationbuilding-permitsarchitectural-reviewcharlestonquick-plan-review
Mon Aug 25, 2025

Board of Zoning Appeals Zoning

Board to consider special exceptions for three non-conforming setback requests

The Board of Zoning Appeals will hear and vote on three special exception requests to extend non-conforming building setbacks for properties at 95 Spring St., 4 Legare St., and 23 Parkwood Ave. Each request seeks to allow modifications or additions that exceed current setback requirements. The board also will approve minutes from its August 19, 2025 meeting.

zoningvariancesspecial-exceptionsboard-of-zoning-appealscharlestonnon-conforming-setbacks
Mon Aug 25, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals considers 10 special exceptions and variances

The Board of Zoning Appeals will meet on August 25, 2025, to consider 10 applications for special exceptions and variances, including requests to extend non-conforming setbacks for porches, additions, and decks, and to expand an accommodations use.

zoningspecial-exceptionsvariancessetbackshousingcharleston
Mon Aug 25, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves several setback and usage exceptions

The Board of Zoning Appeals reviewed 10 new applications regarding zoning variances and special exceptions. The body approved several requests for non-conforming setbacks and usage expansions, while denying one garage variance and deferring three others.

zoningsetbacksvariancesparkingalcohol-permits
Mon Aug 25, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals reschedules meeting for 5 zoning requests

The Board of Zoning Appeals will hold a special meeting on August 25, 2025, to hear five requests for variances and special exceptions regarding building setbacks, unit expansions, and a garage addition. The meeting was rescheduled from August 19 due to a missed newspaper publication deadline.

zoningsetbacksvariancespecial-exceptioncharlestonbzameeting
Thu Aug 21, 2025

Technical Review Committee

Technical Review Committee to review site plans and subdivisions

The Technical Review Committee is reviewing several site plans, subdivision plats, and road construction plans. The agenda focuses heavily on residential developments in the Cainhoy and West Ashley areas.

zoninghousingroadsdrainagesite-plans
Thu Aug 21, 2025

Technical Review Committee

Technical Review Committee to review 317-unit multifamily development in Cainhoy

The Technical Review Committee will review 10 site plans, subdivisions, and road construction plans, including a proposed 317-unit multifamily development (Woodfield Point Hope 4) that was returned for revisions. Other items include a 103-lot subdivision in West Ashley, drainage improvements in Windermere, and a boat/RV storage facility on Sportsman Island. Decisions range from approvals to requests for revisions.

zoningsite-planssubdivisionshousingcainhoywest-ashleydevelopment
Thu Aug 21, 2025

Human Resources Committee

Committee reviews proposed 2026 healthcare budget with premium increases

The Human Resources Committee will consider approving the proposed 2026 Healthcare Budget, which includes employee premium increases and a total budget of $30,972,240. The committee will also receive a compensation study update and a staffing and retention report. No votes are scheduled on the compensation study or staffing report.

human-resourcesbudgethealthcarecompensationstaffingbenefits
✓ Decided: Committee recommends approval of the 2026 healthcare budget

The Human Resources Committee unanimously approved the May 15, 2025 meeting minutes. It also voted unanimously to recommend that the full Council approve the proposed 2026 healthcare budget. No other actions were taken.

Thu Aug 21, 2025

Resilience & Sustainability Advisory Committee

Committee reviews sustainability metrics and resilience updates

The Resilience & Sustainability Advisory Committee will receive updates on sustainability data tools and resilience partnerships. The meeting includes previews of a new data display and the Rainproof relaunch.

sustainabilityresiliencedata-toolswater-management
Thu Aug 21, 2025

Community Development

Panel to vote on MUSC district overlay and $929k affordable housing loan changes

The committee will consider a request from the Charleston Redevelopment Corporation to restructure $929,791 in City loans for Sea Island Apartments to be deferred and forgivable, enabling refinancing of two deeply affordable housing projects totaling 82 units. Additionally, the committee will discuss a new Peninsula Medical University District Overlay Zone that alters zoning regulations for MUSC-affiliated properties, including removing density limits for housing. Other items include approval of a tax credit for the 1000 King Street former textile mill site and certification of three abandoned building sites.

zoningaffordable-housinghousingcommunity-developmentmusc-overlayloan-modificationtax-creditsabandoned-buildings
✓ Decided: Committee unanimously approved loan modification, housing strategy, and zoning proposals

The committee approved the July 17, 2025 meeting minutes and a request to subordinate and modify loan agreements with the Charleston Redevelopment Corporation. It also moved the Peninsula Medical University District Overlay Zone and the City of Charleston housing strategy proposals to full council for consideration, and approved a tax credit for the 1000 King Street former textile mill site. Additionally, the committee certified three abandoned building sites—35 Prioleau Street, 1091 King Street, and 331 King Street.

Thu Aug 21, 2025

Livability Review Board

Board to review vacant structure at 8 Ducs Ct.

The Livability Review Board will hold a hearing to discuss the status of a vacant structure at 8 Ducs Ct., built around 1940. Staff will also provide updates on properties previously before the board. The meeting includes no other substantive agenda items.

vacant-buildingshousinglivabilitypublic-hearingcharleston
Thu Aug 21, 2025

Recreation Committee

Recreation Committee to hear recreation and parks updates

The Recreation Committee will consider minutes from June 18, 2025, and hear updates on recreation and parks, including capital projects and maintenance. No specific proposals or votes are on the agenda; the meeting is largely procedural with informational reports.

recreationparkscapital-projectsmaintenancecommittee-meeting
✓ Decided: Committee unanimously approved June 18, 2025 meeting minutes

The Recreation Committee voted unanimously to approve the minutes from its June 18, 2025 meeting. No other motions, approvals, or denials were recorded during the August 21 session.

Wed Aug 20, 2025

Planning Commission

Planning Commission meeting on Aug 20, 2025 cancelled, agenda items deferred

The Charleston Planning Commission meeting scheduled for Wednesday, August 20, 2025 was cancelled. The cancellation is due to the deferral of the Mobile Vending Ordinance amendment, and the zoning items originally on the agenda will be moved to the September 17 meeting. A special meeting will still be held on Tuesday, August 26 at 5:00 p.m. Residents may submit written comments by 12:00 p.m. on August 19, 2025 as previously outlined.

planningzoningordinancemeeting-cancellationpublic-commentmobile-vending
Tue Aug 19, 2025

City Council

Council to decide on rezoning 50-acre West Ashley parcel to General Business

The City Council will hold public hearings on seven rezoning proposals, including a 50.55-acre parcel at West Ashley Circle rezoned from Gathering Place to General Business. The council will also vote on a $551,753 school resource officer grant and a $921,019 FEMA grant for elevating three historic properties. Additionally, the Battery Extension Project design agreement and related funding are reported out for future consideration.

zoningpublic-safetygrantsfloodingbattery-extensionhistoric-preservationschools
✓ Decided: Council held recognitions but recorded no formal votes

The council honored Chief Daniel Curia, read a resolution honoring Reverend Darby, and read a proclamation for the James Island Charter High School baseball team. Seven rezoning items were presented for public hearing, but no votes or decisions were recorded. The meeting concluded with the public hearing presentations.

Tue Aug 19, 2025

City Council

Council to weigh $73M in redevelopment bonds for four project areas

The Ways and Means Committee will consider approving up to $73 million in special obligation redevelopment bonds for the Cooper River Bridge, West Ashley, Morrison Drive, and Charleston Neck project areas. Also on the agenda are the CARTA FY26 budget, several grants and contracts for cultural affairs, fire department equipment, stormwater drainage, and police school resource officers. Real estate items include property conveyances, leases, and annexations of multiple parcels.

bondsredevelopmentgrantsflood-mitigationfire-departmentpolicecultural-affairsannexations
✓ Decided: Committee approved $73.5M in special obligation redevelopment bonds

The Committee on Ways and Means unanimously approved the FY26 CARTA budget. It also unanimously approved several bids and purchases, including a $224,547 fire department truck and IT maintenance contracts. The committee approved four special‑obligation redevelopment bonds totaling $73.5 million for the Cooper River Bridge, West Ashley, Morrison Drive, and Charleston Neck projects. Additional approvals included a $480,530 design‑builder contract for temporary fire‑station relocation and a $10 million increase to the Ashley River Crossing federal grant, with the latter passing despite one dissenting vote.

Tue Aug 19, 2025

Board of Zoning Appeals Zoning

BZA to consider adding 72 dry stack slips at Wando Creek Lane

The Board of Zoning Appeals – Zoning will hear five items: a variance for a single-family home setback, a special exception and variance for a rear addition, an amendment to an accommodations use special exception, an amendment to add 72 dry stack slips to an existing boatyard special exception, and a reconsideration of a denied variance. No new applications will be heard due to an advertising error; they are deferred to a special meeting on August 25.

zoningboard-of-zoning-appealsvariancesspecial-exceptionsdry-stack-slipsaccommodationsreconsiderations
Tue Aug 19, 2025

Board of Zoning Appeals Zoning

Board to rule on setbacks and lot occupancy variances for two properties

The Board of Zoning Appeals will hear two cases: a variance to reduce a required side setback at 21 Reid St., and a special exception and variance to extend a non-conforming rear setback and exceed lot occupancy at 41 Woodall Ct. Both are on properties zoned DR-2F.

zoningvariancessetbackslot-occupancyspecial-exceptionboard-of-zoning-appeals
Tue Aug 19, 2025

Board of Zoning Appeals Zoning

Board denies additional 72 dry stack slips at Wando Creek Lane

The Board of Zoning Appeals approved minutes and two variance/special exception requests for properties at 21 Reid St. and 41 Woodall Ct. It denied a special exception amendment for 411 Meeting St. regarding minimum residential units, and denied an amendment to add 72 dry stack slips at Wando Creek Lane. A reconsideration request for 4 Henrietta St. was struck due to improper scheduling. New applications were deferred to August 25 due to a legal advertising error.

zoningvariancesspecial-exceptionsboard-of-zoning-appealsdenialsdry-stack-slipscharleston
Tue Aug 19, 2025

Board of Zoning Appeals Zoning

Board to consider amending 411 Meeting St hotel special exception

The Board of Zoning Appeals – Zoning will hold a public hearing to decide on three applications: a setback variance for a new home at 21 Reid St, an amendment to a 2022 special exception for accommodations at 411 Meeting St, and an amendment to add 72 dry stack slips at Wando Creek boatyard. The board will also hear public comments submitted in advance, including opposition from the Preservation Society regarding the 411 Meeting St hotel project.

zoningboard-of-zoning-appealsvariancesspecial-exceptionshotelshousingboatyardpublic-hearing
Tue Aug 19, 2025

Traffic and Transportation Committee

Charleston Traffic Committee to vote on Lime bike share agreement extension

The Traffic and Transportation Committee is considering a first amendment to extend the City's bike share agreement with Neutron Holdings (Lime Bikes) on a month-to-month basis for up to one year. The amendment includes an updated scope of services, requiring Lime to maintain a local coordinator, increase foot patrols, and provide real-time data access. The program currently operates without public subsidy, with support from the Medical University of South Carolina (MUSC).

transportationbikesharelime-bikescity-contractpublic-transittraffic-committeecharleston
✓ Decided: Committee unanimously approved Lime Bikes contract amendment

The Traffic and Transportation Committee approved the July 15, 2025 meeting minutes and the Lime Bikes contract amendment, both by unanimous vote. The committee also approved the appointment of Code Enforcement Officer Jeffrey Wagner. Updates were given on the Ashley River Crossing, Lowline parking projects, and Riverland Drive/Maybank Highway improvements, but no actions were taken on those items.

Mon Aug 18, 2025

Design Review Board

Board reviewing 10 routine design permits

The Design Review Board is considering 10 staff-level quick plan reviews for commercial signs, electrical, mechanical, and roofing work at various locations. All items are administrative approvals with no public hearings or major policy decisions.

design-reviewpermitssignscommercialelectricalroofingcharleston
Mon Aug 18, 2025

Public Works and Utilities Committee

Battery Extension Project design agreement and $13.3M federal funding discussed

The committee will discuss and report out to City Council several items related to flooding resilience, including a $13.325 million federal design agreement for the Battery Extension Project, a $1.99 million contract amendment for its design, and $1.1 million for a citywide flood risk study. They will also consider approval of a FEMA grant of $871,819.98 for elevating three historic properties, a $163,398.66 drainage outfall contract at Sandcroft Drive, and a $106,004.37 change order for Huger Street drainage improvements. Multiple temporary and permanent encroachments are presented for information or action.

flood-mitigationdrainageinfrastructurefema-grantbattery-extensionencroachmentspublic-works
✓ Decided: Committee approved temporary easements and advanced agenda items K1‑K5

The committee unanimously approved the July 14, 2025 meeting minutes. It then unanimously advanced agenda items K1‑K5 and later approved those items, with Councilmember Gregorie voting nay and Councilmember Parker abstaining. The committee also unanimously approved a temporary construction easement at Herbert and Meeting Street and easements for the MUSC Pump Station Upfit Project.

Mon Aug 18, 2025

City Council

Committee on Real Estate to consider multiple property annexations

The Committee on Real Estate is meeting to discuss property transfers, lease amendments, and the annexation of several parcels of land. The body will also review a temporary residential lease for a participant in the City's Rehabilitation Program.

real-estateannexationzoningleasinginfrastructure
✓ Decided: Committee approves land conveyance to county, festival hall use and real‑estate actions

The Real Estate Committee unanimously approved several transactions, including a quitclaim of a 1.011 SF surplus right‑of‑way on Helmsman Street to Parcel R Phase 3 Development Co., and the conveyance of 0.63 ac (2,763 SF) of Riverland Drive to Charleston County for roadway improvements. It also approved a lease amendment for Freddie Whaley Park, a three‑month lease of 2324 Birdie Garrett to Andrea Prioleau, and authorized the Sixth Amendment to the lease with Lowline Housing. Additionally, the committee approved the use of Festival Hall for the MOJA Arts Festival on Oct 10‑11 and ratified the July 14 2025 meeting minutes.

Mon Aug 18, 2025

Board of Architectural Review

Renovation and addition project at 84 King Street approved

The Board of Architectural Review will review and approve a renovation and new two‑story addition to a historic home at 84 King Street, including demolition of a non‑historic addition, new flood‑zone‑compliant construction, and updates to plumbing, electrical, and mechanical systems. The meeting also includes quick‑plan approvals for numerous residential roof, fence, siding, and pool projects, as well as a few commercial repaint and repair items.

zoninghistoric-preservationresidentialconstructionpoolfence
Fri Aug 15, 2025

Commission on Disability Issues

Commission on Disability Issues to discuss ADA progress and access

The Mayor’s Commission on Disability Issues will meet to review the minutes from June 2025 and hear a report on the July 2025 Celebration. Members will discuss the current status of the ADA and strategies to achieve full access. The ADA Coordinator will provide a report and the commission will determine which city department to hear from next.

disability-servicesada-complianceaccessibilitypublic-access
Thu Aug 14, 2025

Accommodations Tax Advisory Committee

Committee to vote on CVB spending plan for accommodations tax

This committee is meeting to consider and potentially approve the 2025-2026 spending plan for the Charleston Area Convention and Visitors Bureau, funded by state accommodations tax revenue. They will also vote on approving minutes from the previous meeting in November 2024.

accommodations-taxtourismbudgetconvention-and-visitors-bureaucharleston
Thu Aug 14, 2025

Human Affairs and Racial Conciliation Commission

IAAAM director to present; housing and Union Pier on agenda

The Human Affairs and Racial Conciliation Commission will hear a presentation from Dr. Felice Ferguson Knight, Director of Education at the International African American Museum, on history and culture. The commission will also discuss old business items including unhoused/rapid housing, youth initiatives, affordable housing, Union Pier, BAR amendments, and the Water Plan. Public comment and approval of previous minutes are scheduled.

racial-conciliationaffordable-housingunion-pierbar-amendmentshomelessnesswater-plancultural-heritage
✓ Decided: Commission unanimously approves July 10 meeting minutes

The Human Affairs and Racial Conciliation Commission voted unanimously to approve the minutes from the July 10, 2025 meeting. The scheduled Special Commission on Equity, Inclusion, and Racial Conciliation meeting was marked as rescheduled. No other formal actions were taken during the session.

Thu Aug 14, 2025

Technical Review Committee

262-home Ashton Woods plat and 200-unit mixed-use on TRC agenda

The Technical Review Committee will review 17 site plans, preliminary plats, and road construction plans, including a 262-lot phase of Ashton Woods, a 200-unit mixed-use development at 578 Meeting Street, and a 62-unit live-work project on James Island. Decisions are advisory; some items require additional board approvals.

site-planssubdivisionsresidential-developmentmixed-usecainhoyjames-islandwest-ashleyjohns-island
Thu Aug 14, 2025

Technical Review Committee

TRC reviews 262-lot Ashton Woods preliminary plat and road plans in Cainhoy

The Technical Review Committee will review 17 site plans, preliminary plats, and road construction plans, many of which are resubmissions. The largest project is Ashton Woods Phase 1A/1B in Cainhoy, proposing 262 single-family lots and associated roads. Other notable items include a 200-unit mixed-use development at 578 Meeting Street and a 62-unit multi-family project at The Standard Grove on James Island. All items are under technical review, with results largely noted as 'Revise and Return' or 'No Return/Paperwork Comments.'

site-planssubdivisionsroad-constructionhousing-developmentcainhoyjames-islandjohns-islandpeninsula
Thu Aug 14, 2025

Board of Architectural Review

Conceptual approval of master plan for 158 Spring Street development

The Board of Architectural Review – Small will review minutes from its July 24, 2025 meeting. It will consider a series of applications for conceptual or final approvals, including a master‑plan concept for 158 Spring Street in the Old City District. Several appeals of staff decisions on roofing, storage sheds, and gates will also be discussed.

architectural-reviewhistoric-preservationdevelopmentappealszoning
Thu Aug 14, 2025

Board of Architectural Review

BAR to consider conceptual approval for 158 Spring St master plan

The Board of Architectural Review – Small will review a request for conceptual approval of a master plan to develop two single-family residences at 158 Spring Street in the Cannonborough/Elliottborough neighborhood. The item includes an applicant presentation and prior city reviews. The board may grant or deny conceptual approval for the project.

architectural-reviewdevelopmenthousinghistoric-districtcharlestonmaster-plan
Thu Aug 14, 2025

Board of Architectural Review

Board of Architectural Review defers most new construction requests

The Board of Architectural Review reviewed six applications for residential developments and additions. Most requests for new construction were deferred due to concerns over height, scale, and massing. Two projects received conceptual approval with specific conditions.

zoninghistoric-preservationresidential-constructionarchitecture
Thu Aug 14, 2025

Board of Architectural Review

BAR-S to consider conceptual master plan for 158 Spring Street development

The Board of Architectural Review – Small will hear public comments and decide on 15 applications including conceptual approvals, final approvals, and appeals of staff decisions. Notable items include a master plan for site development at 158 Spring Street, an appeal for a metal roof at 172 Rutledge Avenue (Ashley Hall School), and a mural proposal at 44 Romney Street. Public comments were submitted for six items, including support for 1091 King Street and opposition to the metal roof.

architectural-reviewhistoric-preservationcharlestondevelopmentpublic-hearingappealsconceptual-approvalold-city-district
Wed Aug 13, 2025

Special Events Committee

Committee discusses 11 special event permits, largest draws 4,500

The Special Events Committee will discuss 11 event applications, including parades, festivals, and private parties. They will also approve minutes from July 23 and receive a general update from the Special Event Manager. No votes are scheduled; these are discussion items only.

special-eventspermitsparadesfestivalscommunity-eventspublic-safetycharleston
Wed Aug 13, 2025

Special Events Committee

Committee discusses MOJA Arts Festival concert location, approves several event permits

The Special Events Committee held a virtual meeting on August 13, 2025, to review and vote on multiple event permit applications. Key actions included approving a prayer procession with conditions, tabling the MOJA Arts Festival Housing Authority Concert pending a location decision, and approving several other events such as a wedding parade, a Red Cross event, and a Medal of Honor plaque dedication. Updates from the special event manager reported no new items.

special-eventspermitsparadesfestivalsroad-closurescharleston
Wed Aug 13, 2025

Board of Architectural Review

BAR to consider new affordable housing building at 275 Huger Street

The Board of Architectural Review – Large will review several applications for new construction, including mock-up panels at 71 George Street and 573 Meeting Street, an exterior lighting plan at 161 East Bay Street, and a new affordable housing building at 275 Huger Street. The board will also hear an appeal of a staff denial for a directory sign at 677 King Street and consider after-the-fact approval of storefront window graphics at 306 King Street. The meeting will be held on August 13, 2025, at 4:30 p.m. in the Public Meeting Room at 2 George Street.

architectural-reviewaffordable-housinghistoric-districtsignagelightingnew-constructioncharleston
Wed Aug 13, 2025

Board of Architectural Review

Board to decide on mock-up panel for Stern Center renovation at 71 George Street

The Board of Architectural Review - Large will consider final approval of a mock-up panel for the College of Charleston's Stern Center Renovation at 71 George Street in the Harleston Village Old and Historic District. The meeting also includes approval of minutes from the July 8, 2025 meeting.

architectural-reviewhistoric-districtcollege-of-charlestonrenovationmock-up-panelharleston-village
Wed Aug 13, 2025

Board of Architectural Review

Board denies exterior lighting plan for 161 East Bay Street

The Charleston Board of Architectural Review met on August 13, 2025 to approve minutes and consider several applications. It approved mock‑up panels for 71 George Street and 573 Meeting Street with conditions, gave preliminary approval with conditions for an affordable housing project at 275 Huger Street, and denied the exterior lighting proposal for 161 East Bay Street, requesting a revised submission. A sign‑signage appeal was deferred.

zoninghistoric-districthousingsignagelighting
Wed Aug 13, 2025

Ad Hoc Budget Advisory Committee

Budget committee to review 2026 budget update and bond issuances

The Ad Hoc Budget Advisory Committee will discuss the 2026 budget update and upcoming bond issuances. The committee will also receive July monthly reports. No final decisions are made at this advisory meeting.

budgetadvisory-committeebond-issuancescharleston
Tue Aug 12, 2025

Public Safety Committee

Committee to vote on $551,753 school resource officer grant for 4 SROs

The Public Safety Committee is considering approval of a $551,753 state grant to fund continuation of 3 SROs and add 1 new SRO at CCSD schools, along with SRO agreements with James Island Charter High School and Berkeley County School District. The committee also will vote on submitting two federal homeland security grants totaling $116,000 for the fire department's incident management and urban search and rescue teams, and authorizing a mutual-aid MOU with Roper St. Francis Healthcare for hazardous material incidents.

policegrantsschoolspublic-safetyfire-departmenthomeland-securitysro
✓ Decided: Committee approved $551,753 SRO grant and related agreements

The Public Safety Committee unanimously approved the minutes from the July 8, 2025 meeting. It also unanimously approved accepting a $551,753 School Resource Officer grant and two SRO agreements with James Island Charter High School and the Berkeley County School District. The committee approved the submission of two Homeland Security grants—$45,000 for the Lowcountry Incident Management Team and $71,000 for the Urban Search and Rescue Team—and authorized the mayor to sign an MOU with Roper St. Francis Healthcare for hazardous‑materials response.

Mon Aug 11, 2025

Board of Architectural Review

Approval of a commercial rooftop structure with deck at 219 Meeting St.

The Charleston Board of Architectural Review will consider staff‑recommended quick‑plan approvals for a range of projects. Items include residential renovations, demolitions, accessory structures, fences, and a commercial rooftop deck. Each listed permit will be reviewed and either approved or denied at this meeting.

commercialresidentialrenovationdemolitionaccessory-structuresfencespools
Mon Aug 11, 2025

Board of Architectural Review

Board reviews substantial interior renovation at 1025 Sam Rittenberg Blvd

The Charleston Board of Architectural Review will consider twelve quick‑plan permit applications. These include interior renovations at 1025 Sam Rittenberg Blvd, non‑structural interior work at 10 Windermere Blvd, and conversion of units at 3575 Maybank Hwy. The board will also review sign installations, electrical service upgrades, window replacements, HVAC replacements, and temporary trailer permits. Decisions will be made on each application during the meeting.

architectural-reviewcommercial-permitsconstructionsignagetemporary-structures
Thu Aug 7, 2025

Technical Review Committee

27-unit hotel at 657 King Street and other site plan reviews

The Technical Review Committee will review seven site plans, subdivision plats, and road construction plans. Items include a proposed 27-unit hotel at 657 King Street, revisions to the City Operations Complex and a sales center, a new oil change facility, and a 42-lot subdivision phase on Johns Island.

site-planssubdivisionshotelcity-operationsoil-changeresidential-developmentjohns-islanddaniel-island
Thu Aug 7, 2025

Technical Review Committee

TRC reviews site plans and subdivisions for 7 projects

The Technical Review Committee will review site plans and subdivisions for seven projects, including a 27-unit hotel on King Street and revisions to a City operations facility on Herbert Street. Several items are pending stormwater comments.

zoningdevelopmentsite-plansubdivisioncharlestonhousingtransportation
Thu Aug 7, 2025

Special Facilities

Special Facilities Committee to receive director's update

The Special Facilities Committee is meeting to approve previous minutes and receive an update from Special Facilities Director Romaine Heyward.

special-facilitiesgovernment-administration
✓ Decided: Committee approved May 1, 2025 meeting minutes unanimously

The Committee on Special Facilities voted unanimously to approve the minutes from the May 1, 2025 meeting. No other actions or resolutions were adopted. The meeting included updates on elevators, a new point‑of‑sale system, and facility conditions, but these were informational only. The committee adjourned at 4:06 p.m.

Wed Aug 6, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to review tree removal variance

The Charleston Board of Zoning Appeals will review minutes from previous meetings and consider a variance request to remove a grand tree at 551 Shem Butler Court. The public may submit written comments by August 5.

bzazoningtree-removalvarianceplanningpublic-hearing
Wed Aug 6, 2025

Board of Zoning Appeals Site Design

Variance request for grand tree removal at 551 Shem Butler Court

The Board of Zoning Appeals - Site Design will consider a variance request to remove one grand tree at 551 Shem Butler Court (Schieveling Plantation), zoned PUD. The board will also vote to approve meeting minutes from May 7 and July 2, 2025.

zoningvariancetreesboard-of-zoning-appealscharlestonsite-design
Wed Aug 6, 2025

Board of Zoning Appeals Site Design

Board approves tree removal variance for 551 Shem Butler Court

The Board of Zoning Appeals – Site Design reviewed one new application and deferred the approval of previous meeting minutes due to a lack of quorum. The board granted a variance for the removal of one grand tree at a specific residential property.

zoningtreesvariancessite-design
Wed Aug 6, 2025

Commission on History

Commission to consider ordinance amending its own charter, hear YWCA bodies presentation

This meeting of the Commission on History includes consideration of an ordinance amending the city code sections that govern the commission itself, and a presentation and discussion on 'Protect and Respect the Bodies Under the YWCA' requested by a commissioner. Approval of minutes from July 2, 2025, and miscellaneous business are also on the agenda.

historyordinancecode-amendmentpreservationywcaburial-groundspublic-meeting
✓ Decided: Commission amended ordinance to remove named institutions and allow chair‑approved excused absences

The Commission unanimously approved agenda item B1 from the July 2 meeting. It then voted to amend the ordinance governing the History Commission by deleting specific institution names and adding language that excused absences may be approved by the Chair. The vote on the amendment was not unanimous; Commissioner Fraser abstained.

Tue Aug 5, 2025

Board of Zoning Appeals Zoning

Board to consider use variance for beer and wine sales at 227-A Rutledge Ave.

The Board of Zoning Appeals will hear 7 applications for variances and special exceptions, including a request to allow on-premises beer and wine consumption at a retail store. Three items have been deferred. The board will also reconsider two prior decisions.

zoningboard-of-zoning-appealsvariancesspecial-exceptionspublic-hearingscharleston
Tue Aug 5, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to review setback exceptions and variances

The Board of Zoning Appeals is meeting to consider requests for special exceptions and variances regarding property setbacks. The board will decide if specific properties meet the requirements for hardship or exceptions to the Zoning Ordinance.

zoningvariancessetbackshousing
Tue Aug 5, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves several setback variances and a retail use request

The Board of Zoning Appeals reviewed applications for zoning variances and special exceptions. The body decided on several requests regarding building setbacks and lot occupancy, as well as a use variance for alcohol consumption at a retail location.

zoningvariancessetbacksland-usealcohol-sales
Tue Aug 5, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to consider use variance for on-premises beer and wine at 227-A Rutledge Ave.

The Board of Zoning Appeals will hear four variance requests, including a use variance for beer and wine consumption at 227-A Rutledge Ave. One item (21 Reid St.) is deferred. Public comments include a note from Eastside Community Development Corporation that applicants for Eastside properties have not presented to the neighborhood association.

zoningvariancespublic-hearingeast-sidecannonborough-elliotboroughwagener-terracecharleston
Mon Aug 4, 2025

Design Review Board

Board hears appeal of denied storage building design revision

The Design Review Board will consider conceptual approval for new office buildings at 1791 Hickory Knoll Way, a car dealership renovation at 1513 Savannah Hwy, and partial demolition and renovation at 1731 Savannah Hwy. The Board will also review preliminary approval for two medical buildings at 3955/3961 West Ashley Circle. Additionally, the Board will hear an appeal of staff's denial of a storage building design revision at 2274 Clements Ferry Rd.

design-review-boardcommercial-developmentconstructionappealwest-ashleyjohns-islandcainhoy
✓ Decided: Design Review Board approves multiple projects and an appeal, all unanimously

The board unanimously gave conceptual approval to new office shells on Hickory Knoll Way and to renovations on Savannah Highway, and approved a partial demolition at 1731 Savannah Hwy. It also granted preliminary approval for two new medical buildings on West Ashley Circle and approved an appeal for a storage building redesign on Clements Ferry Rd. Finally, the board approved the minutes from the July 7 meeting.

Mon Aug 4, 2025

Design Review Board

DRB to review conceptual approvals for new offices and dealership renovation

The Charleston Design Review Board will consider two conceptual approval requests at its August 4, 2025 meeting. The first is for two new 5,000-square-foot shell office buildings at 1791 Hickory Knoll Way on Johns Island. The second is a renovation of the existing Infinity dealership at 1513 Savannah Highway in West Ashley to convert it into a Land Rover dealership. Both items are design reviews seeking conceptual approval; no final permits are being voted on.

design-reviewcommercial-developmentjohns-islandwest-ashleydealershipoffice-buildingsconceptual-approval
Mon Aug 4, 2025

Design Review Board

Board approves medical buildings, office shells, and car dealership renovations

The Design Review Board approved all six applications on the agenda, including two new medical buildings on West Ashley Circle, two shell office buildings on Johns Island, a car dealership renovation and partial demolition on Savannah Highway, and an appeal for a storage building redesign on Clements Ferry Road. Each approval included conditions from staff and board members regarding landscaping, signage, and architectural details. The board also approved the minutes from the July 7, 2025 meeting.

design-reviewwest-ashleyjohns-islandcainhoycommercial-developmentmedical-buildingscar-dealership
Mon Aug 4, 2025

Design Review Board

Design Review Board to consider office and medical building projects

The Design Review Board is reviewing conceptual and preliminary approvals for several commercial developments. The board will also consider a demolition request and an appeal regarding a storage building design.

zoningcommercial-developmentdemolitionmedical-facilitiesoffice-space
Mon Aug 4, 2025

Design Review Board

Design Review Board staff reviews 20 commercial and residential permits

The Design Review Board staff is conducting quick plan reviews for various property modifications. These items include commercial renovations, sign installations, and electrical updates.

commercial-developmentsignagerenovationspermits
Mon Aug 4, 2025

Board of Architectural Review

33 staff-level BAR reviews covering painting, roofing, signs, and more

The Board of Architectural Review staff is reviewing 33 quick-plan permits for minor exterior alterations and repairs across Charleston. Items include painting, HVAC replacements, roof work, sign installations, and a demolition—all at staff level with no full board decisions. This is a routine procedural agenda.

historic-preservationarchitectural-reviewstaff-approvalspermitspaintingroofingsigns
Fri Aug 1, 2025

Design Review Board

DRB/BAR retreat to discuss new design policy guidelines and procedures

This is a joint retreat for the Design Review Board and Board of Architectural Review, consisting of breakout sessions to discuss potential new policy/guideline statements (e.g., artificial turf, EIFS, hardscape) and revisions to existing policies. No formal votes or decisions are scheduled; the meeting is entirely discussion-based.

design-reviewarchitectural-reviewboard-retreatpolicy-guidelinescharleston
Fri Aug 1, 2025

Board of Architectural Review

BAR retreat to discuss new design guidelines and policy statements

The Board of Architectural Review and Design Review Board are holding a joint retreat to discuss potential new policy and guideline statements on topics such as artificial turf, hardscape, fences, and signage. Breakout sessions will also cover submittal requirements, review protocols, and historic materials demolition. No votes or decisions are scheduled; this is a working session for discussion.

architectural-reviewdesign-reviewboard-retreatdesign-guidelinespolicy-discussioncharleston
Wed Jul 30, 2025

James Island Intergovernmental Council Agenda

James Island Intergovernmental Council to discuss Folly Road safety audit and flooding updates

The council will consider updates on the Folly Road Safety Audit and raised medians at Ft. Johnson & Folly Road intersection, discuss a drainage issue on Flint Street, and receive a Joint Task Force on Flooding Update. New business includes Camp Road Middle School traffic concerns, stoplight issues at George Griffith & Folly Road, and Secessionville Sidewalks. Legislative updates from Charleston County, the City of Charleston, the Town of James Island, and the school district are also on the agenda.

roadstransportationfloodingdrainagepublic-safetyschoolssidewalksintergovernmental
Mon Jul 28, 2025

Design Review Board

Design Review Board reviews seven commercial signage and building permits

The Design Review Board is reviewing staff approvals for seven commercial projects. These items include requests for new signage and exterior building repairs.

zoningsignscommercial-propertybuilding-permits
Mon Jul 28, 2025

Board of Architectural Review

BAR staff to review 39 quick-plan building permits

The Board of Architectural Review staff is processing 39 quick-plan reviews for building permits across Charleston, mostly involving window replacements, roofing, HVAC, and minor renovations. No public hearings or major policy decisions are scheduled; all items are routine staff-level approvals.

board-of-architectural-reviewdesign-reviewhistoric-districtbuilding-permitsquick-plan-review
Thu Jul 24, 2025

Redevelopment and Preservation Commission

Commission to consider housing rehabilitation and roof replacement requests

The Redevelopment and Preservation Commission will vote on approving a Substantial Rehabilitation Program for 10 Cleveland Street and a Roof Replacement Program for 5 Packard Court and 1721 West Avalon Court. The meeting also includes approval of prior minutes and a progress report.

redevelopmentpreservationhousingroof-replacementsubstantial-rehabilitationpublic-comment
Thu Jul 24, 2025

Technical Review Committee

Review of Alberta Sottile Long Lake pedestrian bridge project

The Technical Review Committee will consider ten applications related to site plans, subdivision plats, and road construction. Items include a new pedestrian bridge at 295 Calhoun St, a single‑family residence at 60 Spring St Unit B, preliminary plats and road plans for 806 Magnolia Rd and The Pointe at Governor's Cay, and multiple road and plat proposals for the Long Savannah neighborhood. The committee will discuss each project's compliance and approve or request changes.

zoningsubdivisionsroad-constructionsite-plansdevelopment
Thu Jul 24, 2025

Technical Review Committee

TRC reviews concept plan for 390-unit Long Savannah development

The Charleston Technical Review Committee will review site plans, preliminary plats, and road construction plans for multiple developments. Key items include a concept plan for 390 housing units in Long Savannah Neighborhood 10C/D, a 55-lot subdivision at The Pointe at Governor's Cay, and a 7-lot subdivision at 806 Magnolia Road. Also on the agenda are a new pedestrian bridge at 295 Calhoun Street and a new single-family residence at 60 Spring Street.

technical-review-committeesite-planssubdivisionshousingwest-ashleycainhoypeninsulainfrastructure
Thu Jul 24, 2025

Board of Architectural Review

Board of Architectural Review to consider multiple demolition and construction requests

The Board of Architectural Review – Small is reviewing applications for partial and complete demolitions, new constructions, and additions. The board will evaluate requests for properties across several historic districts, including the Old and Historic District and the Historic Corridor District.

zoningdemolitionhistoric-preservationconstructionarchitecture
Thu Jul 24, 2025

Board of Architectural Review

Board of Architectural Review to consider partial demolitions in Wagener Terrace

The Board of Architectural Review - Small is reviewing requests for partial demolition of historic materials at two properties. The meeting also includes a review of minutes from July 10, 2025.

historic-preservationdemolitionwagener-terracezoning
Thu Jul 24, 2025

Board of Architectural Review

Board denies demolition of historic double doors at 318 Sumter Street

The Charleston Board of Architectural Review – Small approved most demolition and alteration requests for historic properties but denied a proposal to remove double front doors at 318 Sumter Street, ruling them character-defining. Several approvals included conditions to preserve original siding, corner boards, and eaves, and require a 30-day appeal period before permits are issued. Two applications were withdrawn by the applicant before the meeting.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonpublic-hearingapprovalsconditions
Thu Jul 24, 2025

Board of Architectural Review

BAR-S considers 13 permits; mural request withdrawn

The Board of Architectural Review – Small meets to decide on 13 applications, including demolitions, additions, and a new home. A proposed mural at 62 Queen Street was withdrawn by the applicant after numerous public comments opposing it. Other items include partial demolitions at several historic properties and conceptual approval for a new carriage house.

board-of-architectural-reviewhistoric-preservationdemolitionsmuralspublic-hearingcharlestonnew-construction
Wed Jul 23, 2025

Tourism Commission

Tourism Commission to discuss evening carriage tours

The Tourism Commission meets to receive an update from the Department of Livability and Tourism, hear a subcommittee report on Routes, Parking and Tourism Rules, and discuss Evening Carriage Tours (action may be taken). Public comments are accepted in person or written. The agenda is mostly procedural aside from the carriage-tour discussion.

tourismcarriage-toursparkingroutespublic-commentcommissionmeetings
✓ Decided: Tourism Commission unanimously approved prior meeting minutes

The commission approved the October 23, 2024 and February 26, 2025 minutes by unanimous vote. The Tourism office announced it will move meetings to 2 George Street and may shift future meeting months. The Routes, Parking and Tourism Rules subcommittee meeting was cancelled because a quorum was not present. A discussion about evening carriage tours was held, but no actions were taken.

Wed Jul 23, 2025

Tourism Commission

Tourism commission to discuss evening carriage tours

The Routes, Parking and Touring Rules Subcommittee will meet to discuss evening carriage tours. Written comments must be submitted by noon on Tuesday, July 22, and will be provided to board members 24 hours in advance.

tourismcarriage-tourspublic-hearingsubcommitteecharleston
Wed Jul 23, 2025

Special Events Committee

Approval of large events, notably Citadel Football Games (6,000 attendees)

The Special Events Committee will review and discuss a series of upcoming events scheduled for the summer and fall of 2025. Items include a commercial film shoot at Big John's Tavern, a private Oktoberfest party, several MOJA festivals, a 9/11 Heroes Run, and the Citadel football games season. The committee will consider each event's details such as date, location, type, and expected attendance. No formal decisions are recorded in the agenda.

special-eventsfestivalssportsfilmparades
Wed Jul 23, 2025

Special Events Committee

Committee approves Outer Banks filming and multiple event permits

The Special Events Committee approved or approved with conditions all 14 event applications on the agenda, including commercial filming for Outer Banks, street closures, and festivals. Most events require event safety plans and coordination with police and EMS. No items were denied or deferred.

special-eventsfilmingfestivalsparadesfoot-racesroad-closurescommittee-meetingpermits
Mon Jul 21, 2025

Design Review Board

Design Review Board reviews five commercial and municipal site updates

The Design Review Board is conducting quick plan reviews for five different properties. The items include a new fire department building and various commercial repairs or installations.

commercial-developmentmunicipal-facilitiessignagebuilding-permits
Mon Jul 21, 2025

Board of Architectural Review

Board of Architectural Review staff reviews 52 permit applications

The Board of Architectural Review staff is reviewing 52 'Quick Plan Review' permit applications for various residential and commercial properties. These items include a mix of routine maintenance, interior renovations, and new construction projects.

zoningdemolitionconstructionhistoric-preservationsolar
Thu Jul 17, 2025

Colonial Common and Ashley River Embankment Commission

Colonial Lake Rededication event planned for October with $250 dinner

The Colonial Common Commission is meeting to receive city and staff reports, discuss volunteer coordination, and plan upcoming events including a rededication of Colonial Lake in October. The agenda is largely procedural with discussions on horticulture projects and social activities.

communityeventshorticultureparksvolunteer
Thu Jul 17, 2025

Technical Review Committee

130-lot Long Savanna subdivision preliminary plat under review

The Technical Review Committee will review 13 items including site plans, subdivision plats, and road construction plans. Key projects include a 130-lot preliminary plat for Long Savanna Neighborhood Phase 3, a proposed 27-unit hotel at 657 King Street, and a playground at Bridge Pointe Ecological Park. The committee also reviews pedestrian safety improvements on Columbus and America Streets and revisions to the Towne at Cooper River subdivision. These are technical reviews before final approvals by other boards.

zoningdevelopmentsite-planssubdivisionsparkshousingtransportation
Thu Jul 17, 2025

Technical Review Committee

Technical Review Committee to review 13 site and subdivision plans

The Technical Review Committee is reviewing various site plans, subdivision concept plans, and road construction plans. The body is evaluating proposals for new residential and commercial developments, public safety improvements, and park additions.

zoningsite-plansroadshousingpublic-safetyparks
Thu Jul 17, 2025

Community Development

Committee to discuss affordable housing zoning for city-owned properties

The Community Development Committee will consider a request to subordinate and modify loan agreements with the Charleston Redevelopment Corporation, and discuss a zoning and entitlement strategy for affordable/workforce housing on city-owned properties including 24 Calhoun Street and One Cooper Street.

community-developmenthousingzoningaffordable-housingloan-agreementscity-owned-propertiespublic-participation
✓ Decided: Committee approved moving forward with affordable housing zoning strategy

The committee unanimously approved the June 18, 2025 meeting minutes. It also unanimously deferred consideration of the Charleston Redevelopment Corporation's request to subordinate and modify loan agreements. Finally, the committee unanimously approved continuing development of a zoning and entitlement strategy for affordable and workforce housing on city‑owned properties.

Thu Jul 17, 2025

Livability Review Board

Livability Review Board to discuss two vacant structures

The Livability Review Board will hold a hearing to review the status of two vacant structures. The board may also receive staff updates on properties previously reviewed.

vacant-propertieslivabilitypublic-hearings
Wed Jul 16, 2025

Planning Commission

Planning Commission weighs rezoning 50-acre West Ashley Circle and 474 Meeting St height increase

The Charleston Planning Commission will consider three rezoning requests, including a 50.55-acre parcel on West Ashley Circle from Gathering Place to General Business and a height increase at 474 Meeting Street. They will also review a concept plan for 22 single-family units on Cane Slash Road and four annexation zonings to assign SR-1 zoning for properties in West Ashley and James Island. Minutes from April, May, and June will be approved, and staff updates are scheduled.

planning-commissionrezoningwest-ashleymeeting-streetsubdivisionannexationzoningcharleston
✓ Decided: Commission approves rezoning of West Ashley Circle to General Business

The Planning Commission unanimously approved the rezoning of West Ashley Circle from Gathering Place to General Business to allow a new fire operations facility. It also approved a height‑district change for 474 Meeting Street, with Commissioner Bailey abstaining. The commission unanimously denied the request to rezone 835 Magnolia Road from Single Family Residential to Commercial Transitional.

Wed Jul 16, 2025

Planning Commission

Commission to consider 50-acre West Ashley rezoning to General Business

The Planning Commission will hear three rezoning requests and approve minutes from April, May, and June meetings. The largest item is a city-owned 50.55-acre parcel at West Ashley Circle proposed to rezone from Gathering Place (GP) to General Business (GB), allowing a broad range of commercial uses. Also on the agenda: a rezoning of 835 Magnolia Road from Single Family Residential (SR-2) to Commercial Transitional (CT) and a height district change at 474 Meeting Street from Old City Height District 2.5-3, 3.5 to Height District 4.

rezoningplanning-commissionland-usecommercialwest-ashleypeninsulameeting-streetcharleston
Wed Jul 16, 2025

Planning Commission

West Ashley Circle rezoned from Gathering Place to General Business

The Planning Commission approved a rezoning of approximately 50.55 acres on West Ashley Circle from Gathering Place to General Business. They also approved a 22-unit conservation subdivision on Cane Slash Road and disapproved a request to rezone 835 Magnolia Road to Commercial Transitional. Several SR-1 zonings were approved for properties in West Ashley, James Island, and Johns Island.

planning-commissionrezoningsubdivisionwest-ashleyjohns-islandpeninsulazoning
Wed Jul 16, 2025

Planning Commission

Planning Commission to review rezoning and subdivision requests

The Planning Commission will consider several rezoning requests, including a proposal to convert a church property to commercial use. The body will also review a concept plan for a new residential subdivision on Johns Island.

rezoningsubdivisionhousingcommercial-developmentjohns-islandwest-ashley
Tue Jul 15, 2025

City Council

City Council to rezone Pioneer Alley to 3.5 Old City Height District

The council will consider several amendments to the Zoning Ordinance, including rezoning Pioneer Alley and other parcels. It will also approve public‑safety grant awards and related agreements, and review stormwater‑related professional services contracts. Additional items include routine approvals and public hearing procedures.

zoningpublic-safetygrantsstormwatercontracts
✓ Decided: City Council unanimously approved first reading of three zoning ordinances

The council gave first reading approval to three ordinances: rezoning Pioneer Alley to a 3.5‑story Old City Height District, amending affordable‑housing standards in the SR‑6 district, and rezoning 1812 Debbenshire Drive to Single‑Family Residential. All three were approved by unanimous consent. Item E‑5 was noted as deferred at the applicant’s request.

Tue Jul 15, 2025

City Council

Council to consider $2.88M contract amendment for smoke stacks restoration

The Ways and Means Committee will consider over a dozen items including contracts, grants, and resolutions. Key items include a $2.88M amendment for smoke stack restoration at St. Julian Devine, a $415k change order for the Ashley River Crossing, design contracts for Johns Island and WL Stephens recreation centers, and approval of the King Street Business Improvement District assessment roll.

budgetcontractsgrantsparksstormwatertransportationpublic-safety
✓ Decided: Committee approved $2.88M Smoke Stacks contract amendment and multiple capital projects

The Committee on Ways and Means unanimously approved a $2,882,735.12 amendment to the ICC Commonwealth contract for smoke‑stack restoration at St. Julian Devine. It also approved several other capital‑project contracts, including a $415,342.28 change order for the Ashley River Crossing (with one councilmember voting nay) and a $1,402,052 contract for the Nowell Creek crossing. Additional approvals covered design contracts for the Johns Island Recreation Center and WL Stephens Aquatic Center, a $390,239 parking‑lot amendment, and acceptance of two small state grants.

Tue Jul 15, 2025

Board of Zoning Appeals Zoning

Board to vote on fourth extension of vested right for 12-unit King St. accommodations

The Board of Zoning Appeals – Zoning will consider minutes from June meetings, a deferred application, and 16 new requests for variances and special exceptions. Notable items include extensions of vested rights, amendments to existing special exceptions, and multiple requests for setback, parking, and lot occupancy variances. The meeting will be held July 15, 2025 at 5:15 p.m.

zoningboard-of-zoning-appealsvariancesspecial-exceptionscharlestonland-useparking
Tue Jul 15, 2025

Board of Zoning Appeals Zoning

Board considers variance for accessory dwelling unit at 2b Piedmont Ave.

The Charleston Board of Zoning Appeals will hear three items: a variance request for an accessory dwelling unit, a fourth one-year extension of a vested right for a special exception, and an amendment to an existing special exception. Public hearings and votes will follow established protocol.

zoningvariancesaccessory-dwelling-unitspecial-exceptionvested-rightaccommodationscharleston
Tue Jul 15, 2025

Board of Zoning Appeals Zoning

Board denies accessory dwelling unit variance at 2b Piedmont Ave.

The Board of Zoning Appeals decided on 16 applications, including approvals, denials, and deferrals. Key decisions include denying a variance for an ADU at 2b Piedmont Ave., approving a fourth extension for a 12-unit accommodations use at 257-261 King St., and approving a church special exception at 1245 Fuseler Rd. with conditions. Several items were deferred for further study.

zoningboard-of-zoning-appealsvariancesaccessory-dwelling-unitaccommodationschurchshort-term-rentalcharleston
Tue Jul 15, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to consider four zoning requests

The Charleston Board of Zoning Appeals will consider four requests: a variance for an accessory dwelling unit, an amendment to a hotel special exception, an expansion of a marina, and a special exception for a church.

zoninghousinghotelmarinachurchbza
Tue Jul 15, 2025

Traffic and Transportation Committee

Committee to discuss Maybank Highway safety improvements

The Traffic & Transportation Committee will review a proposed $350,000 safety improvement plan for the Maybank Highway and Riverland Road intersection and hear resident suggestions for low-cost safety measures.

trafficsafetyinfrastructurepedestrianintersectionmaybank-highwayriverland-roadlowline
✓ Decided: Committee gave pre‑approval for Lowline street‑ownership transfer

The Traffic and Transportation Committee unanimously approved three items: pre‑approval for the Lowline project’s request to transfer ownership and maintenance of certain streets from SCDOT; approval to forward the Lowline parking‑lot funding request to the Ways and Means Committee; and approval of the May 27, 2025 meeting minutes. All motions were passed without dissent.

Mon Jul 14, 2025

Design Review Board

Design Review Board reviews six commercial site and sign updates

The Design Review Board is processing staff approvals for various commercial modifications. These items include new construction, signage updates, and facility improvements.

commercial-developmentsignagelightingdesign-review
Mon Jul 14, 2025

Public Works and Utilities Committee

City seeks $1M grant for Newmarket Creek restoration and flood protection

The Public Works and Utilities Committee is reviewing several infrastructure maintenance agreements and professional service contracts. The body is discussing a grant application for flood protection and approving multiple contract addendums for stormwater plan reviews.

stormwaterflood-protectioninfrastructurecontractspublic-works
✓ Decided: Committee unanimously approved a $1 million grant application and multiple contracts

The Public Works & Utilities Committee approved the City’s acceptance of several rights‑of‑way easements, increased contract amounts with three engineering firms by $100,000 each, approved a $1 million grant application to the National Fish and Wildlife Foundation, and authorized a $200,461.32 change order for the Murray Blvd. road project. All actions were approved by unanimous vote.

Mon Jul 14, 2025

City Council

Committee to consider accepting donation of 4.66-acre marshland parcel

The Committee on Real Estate will vote on three items: a proposal to accept a donation of 4.66 acres of marshland from SPC Investments LLC along Sam Rittenberg Boulevard, a lease amendment for city-owned property at 140 East Bay Street, and annexation requests for three parcels (5 Arcadian Park, 473 Nelliefield Trail, and 2.4 acres off Folly Road). The meeting also includes an invocation and approval of prior minutes.

real-estateland-donationleaseannexationmarshlandcharleston
✓ Decided: Committee approved two annexations and authorized a marshland donation

The Real Estate Committee unanimously approved the June 16, 2025 meeting minutes. It authorized the mayor to accept a donation of approximately 4.66 acres of marshland from SPC Investments LLC. The committee also approved the terms of a First Amendment to the lease with Tamsberg East Bay, LLC. Finally, the committee voted unanimously to approve annexations of 5 Arcadian Park (0.23 acre) and 473 Nelliefield Trail (0.12 acre).

Mon Jul 14, 2025

Board of Architectural Review

BAR staff approves 42 quick-plan reviews for alterations and repairs

The Board of Architectural Review staff is processing 42 quick-plan review items, including interior alterations, roof repairs, fence installations, and painting. Most are routine in-kind repairs or minor modifications to historic properties. No substantive policy decisions or public hearings are scheduled.

architectural-reviewhistoric-preservationrenovationspermitsstaff-approvalsquick-plan-review
Thu Jul 10, 2025

Human Affairs and Racial Conciliation Commission

Commission holds presentations on arts festival and criminal justice coordination

The Human Affairs and Racial Conciliation Commission will approve minutes from the June 12, 2025 meeting, provide a public comment period, and hear presentations from Charlton Singleton of the MOJA Arts Festival and Ellen S. Steinberg of the Charleston County Criminal Justice Coordinating Council. The meeting also includes chairperson comments, manager updates, subcommittee updates, and an open discussion. No formal decisions beyond routine approvals are indicated.

public-commentminutesarts-festivalcriminal-justicecommission
✓ Decided: Commission unanimously approved June 12 meeting minutes

The commission voted unanimously to approve the minutes of the June 12, 2025 meeting as amended. No other motions were adopted. The meeting was adjourned at 5:40 p.m. because a quorum was not present. Public comments addressed a proposed student housing project on a historic burial ground and related preservation concerns.

Thu Jul 10, 2025

Charleston Basin Flood Action Committee

Flood committee gets resilience and stormwater updates

The Charleston Basin Flood Action Committee will receive updates on resilience efforts, including flood data and the WaterWise Charleston communications campaign, as well as a stormwater update from city directors. No votes or actions are scheduled; the meeting is for discussion and public comment.

floodresiliencestormwatercommitteecharleston
Thu Jul 10, 2025

Technical Review Committee

Review of Maybank Landing Phase 1‑5 site plan for 13.68 acres in Council District 3

The Technical Review Committee will consider site plan applications for several development projects, including Maybank Landing, a park‑and‑ride lot, and multiple residential subdivisions. Each item will be reviewed for compliance with zoning, engineering, and planning requirements. The committee may approve, request changes, or defer decisions on the proposed plans.

zoningsite-planssubdivisionshousingroads
Thu Jul 10, 2025

Technical Review Committee

Point Hope POD 4 Ph. 3 preliminary plat for 151 lots reviewed

The Technical Review Committee reviewed 13 site plans, subdivision plats, and road construction plans, issuing most as 'Revise and Return' or holding them open pending additional comments. Key items include large residential subdivisions on Cainhoy and James Island, two hotels on the Peninsula, a new multifamily development on Johns Island, and a freestanding emergency room.

zoningsubdivisionssite-planshousinghotelsinfrastructurejohns-islandcainhoy
Thu Jul 10, 2025

Board of Architectural Review

BAR-S to consider 16 items including full demolition at 10 Ducs Court

The Board of Architectural Review – Small will review minutes from June 26 and decide on 16 applications for appeals, demolitions, new construction, and alterations in historic districts. Items include a full demolition, rear addition demolitions, new single-family dwellings, and appeals of staff decisions. The meeting is on July 10, 2025 at 4:30 p.m. at 2 George Street.

architectural-reviewdemolitionnew-constructionhistoric-districtappealscharleston
Thu Jul 10, 2025

Board of Architectural Review

BAR to decide appeal on siding, windows, and paint at 250 Rutledge Ave

The Board of Architectural Review - Small will hold a public hearing on an appeal of a staff decision for 250 Rutledge Avenue. The applicant seeks approval to replace rotted wood siding and windows and repaint the house in Sherman Williams Iron Ore with black trim, citing a termite problem. The board will also consider minutes from the June 26, 2025 meeting.

architectural-reviewhistoric-districtboard-of-architectural-reviewcharlestonappealsidingwindowspaint
Thu Jul 10, 2025

Board of Architectural Review

Board of Architectural Review denies demolition request for 10 Ducs Court

The Board of Architectural Review – Small reviewed several applications for demolition, new construction, and exterior alterations. The board denied requests for full demolition at 10 Ducs Court and an appeal for siding replacement at 250 Rutledge Avenue.

zoningdemolitionhistoric-preservationarchitectureresidential
Thu Jul 10, 2025

Board of Architectural Review

Board reviews revisions to 141 East Bay addition in French Quarter

The Charleston Board of Architectural Review – Small will consider nine applications, including appeals, demolitions, new construction, and a conceptual revision for a new addition at 141 East Bay. The board will decide whether to approve the requested changes, many of which have received public comments. The meeting also includes a siding and window replacement appeal for 250 Rutledge Avenue and a stair reconfiguration request for 60 Cannon Street.

historic-preservationdemolitionnew-constructionzoningpublic-comments
Wed Jul 9, 2025

Special Events Committee

Committee to discuss multiple special event permits including Avondale 5K and First Day Festival

The Special Events Committee will discuss several event permit applications, including the Avondale 5K Run/Walk, Fisher House Freedom Ride, First Day Festival, National Night Out, and others. An update notes that the Mother's March in Hampton Park has changed its date to August 17. No final decisions are made at this meeting; it is purely discussion.

special-eventscommitteepermitsfestivalsroad-closuresparadescharleston
Wed Jul 9, 2025

Special Events Committee

Charleston committee approves several special events for 2025

The Special Events Committee will discuss and decide on permits for several events, including the Avondale 5K Run/Walk and the First Day Festival. The committee also approved the National Night Out event.

charlestonspecial-eventscommitteezoningpolicepublic-safetycalendar
Wed Jul 9, 2025

Board of Architectural Review

BAR-L to review Courier Square Phase 3 and affordable housing plans

The Board of Architectural Review – Large is reviewing conceptual approvals for several new construction projects. Key items include a multi-building development at 134 Columbus Street and a new affordable housing building on Huger Street.

architecturehousingzoningnew-constructionhistoric-preservation
Wed Jul 9, 2025

Board of Architectural Review

Board to review conceptual plans for Johnson Hagood Stadium east stands

The Board of Architectural Review is considering a conceptual proposal by The Citadel to replace temporary aluminum bleachers with permanent east stands. The project includes increasing seating capacity from 1,000 to 2,000 and adding a restroom facility.

stadiumthe-citadelarchitecturepublic-facilitieswestside
Wed Jul 9, 2025

Board of Architectural Review

BAR to review Courier Square Phase 3 site plan at 134 Columbus Street

The Board of Architectural Review is considering conceptual approval of a site plan for new construction at 134 Columbus Street in the Cannonborough/Elliottborough neighborhood. The proposal is part of the Courier Square Phase 3 PUD within the Old and Historic District.

architectural-reviewhistoric-districtnew-constructionpudsite-planzoning
Wed Jul 9, 2025

Board of Architectural Review

Board of Architectural Review approves stadium and housing conceptual plans

The Board of Architectural Review reviewed several conceptual applications for new construction and site plans. The body granted conditional approvals for stadium upgrades and affordable housing, and approved a site plan for the Courier Square Phase 3 PUD.

zoningaffordable-housingstadiumnew-constructionsite-plan
Wed Jul 9, 2025

Board of Architectural Review

BAR reviews Citadel stadium seating upgrade after previous denial

The Board of Architectural Review – Large will hold a public comment meeting on July 9, 2025 to consider conceptual approval for the Citadel's proposal to upgrade stadium seating and add facilities at 68 Hagood Avenue. The application follows a denial in May, and numerous public comments have been submitted criticizing the design and the applicant's community engagement. The other agenda item, a new construction mock-up panel at 71 George Street, was deferred by the applicant.

board-of-architectural-reviewpublic-hearingcitadelstadiumnew-constructionhistoric-districtcommunity-engagement
Tue Jul 8, 2025

Public Safety Committee

Public Safety Committee to vote on police mutual aid with York County

The committee will consider a mutual aid agreement between the Charleston Police Department and the York County Sheriff's Office, allowing officers to operate across jurisdictional lines during emergencies or special events. Also on the agenda: approval of a $200,000 federal grant for officer mental health peer support, acceptance of a $90,252 grant for ballistic vests, an MOU allowing CFD paramedics to use CCEMS ambulance equipment, and two ordinances updating animal control and conforming local codes to state law.

policemutual-aidgrantsfire-departmentparamedicsanimal-controlordinances
✓ Decided: Committee approves updated animal control ordinance

The Public Safety Committee approved the June 10, 2025 meeting minutes unanimously. It also unanimously approved a law enforcement assistance agreement with the York County Sheriff’s Office, a $200,000 mental‑health grant application, a $90,252 body‑armor grant, and an MOU allowing fire‑department paramedics to use CCEMS ambulance equipment. The committee then unanimously adopted the proposed animal‑control code amendments after a motion to defer failed, and unanimously passed a vessel‑code ordinance to align city law with state legislation.

Mon Jul 7, 2025

Design Review Board

Design Review Board to consider multifamily and retail projects on James Island

The Design Review Board will review applications for building demolitions, renovations, and new developments. The board is specifically considering a 62-unit multifamily project and retail changes on James Island.

zoningdemolitionmultifamily-housingretailjames-island
✓ Decided: Preliminary approval granted for 4‑story, 62‑unit multifamily project on Maybank Hwy

The Design Review Board approved partial demolition of a portion of the 1919 Maybank Hwy retail building (6‑0). It gave conceptual approval for a renovation and new addition to the same building, requiring additional parking‑lot material details and a joint‑detail study (6‑0). The board also gave preliminary approval for a 4‑story, 62‑unit multifamily development on Maybank Hwy at Promenade Vista St, with conditions to use ADA‑compliant pathway material and brick‑veneer for the low retaining wall (6‑0). Minutes from the June 2, 2025 meeting were approved (6‑0).

Mon Jul 7, 2025

Design Review Board

Design Review Board to consider demolitions of buildings over 50 years old

The Design Review Board is reviewing requests to demolish structures over 50 years old. One request has been deferred by the applicant.

demolitionpreservationzoning
Mon Jul 7, 2025

Design Review Board

DRB approves multifamily development and retail renovations on James Island

The Design Review Board decided on three applications, including the approval of a 62-unit multifamily project and retail building changes. Two other applications for demolition and a storage facility were deferred by the applicants.

zoninghousingdemolitioncommercial-developmentjames-island
Mon Jul 7, 2025

Design Review Board

DRB reviews six quick‑plan permits, including emergency roof repair on Maybank Hwy

The Charleston Design Review Board will conduct quick‑plan reviews of six permit applications on July 7, 2025. Items include a commercial building pergola addition at 1291 Folly Rd Ste 101, a directional sign at 716 UT Oyster Isle, and emergency roof repair at 2863 Maybank Hwy. Additional reviews cover sign installations at 1101 Waterline St and 3863 West Ashley Cir Unit 200, and interior renovation of the fire station at 235 Seven Farms Dr. The board will request contractor information for several projects before approval.

permitsconstructionsignageemergency-repairfire-stationdesign-review
Mon Jul 7, 2025

Board of Architectural Review

Board of Architectural Review staff approve 52 property permits

The Board of Architectural Review staff processed a series of quick plan reviews for residential and commercial properties. These approvals cover a range of maintenance, renovations, and demolitions across the city.

zoningrenovationdemolitioncommercial-developmentresidential
Thu Jul 3, 2025

Technical Review Committee

Ashley Landing Publix site plan, 155 Meeting St hotel reviewed

The Technical Review Committee will review site plans and subdivision plats for 11 projects, including a Publix grocery store at Ashley Landing, a mixed-use hotel and residential development at 155 Meeting Street, and reconstruction of Johnson Hagood Stadium at The Citadel. Other items include drainage improvements, a new Take 5 Oil facility, and a townhome subdivision on James Island.

site-planssubdivisionspublixashley-landingcitadelstormwater-drainagedevelopmentzoning
Thu Jul 3, 2025

Technical Review Committee

Technical Review Committee to review 11 site and infrastructure plans

The Technical Review Committee is reviewing various site plans, subdivision plats, and infrastructure projects. The body is evaluating proposals for commercial developments, residential townhomes, and city stormwater improvements.

zoningsite-plansstormwaterdevelopmentinfrastructure
Wed Jul 2, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to review tree removal requests

The Board of Zoning Appeals – Site Design will consider variance and special exception requests regarding the removal of protected and grand trees. The board will also review minutes from May and June 2025 meetings.

zoningtree-removalvariancessite-design
Wed Jul 2, 2025

Board of Zoning Appeals Site Design

Board considers variance to remove 19 grand trees at Country Club

The Board of Zoning Appeals will decide on two requests to remove protected trees. At 1 Country Club Drive, the applicant seeks variances and a special exception to remove 21 grand trees and reduce protection zones. At 100 Coastal Drive on Daniel Island, a variance is requested to remove 24 protected trees.

zoningboard-of-zoning-appealsvariancestreesdaniel-islandcountry-clubcharleston
Wed Jul 2, 2025

Board of Zoning Appeals Site Design

Board approves tree removal variances at two sites with replanting conditions

The Board of Zoning Appeals – Site Design approved two variance requests for protected tree removal at 100 Coastal Drive on Daniel Island and 1 Country Club Drive on James Island, each with conditions including replanting native canopy trees. Minutes from the May 7, 2025 meeting were deferred, while minutes from June 4, 2025 were approved. The board also approved a variance for 100 Coastal Drive to remove 24 protected trees and for 1 Country Club Drive to remove 19 grand trees and allow a special exception for two grand trees.

zoningtree-removalvariancescharlestonboard-of-zoning-appealsdaniel-islandjames-islandconditions
Wed Jul 2, 2025

Board of Zoning Appeals Site Design

Board to decide variance for tree removal at Daniel Island site

The Charleston Board of Zoning Appeals will consider a variance to remove 24 protected trees at 100 Coastal Drive. The board will also review a separate application for tree removal at 1 Country Club Drive.

zoningtree-removalvariancedaniel-islandplanningenvironment
Wed Jul 2, 2025

Commission on History

Commission on History to discuss Liberty Square and Marion Square markers

The Commission on History will meet to discuss a marker for the British Evacuation of Charleston at Liberty Square. The body will also receive information regarding a SC Medal of Honor Dedication Plaque for Marion Square.

historypublic-markersliberty-squaremarion-square
✓ Decided: History Commission unanimously approves two items, including Liberty Square marker text

The commission voted unanimously to approve item B1 from the June 4 meeting. It also unanimously approved the wording for the Liberty Square marker about the British evacuation of Charleston (Item C). No other actions were decided at this meeting.

Mon Jun 30, 2025

Design Review Board

Design Review Board staff approves 11 quick-plan commercial permits

This meeting consists solely of staff-level approvals for 11 quick-plan review items, including commercial building alterations, mechanical replacements, signage, and a new restaurant shell. No formal board hearings or policy discussions are scheduled.

design-reviewcommercial-permitsplan-reviewstaff-approvalsconstruction
Mon Jun 30, 2025

Board of Architectural Review

Staff approves 46 permits including new 6-story mixed-use building

The Board of Architectural Review staff is approving 46 permit applications across Charleston, covering a range of exterior and interior work. Items include new construction of a 6-story mixed-use building at 573 Meeting Street, new single-family residences, and several substantial improvement projects with historic variances. All items are listed as staff approvals and not subject to board discussion.

building-permitshistoric-preservationarchitecturemixed-usenew-constructionresidentialcommercial
Thu Jun 26, 2025

Minority Business Enterprise Advisory Board

Minority Business Enterprise Advisory Board to discuss 395C King project

The Minority Business Enterprise Advisory Board will meet to receive updates on the 395C King construction-renovation project. The board will also discuss the Entrepreneurial Resource Center (ERC II) application deadline.

minority-businessconstructionbusiness-licensingentrepreneurshipeconomic-development
Thu Jun 26, 2025

Redevelopment and Preservation Commission

Commission to vote on rehab and roof replacement at 4 properties

The Redevelopment and Preservation Commission will consider approving Limited Substantial Rehabilitation, Roof Replacement, and Substantial Rehabilitation programs for four properties. The meeting also includes approval of previous meeting minutes and public comment.

housingrehabilitationpreservationcharleston
Thu Jun 26, 2025

Technical Review Committee

Technical Review Committee to review site plans and subdivision plats

The Technical Review Committee is reviewing site plans, preliminary plats, and road construction plans for several developments. These reviews cover projects in the Peninsula and West Ashley areas.

zoningsite-planssubdivisionsroadshousingpeninsulawest-ashley
Thu Jun 26, 2025

Technical Review Committee

Technical Review Committee to review site plans and subdivision plats

The Technical Review Committee is reviewing site plans, preliminary plats, and road construction plans for several developments. The committee evaluates these applications for compliance with city planning, engineering, and stormwater standards.

zoningsite-planssubdivisionsroadshousing
Thu Jun 26, 2025

Board of Architectural Review

Board of Architectural Review to consider demolition and construction requests

The Board of Architectural Review – Small will review applications for building alterations, demolitions, and new construction. The board is deciding on conceptual and final approvals for several residential and commercial properties across various city districts.

zoningdemolitionhistoric-preservationconstructionarchitecture
Thu Jun 26, 2025

Board of Architectural Review

BAR to consider partial demo at 178 Sans Souci and after-the-fact porch at 347 Ashley

The Board of Architectural Review - Small will consider two demolition requests: partial demolition of a c.1935 home at 178 Sans Souci Street, and partial demolition at 347 Ashley Avenue and 448 Race Street, including after-the-fact approval for porch reconstruction. One agenda item (28 Gordon Street) was withdrawn by staff. The board will also review minutes from the June 12, 2025 meeting.

historic-preservationdemolitionarchitectural-reviewcharlestonboard-of-architectural-reviewafter-the-fact-approvalpartial-demolition
Thu Jun 26, 2025

Board of Architectural Review

BAR denies fiberglass windows, approves partial demolition with conditions

The Board of Architectural Review – Small reviewed eight applications at its June 26, 2025 meeting, making decisions on demolitions, after-the-fact alterations, and new construction. It denied after-the-fact installation of solid fiberglass windows at 218B Rutledge Avenue, approved partial demolition at 178 Sans Souci with a requirement to rebuild a removed chimney, and deferred conceptual approval for a new single-family dwelling at 13 Trumbo Street for restudy. Other items were withdrawn or approved with conditions, including storefront alterations at 337 King Street.

architectural-reviewhistoric-preservationdemolitionwindowsafter-the-factcharlestonboard-of-architectural-review
Thu Jun 26, 2025

Board of Architectural Review

BAR-S to consider full demolition of 55 Spring Street over neighborhood opposition

The Board of Architectural Review – Small will decide on 14 applications, including partial and full demolitions, new construction, and alterations in Charleston's historic districts. A full demolition request at 55 Spring Street has drawn 124 public comments and opposition from the Cannonborough-Elliottborough Neighborhood Association. Two items (28 Gordon Street and 158 Spring Street) have been withdrawn.

architectural-reviewdemolitionhistoric-preservationpublic-hearingold-city-districtwagener-terracecannonborough-elliottboroughaccessory-dwelling-units
Mon Jun 23, 2025

Design Review Board

Design Review Board processes 9 staff approvals for signs and building work

The Design Review Board is reviewing staff approvals for various commercial signs, a building demolition, and tenant improvements. These items are processed via Quick Plan Review.

signsdemolitioncommercial-developmentdesign-review
Mon Jun 23, 2025

Commission on Women

Charleston Commission on Women holds routine meeting

The Commission on Women is meeting to approve minutes from April 28, 2025, and hold a general discussion. The agenda contains no specific proposals, votes, or public hearings.

commission-on-womencharlestonpublic-meetingprocedural
Mon Jun 23, 2025

Board of Architectural Review

BAR staff approves 24 quick plan reviews for renovations and additions

The Board of Architectural Review staff is approving a series of quick plan reviews for residential and commercial projects across Charleston. Items include additions, renovations, roof replacements, painting, and a change of occupancy from residential to commercial. No public hearings or policy decisions are scheduled.

historic-districtbuilding-permitsrenovationsstaff-approvalsarchitectural-review
Fri Jun 20, 2025

Commission on Disability Issues

Commission discusses ADA resource information for King St merchants

The Mayor’s Commission on Disability Issues will meet to discuss delivering ADA resource information to merchants on King St. The body will also receive a six-month update from the ADA Coordinator and a report from the July 2025 Celebration Work Group.

adadisability-servicesking-stpublic-information
✓ Decided: May 2025 meeting minutes approved unanimously by the commission

The commission approved the minutes from the May 2025 meeting with a unanimous vote. The motion was made by Vice‑Chair Alex Jackson and seconded by Commissioner Vonnie Gilreath. No other formal actions, approvals, or denials were recorded; the remaining agenda items were discussed but not decided.

Wed Jun 18, 2025

Planning Commission

129-home subdivision concept plan on Johns Island up for approval

The Planning Commission will vote on a concept plan for a 129-home Conservation Development subdivision on 102 acres at the Jordan Tract on Johns Island. They will also consider rezoning requests for 806 Elsey Drive (to Job Center District), Pioneer Alley (to increase height and allow PUD), and other properties. A scrivener's error correction in the zoning ordinance regarding affordable housing lot standards is up for amendment. Several zoning requests for single-family residential designations in West Ashley are also on the agenda.

planning-commissionsubdivisionrezoninghousingjohns-islandwest-ashleyzoning-ordinance
✓ Decided: Planning Commission approves Pioneer Alley rezoning and denies Elsey Drive request

The commission amended the April meeting minutes after a motion passed with Commissioner Jacobs abstaining. It unanimously denied the request to rezone 806 Elsey Drive from Single Family Residential to Job Center. The rezoning request for 105 Cannon Street (Pioneer Alley) was taken together and unanimously approved. The 835 Magnolia Road rezoning request was deferred.

Wed Jun 18, 2025

Planning Commission

Planning Commission reviews 129-home subdivision on Johns Island

The Planning Commission will consider a rezoning for 806 Elsey Drive to Job Center, two rezoning requests for Pioneer Alley (105 Cannon St.) to increase building height and create a Planned Unit Development, and a concept plan for a 129-home conservation subdivision on Johns Island. Staff recommends approval for all items. The commission's recommendations will go to City Council for final decisions.

zoningsubdivisionconservationrezoningpublic-hearingplanning-commissioncharleston
Wed Jun 18, 2025

Planning Commission

Planning commission approves 129-home subdivision on Johns Island

The Planning Commission voted on several items. They approved a subdivision concept plan for 129 homes on Johns Island, rezonings for Pioneer Alley, and zoning changes for two properties. They denied a rezoning at 806 Elsey Drive and deferred a rezoning at 835 Magnolia Road. An ordinance amendment fixing a scrivener's error and adjusting affordable housing lot standards was also approved.

planning-commissionzoningsubdivisionaffordable-housingjohns-islandwest-ashleypeninsulacharleston
Wed Jun 18, 2025

Planning Commission

Commission to consider rezoning 806 Elsey Drive from residential to commercial

The Planning Commission will consider four rezoning requests, including 806 Elsey Drive from SR-2 to Job Center District, with public opposition citing commercial intrusion. Also up for discussion is a subdivision concept plan for 129 homes on Johns Island, a zoning ordinance amendment correcting a scrivener's error, and two annexation zoning requests for properties in West Ashley.

zoningrezoningsubdivisionresidentialcommercialpublic-hearingordinance-amendmentaffordable-housing
Wed Jun 18, 2025

Community Development

City to certify abandoned building for rehab tax credits

The Community Development Committee will consider certifying a property at 1 Rosemont Street as an abandoned building to allow the owner to apply for state tax credits for rehabilitation. The committee will also hear a presentation on proposed changes to affordable housing zoning standards.

zoninghousingtax-creditsredevelopmentcharleston
✓ Decided: Committee approved sending affordable‑housing zoning changes to Planning Commission

The committee unanimously approved the minutes from the May 15 and June 12, 2025 meetings. It also unanimously certified the property at 1 Rosemont Street as an abandoned building under state law. Finally, the committee unanimously voted to forward the proposed amendment to the SR‑6 single‑family residential zoning standards for affordable housing to the Planning Commission for approval.

Wed Jun 18, 2025

Recreation Committee

Committee to vote on naming tennis center after Peggy Bohne

The Recreation Committee will discuss and potentially decide on renaming the Charleston Tennis Center on Farmfield Avenue as 'The City of Charleston Peggy Bohne Tennis Center.' Other agenda items include updates on the Parks and Recreation Master Plan General Obligation Bonds, WPAL park, Harmony Property, Johns Island Recreation Center, and a proposal to add a grass infield at Johns Island City Park.

recreationparksnamingbondscommunity-centers
✓ Decided: Committee unanimously names Charleston Tennis Center after Peggy Bohne

The Recreation Committee approved the minutes from the May 15, 2025 meeting. It voted unanimously to take item 5.c first. It also voted unanimously to name the Charleston Tennis Center on Farmfield Avenue “The City of Charleston Peggy Bohne Tennis Center.”

Tue Jun 17, 2025

City Council

City Council to consider $25 million buyout of MUSC stake in WestEdge development

The council will receive committee reports including a recommendation to buy out MUSC's interest in the WestEdge Foundation for up to $25 million. Public hearings will be held on three rezoning requests. Other items include a juvenile curfew ordinance, approvals of grants and contracts, and changes to stormwater utility billing.

zoningjuvenile-curfewpublic-safetyparksgrantsstormwaterpolicedevelopment
✓ Decided: Council defers 0 Folly agenda item

The City Council deferred the agenda item concerning 0 Folly to a later date, as announced by Mayor Cogswell. The meeting also featured several proclamations and a public hearing on a development application, but no other council actions were recorded.

Tue Jun 17, 2025

City Council

Mayor proclaims June 17, 2025 as Mother Emanuel Nine and Survivors Remembrance Day

The City Council will adopt a mayoral proclamation designating June 17, 2025 as Mother Emanuel Nine and Survivors Remembrance Day. The proclamation honors the nine victims of the 2015 church shooting and the survivors, and references ongoing memorial projects such as the Mother Emanuel Way Memorial District and the Susie Jackson Freedom Memorial Garden. The Council will also direct that copies of the proclamation be sent to the families, survivors, and Mother Emanuel AME Church.

memorialproclamationcommunityhistorypublic-awareness
Tue Jun 17, 2025

City Council

Council to vote on $991K animal shelter contract from reserves

The Ways and Means Committee will consider multiple contracts and grant applications. Notable items include a $991,518 contract with Charleston Animal Society funded by reserves, a $1,727,600 port security grant application, and a $198,725 contract for Hagood Avenue improvement plan. Several real estate transactions including annexations and leases are also on the agenda.

budgetcontractsgrantspoliceanimal-servicesstormwatertransportationreal-estate
✓ Decided: Committee authorizes $991,518 animal services contract

The Ways and Means Committee approved several items, including a $415,000 contract for traffic software, a $4,996.40 state grant for the MOJA Arts Festival, and amendments to the 2024 General Fund budgets. It deferred the special‑projects manager contract and authorized the mayor to sign a $991,518 agreement with the Charleston Animal Society, a vote that was not unanimous. The committee also approved the HUD housing plan submission and a $200,000 storm‑water fee agreement with Charleston County.

Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to review 10 property variance and exception requests

The Board of Zoning Appeals is meeting to consider several requests for zoning variances and special exceptions. These include requests for residential additions, lot size exceptions, and a use variance for an office.

zoningvarianceshousingparkingland-use
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board to consider use variance for off-site commercial parking at 126 Romney St.

The Board of Zoning Appeals – Zoning will hold a special meeting on June 17, 2025, to consider a single new application. The applicants request a use variance from Section 54-201 to allow off-site parking for a commercial lot on a residentially zoned property at 126 Romney St. The property is owned by Marquee Moon LLC and located in the North Central area, Council District 4.

zoningboard-of-zoning-appealsuse-varianceparkingcommercialresidential
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to hear variance and special exception requests

The Charleston Board of Zoning Appeals will consider two property requests at the June 17, 2025, meeting: a variance for a rear addition at 20 Alberta Ave. and a special exception to expand a non-conforming structure at 39 Alberta Ave. Both properties are zoned SR-2.

zoningvariancespecial-exceptioncharlestonwagener-terracealberta-avebza
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board will consider a use variance for off‑site parking at 126 Romney St.

The Board of Zoning Appeals will hear an application for a use variance at 126 Romney St. in the North Central area. The request seeks to allow off‑site parking for a commercial lot on property zoned DR‑1F residential. The Board will follow its standard protocol, including staff presentation and public comments, before voting to approve, conditionally approve, deny, or defer the variance.

zoningvariancesparkingresidentialcommercial
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves several residential and commercial variances

The Board of Zoning Appeals reviewed 11 applications for zoning variances and special exceptions. The board approved requests for residential additions, lot size exceptions, and a restaurant expansion, while denying one setback request and deferring another.

zoningvarianceshousingcommercial-developmentsetbacks
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals denies parking variance for 126 Romney St.

The Board of Zoning Appeals met to consider a new application for a use variance. The board voted to deny a request to allow off-site commercial parking on a residential property.

zoningparkingvarianceland-use
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board will consider three special exception requests for residential projects

The Board of Zoning Appeals will review special exception applications for 39 Alberta Ave, 828 Burger St, and 1139 Forbes Ave. Each request seeks to build or expand a single‑family residence on a lot that does not meet the required size or setback standards. Public comments supporting the proposals have been submitted for each site.

zoningspecial-exceptionresidentialhousingpublic-comments
Tue Jun 17, 2025

Board of Zoning Appeals Zoning

Board to consider use variance for off-site parking at 126 Romney St

The Board of Zoning Appeals will hold a public hearing on a request for a use variance to allow off-site parking for a commercial lot on residential property at 126 Romney Street. The applicant, Tyler & Michelle Smyth, seeks to provide parking for redevelopment of a vacant school at 1091 King Street. The meeting includes public comments, with support from the North Central Neighborhood Association and opposition from some neighbors.

zoningvarianceparkingresidentialcommercialpublic-hearingnorth-central
Mon Jun 16, 2025

Design Review Board

Design Review Board considers five staff-level quick plan approvals

The Design Review Board is reviewing five staff-level quick plan approvals for minor commercial maintenance and signage changes. Items include termite damage repair at 2274 Ashley River Rd, fence replacement at 621 Skylark Dr, and a gas station sign rebrand from Exxon to Refuel at 860 Island Park Dr.

design-reviewquick-plancommercial-maintenancesignagetermite-damagefenceroofhvac
Mon Jun 16, 2025

Public Works and Utilities Committee

Public Works committee to vote on stormwater contracts and fee collection

The Public Works and Utilities Committee will consider construction and professional services contracts for stormwater and road improvements. The body will also discuss agreements for stormwater utility fee collection with Charleston and Berkeley counties.

stormwatercontractsinfrastructureeasementsfees
✓ Decided: Committee unanimously approved stormwater fee agreements and a $351,420.70 retrofit contract

The Public Works & Utilities Committee approved the May 22 meeting minutes and accepted drainage easements for Ferguson Village and Indigo Grove Phase 1. It also approved agreements with Charleston County and Berkeley County to collect city stormwater utility fees. Finally, the committee approved a $351,420.70 construction contract for the Howle Avenue stormwater retrofit project, funded by a National Fish and Wildlife Foundation grant. Temporary encroachments were noted for information only.

Mon Jun 16, 2025

City Council

Real Estate Committee to consider transfer for senior affordable housing tax credit

The Committee on Real Estate will consider an ordinance authorizing the mayor to consent to a property transfer for Poinsette Senior Apartments LLC to receive low-income housing tax credits for senior housing. Other items include a lease agreement with the Charleston County Park and Recreation Commission for the Riverland Terrace Boat Landing, a parking agreement with the school district for 33 Alexander Street, and four annexation requests for properties in West Ashley and James Island.

real-estatehousingaffordable-housingsenior-housingleaseparkingannexation
✓ Decided: Committee approved four residential annexations unanimously

The Real Estate Committee unanimously approved the May 22, 2025 meeting minutes. The committee voted unanimously to defer the lease agreement for the Riverland Terrace Boat Landing. It also voted unanimously to approve four residential annexations in James Island and West Ashley.

Mon Jun 16, 2025

Board of Architectural Review

Board of Architectural Review staff reviews 48 property permits

The Board of Architectural Review is processing staff approvals for 48 quick plan reviews. These items consist of residential and commercial exterior modifications, including painting, roofing, and structural renovations.

zoningarchitecturepermitsresidentialcommercial
Thu Jun 12, 2025

Human Affairs and Racial Conciliation Commission

Routine meeting with subcommittee updates and public comment

This is a procedural meeting of the Human Affairs and Racial Conciliation Commission. No ordinances, contracts, or specific decisions are listed; the agenda includes a call to order, moment of silence, public comment, approval of prior minutes, chairperson comments, manager's updates, subcommittee updates under old business, and open discussion.

human-affairsracial-conciliationcommissionproceduralpublic-comment
✓ Decided: Commission unanimously approves minutes and opposes curfew, requests ordinance review

The commission unanimously approved the May 8, 2025 meeting minutes. They also voted unanimously to go on the record that they do not fully support the proposed youth curfew ordinance. Additionally, the commission unanimously voted to request the City Council review the First Amendment demonstration ordinance.

Thu Jun 12, 2025

Technical Review Committee

136-room hotel, 62-unit complex, and Magnolia phases on TRC agenda

The Technical Review Committee will review 14 items including site plans, preliminary plats, and road construction plans. Key proposals are a 136-room hotel at 804 Orleans Rd, a 62-unit multifamily development at 215 Promenade Vista St, and multiple phases of the Magnolia development on the Peninsula. The committee also considers offsite parking for Orange Grove Charter School and sidewalk improvements on Old Towne Road.

site-planssubdivisionshotelsmultifamily-housingschoolssidewalkspeninsula-developmentzoning
Thu Jun 12, 2025

Technical Review Committee

136-room hotel proposed at 804 Orleans Rd

The Technical Review Committee considers 14 site plans, subdivisions, road plans, and concept plans. Items include a 136-room hotel on Orleans Road, a 62-unit multifamily development on James Island, and several subdivision and road improvement projects. Most items were marked 'Revise and return' or 'Open pending stormwater comments'.

zoningdevelopmentsite-plansubdivisionhotelroads
Thu Jun 12, 2025

Board of Architectural Review

BAR-S reviews demolition, addition, and new construction in historic districts

The Board of Architectural Review – Small will consider 15 applications, including partial demolitions at 257 W. Poplar, 10 Hester, and 115 Moultrie streets, conceptual approvals for additions at several properties, and two appeals of staff decisions. Two items (2 Longitude Lane and 9 Allway Street) have been withdrawn. The board will also approve minutes from previous meetings.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonzoningbuilding-permitsappeals
Thu Jun 12, 2025

Board of Architectural Review

Board of Architectural Review to consider partial demolitions in Wagener Terrace

The Board of Architectural Review - Small is reviewing requests for partial demolitions of historic materials at two properties. The board will evaluate the removal of specific architectural features to determine if they are character-defining for the area.

zoninghistoric-preservationdemolitionwagener-terrace
Thu Jun 12, 2025

Board of Architectural Review

Board of Architectural Review denies demolition request for 257 W. Poplar Street

The Board of Architectural Review - Small reviewed several demolition and conceptual construction applications for historic properties. The board approved partial demolitions and conceptual plans for multiple sites while denying one request and deferring others for further study.

zoninghistoric-preservationdemolitionarchitectureCharleston
Thu Jun 12, 2025

Board of Architectural Review

BAR-S to decide on 15 historic properties, including roof replacement appeal

The Board of Architectural Review – Small will consider 15 applications for demolitions, additions, and alterations in Charleston's historic districts. Items include an appeal of a staff decision to replace a metal roof with asphalt shingles at 9 Allway Street, where the Preservation Society opposes the change. Other requests range from partial demolitions to new construction, with public comments submitted for two properties.

historic-preservationboard-of-architectural-reviewdemolitionnew-constructionappealscharleston
Thu Jun 12, 2025

Community Development

Committee to review 2025-2029 Consolidated Plan and federal HUD funding

The Community Development Committee will review and approve budgets for CDBG, HOME, and HOPWA funding for 2025-2026. The body will also review the 2025-2029 Consolidated Plan and the 2025-2026 Annual Action Plan.

hudhousingbudgetcommunity-developmentgrants
✓ Decided: Committee unanimously approved grant budgets and the consolidated plan

The Community Development Committee voted unanimously to approve the 2025‑2026 budgets for the Community Development Block Grant, HOME Investments Partnerships Program, and Housing Opportunities for Persons with AIDS. The committee also voted unanimously to approve the 2025‑2029 Consolidated Plan, including the 2025‑2026 Annual Action Plan, with suggested footnote amendments. No decision was made on the Section 108 Loan, which has been paid off but could be used again for $4.2 million.

Wed Jun 11, 2025

Special Events Committee

Committee to discuss OCA Juneteenth on Ann St. with 2,000 attendees

The Special Events Committee will discuss several upcoming events, including the OCA Juneteenth block party, Veteran's Day Parade, and RiverDogs post-game cannon/drone show. No votes or decisions are scheduled; the meeting is for discussion only. The next meeting is July 9, 2025.

special-eventsblock-partyparadefestivaljuneteenthveterans-daycharleston
Wed Jun 11, 2025

Special Events Committee

Committee approves several city-sponsored events, including Veteran's Day Parade

The Special Events Committee reviewed and approved minutes from the May 14 and May 28 meetings. It received an update that there will be no Special Events Committee meeting on June 25, 2025. The committee approved eight event proposals, such as the Veteran’s Day Parade, Juneteenth Block Party, and Daniel Island Independence Day Celebration, noting required officer support and safety plans.

special-eventsparadespublic-safetycity-sponsoredcommunity
Wed Jun 11, 2025

Board of Architectural Review

Board to consider final approval of demolition of former YWCA at 106 Coming Street

The Board of Architectural Review – Large will consider several applications, including final approval for full demolition of the former YWCA building at 106 Coming Street, final approval of mock-up panels for new construction at 71 George Street and 573 Meeting Street, and a comprehensive signage package for the College of Charleston at 66 George Street. Also on the agenda is conceptual approval for renovation of the Florence Crittenton House at 19 Saint Margaret Street. One item, a new affordable housing building at 275 Huger Street, has been withdrawn by the applicant.

historic-preservationdemolitionnew-constructionsignagecollege-of-charlestonbar-largeboard-of-architectural-review
Wed Jun 11, 2025

Board of Architectural Review

BAR to vote on mock-up panel for College of Charleston Stern Center renovation

The Board of Architectural Review will consider final approval of a mock-up panel for a new construction project at 71 George Street in the Old and Historic District (Harleston Village). The item is the only application on the agenda, in addition to approval of minutes from the May 14 meeting.

architectural-reviewhistoric-districtcollege-of-charlestonconstructioncharleston-sc
Wed Jun 11, 2025

Board of Architectural Review

Board approves demolition of former YWCA building at 106 Coming Street

The Board of Architectural Review reviewed several construction and signage requests for the College of Charleston and One80 Place. The body approved the demolition of a 1964 building and granted conceptual approval for a campus signage package.

demolitionsignagenew-constructionhistoric-preservationcollege-of-charleston
Wed Jun 11, 2025

Board of Architectural Review

Board to consider demolition of former YWCA building amid burial ground concerns

The Board of Architectural Review – Large will vote on final approval of mock-up panels, signage, and demolitions, including full demolition of the former YWCA at 106 Coming Street, where public comments cite a historic burial ground. Other items include signage at 66 George Street, facade signs, and renovation conceptual approval for Florence Crittenton House. A proposed affordable housing building at 275 Huger Street was withdrawn by the applicant.

historic-preservationdemolitionsignagenew-constructionaffordable-housingcollege-of-charlestonpublic-hearing
Tue Jun 10, 2025

Public Safety Committee

Police seek $85,000 contract for reentry services, plus permit appeal

The Public Safety Committee will consider a $85,000 contract with Turn90 for reentry and rehabilitation services for formerly incarcerated men, a law enforcement support agreement with Dorchester County, an animal services agreement, and an appeal of a denied First Amendment Demonstration Permit.

policereentrybudgetanimal-servicesfirst-amendmentpublic-safetycontracts
✓ Decided: Approved $85K reentry contract and $991K animal services agreement

The Public Safety Committee unanimously approved the May 20 minutes. It also unanimously approved an $85,000 contract with Turn90 for reentry services and a Law Enforcement Assistance and Support Agreement with the Dorchester County Sheriff’s Office. The committee approved an Animal Services Agreement with the Charleston Animal Society, covering an estimated $991,518 annual fee; the vote was not unanimous as Councilmember Brady recused himself.

Mon Jun 9, 2025

Design Review Board

DRB staff reviews 9 quick-plan permits for signs and mechanical work

This meeting lists Design Review Board staff-level quick plan approvals for nine permit applications, including sign installations and replacements, a commercial interior alteration, and mechanical unit replacements. No board discussion or public hearings are scheduled; all items are handled administratively.

design-reviewsignscommercialmechanicalstaff-approvals
Mon Jun 9, 2025

Board of Architectural Review

Board of Architectural Review staff reviews 21 property modification requests

The Board of Architectural Review staff is reviewing a series of permit applications for residential and commercial properties. These requests include exterior renovations, sign installations, and structural repairs.

zoningarchitecturepermitsrenovationssigns
Thu Jun 5, 2025

Technical Review Committee

TRC reviews 350-lot Maybank Landing preliminary plat on Johns Island

The Technical Review Committee will review a preliminary plat for a 350-lot development at 3124 Maybank Highway on Johns Island, along with road construction plans for the same site. Other items include a 16-unit townhome project on James Island, a new freestanding emergency department for MUSC in West Ashley, and a mixed-use PUD on the Peninsula. Some items have been withdrawn or deferred.

developmentsubdivisionsite-planroadsemergency-hospitalmixed-usezoning
Thu Jun 5, 2025

Technical Review Committee

TRC to review revised site plan for MUSC emergency hospital in West Ashley

The Charleston Technical Review Committee (TRC) will meet via Zoom to review site plans, subdivision plats, and road construction plans. The most notable item is a revised site plan for a new freestanding emergency department at MUSC's West Ashley location (2080 Sam Rittenberg Blvd). Other items include a 16-townhome development on James Island, a community center for the Point Hope development, and preliminary plats for subdivisions on Cainhoy and in West Ashley.

technical-review-committeesite-planssubdivisionsdevelopmentcharlestonhealthcareroadsstormwater
Thu Jun 5, 2025

Keep Charleston Beautiful

Keep Charleston Beautiful to vote on board and vice chair positions

The body will conduct a financial report and review youth education programs and mid-year strategic planning. Members will vote on the appointment of Taylor Hodges to the board and a Vice Chairperson. The meeting also covers upcoming summer projects and cleanup events.

beautificationcommunity-outreacheducationvolunteeringboard-appointments
Wed Jun 4, 2025

Board of Zoning Appeals Site Design

Board reviews extension request for 158 Spring Street and several tree removal variances

The Board of Zoning Appeals – Site Design will first review minutes from its May 7, 2025 meeting. It will then consider new applications, including a one‑year extension of a prior approval for 158 Spring Street and multiple variance requests to remove protected trees at various properties. One application (48 King Street) has been withdrawn, and the variance for 100 Coastal Drive is marked deferred.

zoningsite-designtree-variancesextensionspublic-comment
Wed Jun 4, 2025

Board of Zoning Appeals Site Design

Variance sought to remove 24 protected trees at 100 Coastal Drive

The Board of Zoning Appeals will decide on two items: a one-year extension for a previously approved project at 158 Spring Street, and a variance request to remove 24 protected trees at 100 Coastal Drive on Daniel Island. The board will also approve minutes from the May 7 meeting.

zoningvariancetree-removalpublic-hearingcharleston
Wed Jun 4, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals approves several tree removals and site variances

The Board of Zoning Appeals – Site Design reviewed requests for tree removals, project extensions, and buffer encroachments. The board approved four applications and deferred or saw the withdrawal of three others.

zoningtree-removalvarianceslandscapingsite-design
Wed Jun 4, 2025

Board of Zoning Appeals Site Design

Board to decide on variance to remove 24 protected trees at 100 Coastal Drive, Daniel Island

The Board of Zoning Appeals – Site Design will hold a public comment meeting on June 4, 2025, to consider six agenda items. The most contested item is a variance request to remove 24 protected trees at 100 Coastal Drive, which has drawn 331 public comments and opposition from the Daniel Island Neighborhood Association. Other items include a one-year extension of a prior approval, two reconsiderations of denied tree removals, a variance to remove one protected tree, and an after-the-fact variance for a retaining wall encroachment. One item (48 King Street) has been withdrawn.

zoningtreesvariancepublic-hearingdaniel-islandprotected-treesboard-of-zoning-appeals
Wed Jun 4, 2025

Commission on History

Commission on History to review Liberty Square and Memorial Park markers

The Commission on History will discuss historical marker text for the British Evacuation of Charleston at Liberty Square. The body will also review a storyboard concept for the Charleston 9 Memorial Park and the Commission's 2020 Resolution.

historymemorialspublic-markerscharleston-9
✓ Decided: History Commission unanimously approved April minutes and Liberty Square marker text

The commission voted unanimously to approve the April 2, 2025 meeting minutes (item B1). They also unanimously approved side 1 of the Liberty Square marker on the British evacuation of Charleston. Finally, they unanimously approved side 2 of the same marker, with an amendment to line 5.

Tue Jun 3, 2025

Board of Zoning Appeals Zoning

Board approves extension for 175-unit accommodations on Columbus St.

The Board of Zoning Appeals voted on six items at its June 3 meeting, approving a first-year extension of a vested right for a 175-unit accommodations project at 131 Columbus St., denying two appeals of short-term rental denials, and granting variances for residential projects at 188 Coming St., 194 Tradd St., and 1416 Emerald Forest Parkway. One request, for an accessory dwelling unit at 2b Piedmont Ave., was deferred pending a neighborhood association support letter.

zoningvariancesshort-term-rentalsvested-rightsboard-of-zoning-appeals
Tue Jun 3, 2025

Board of Zoning Appeals Zoning

Board reviews several variances, notably a pool enclosure at 1416 Emerald Forest Parkway

The Charleston Board of Zoning Appeals will review minutes from its May 20, 2025 meeting and consider a slate of applications. Items include variances for setbacks and lot coverage, a one‑year extension of a vested right for a 175‑unit accommodation, and appeals of staff denials for Category 2 residential short‑term rentals. Decisions will affect properties in Council Districts 2, 4, 6, and 8.

zoningvariancesspecial-exceptionshort-term-rentalextensions
Tue Jun 3, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals considers variance and special exception requests

The Board of Zoning Appeals will consider a variance for a new home at 188 Coming St. and a special exception for a building addition at 194 Tradd St. The meeting will also include the approval of prior minutes and a request to extend a vested right for a 175-unit project at 131 Columbus St.

zoningvariancespecial-exceptionplanningcannonboroughcharleston
Tue Jun 3, 2025

Board of Zoning Appeals Zoning

Board to hear appeals on two short-term rental denials

The Board of Zoning Appeals – Zoning will consider two appeals of staff denials for Category 2 short-term rental applications at 107 America St and 30 Ashton St, with opposition from the Preservation Society and a resident citing the housing crisis. Additionally, three variance requests are on the agenda: a new home at 188 Coming St with reduced side setbacks, a pool enclosure at 1416 Emerald Forest Pkwy with rear setback and lot coverage variances, and an accessory dwelling unit at 2b Piedmont Ave with front and side setback variances.

zoningvariancesshort-term-rentalsappealspublic-hearingcharlestonhousing
Mon Jun 2, 2025

Design Review Board

DRB to review new 10,000 sq ft daycare, retail building, sign appeal

The Design Review Board will consider three applications: an appeal of a staff decision on signage at 1804 Sam Rittenberg Blvd., conceptual approval for a new 1-story retail building at 1109 Wappoo Rd., and conceptual approval for a new 10,000 sq ft child daycare facility at 3309 Maybank Hwy. The board will also review minutes from the May 5, 2025 meeting.

design-reviewwest-ashleyjohns-islanddaycareretailsigns
✓ Decided: Design Review Board gives conceptual approval to a new child daycare facility

The board upheld staff’s denial of additional signage at 1804 Sam Rittenberg Blvd (5‑0). It deferred the conceptual approval of a 1‑story retail building on 1109 Wappoo Rd pending further study (4‑0). It granted conceptual approval, with conditions, for a 10,000 sq ft child daycare on 3309 Maybank Hwy (5‑0). The minutes from the May 5 meeting were also approved (5‑0).

Mon Jun 2, 2025

Design Review Board

Appeal over denied signage for First National Bank

The Design Review Board will hear an appeal regarding a staff decision to deny four proposed signs. The staff determined that the requested two facade signs and two directional signs were excessive.

signagedesign-reviewcommercial-property
Mon Jun 2, 2025

Design Review Board

Design Review Board approves new 10,000 sq ft daycare on Maybank Hwy

The Design Review Board denied an appeal for excessive signage at 1804 Sam Rittenberg Blvd, deferred a proposed retail building at 1109 Wappoo Rd for design and stormwater revisions, and granted conceptual approval for a 10,000 sq ft daycare at 3309 Maybank Hwy with conditions. The board also approved the minutes from the May 5, 2025 meeting.

design-reviewsignagedaycareretailwest-ashleyjohns-islandcommercial-developmentland-use
Mon Jun 2, 2025

Design Review Board

Design Review Board to consider new retail and daycare projects

The Design Review Board is reviewing conceptual approvals for two new buildings and an appeal regarding signage. The board will evaluate a retail project on Wappoo Road and a daycare facility on Maybank Highway.

zoningcommercial-developmentsignagedaycarewest-ashleyjohns-island
Mon Jun 2, 2025

Design Review Board

Design Review Board to review eight staff-approved permits

The Design Review Board is reviewing eight staff-approved quick plan reviews for commercial fences, signs, a mock-up panel, electrical and mechanical work, and a communication tower installation. No substantive policy decisions or public hearings are scheduled; the agenda consists entirely of routine administrative approvals.

design-reviewpermitsfencessignscommunication-towercommercialstaff-approvals
Mon Jun 2, 2025

Board of Architectural Review

BAR staff approves 36 quick-plan reviews for demolitions, pools, signs

The Board of Architectural Review staff approved 36 permit applications under quick plan review from June 2 to June 6. Items include demolitions, new pools, roofing, painting, sign installations, and interior/exterior renovations at various Charleston properties. No public hearings or policy changes were considered.

barhistoric-preservationdemolitionpoolssignsrenovationscharleston
Wed May 28, 2025

Special Events Committee

Special Events Committee to discuss 10 event applications for June and July 2025

The Special Events Committee is meeting to discuss various event applications, including festivals, parades, and private parties. The body will review requests for street closures and park usage for events in the Peninsula and West Ashley areas.

special-eventsstreet-closuresfestivalsparadespublic-safety
Wed May 28, 2025

Special Events Committee

Special Events Committee approves multiple June and November events

The Special Events Committee reviewed and approved several upcoming festivals, parades, and private parties. Decisions focused on street closures, police staffing requirements, and safety plan submissions.

special-eventsstreet-closurespublic-safetypermits
Tue May 27, 2025

Design Review Board

Design Review Board reviews demolition and signage requests

The Design Review Board is processing staff approvals for signage, demolitions, and plumbing work. These items are undergoing Quick Plan Review for various properties in Charleston.

demolitionsignageplumbingdesign-review
Tue May 27, 2025

City Council

City Council to consider $9M bond for new West Ashley office building

City Council will discuss several zoning changes, property annexations, and stormwater utility fee adjustments. The body is also reviewing multiple construction contracts and a grant application for property acquisition on James Island.

zoningbudgetstormwaterwest-ashleypublic-worksreal-estate
✓ Decided: No council actions were decided at the May 27, 2025 meeting

The May 27, 2025 City Council meeting consisted of presentations on a storm‑water fee amendment, a street abandonment request, several rezoning and height‑district proposals, and annexation items. No votes or formal approvals, denials, or tablings were recorded in the minutes. The meeting concluded after a public hearing with ten speakers.

Tue May 27, 2025

City Council

Council to approve $385k contract for Sam Rittenberg Blvd redesign

The City Council will consider approving a contract with Staniec Consulting Services, Inc. to redesign Sam Rittenberg Boulevard. The request seeks $385,000 from Department 430000, Account #5220, which has a balance of $550,500. Funding of $400,000 was previously approved in the 2024 budget and reserved again in the 2025 budget.

ways-and-meansbudgetstreetscontracts
✓ Decided: Committee approved $1.998M design‑builder contract for new city office building

The Ways and Means Committee unanimously approved several contracts, including a $1.998 M design‑builder agreement for the new city office building at Ingram Road. It also adopted a resolution to seek reimbursement from tax‑exempt bonds for up to $9 M to fund that building. Additional approvals covered software services, police fleet equipment, a park playground, and storm‑water projects. One professional services contract was deferred, and a FEMA grant application was approved for submission.

Tue May 27, 2025

Board of Architectural Review

Approval review of 41,500‑sqft Ronald McDonald House special‑needs housing project

The Board of Architectural Review will conduct staff approvals for a range of permits, from single‑family remodels to commercial projects. A major item is the proposed 41,500‑sqft, five‑story special‑needs housing development for Ronald McDonald House Charleston. Additional items include sign encroachment reviews, a new gunite pool installation, and various exterior repair and roofing permits.

housingcommercialresidentialpermitsconstructionzoning
Tue May 27, 2025

Traffic and Transportation Committee

Committee to consider pedicab decal renewals and transportation updates

The Traffic and Transportation Committee will discuss updates on the Ashley River Crossing and Lowline projects. The body is considering an ordinance to change how pedicab operating decals are renewed to provide more business certainty.

pedicabstransportationroadssidewalkszoning
✓ Decided: Committee unanimously recommends $11.5 M change order for Ashley River Crossing

The Traffic and Transportation Committee approved the April 22, 2025 meeting minutes unanimously. It then voted unanimously to recommend sending a change order of up to $11.5 million for additional access points on the Ashley River Crossing bridge to the City Council's Ways and Means Committee.

Thu May 22, 2025

Redevelopment and Preservation Commission

Commission to consider roof rehab for three properties

The Redevelopment and Preservation Commission will meet via Zoom to consider roof rehabilitation requests for three properties under the Roof Rehabilitation Program. The agenda also includes approval of previous minutes, a progress report, and public comment.

housingredevelopmentpreservationroof-rehabilitationpublic-meeting
Thu May 22, 2025

Technical Review Committee

Dolphin Cove redevelopment and nine other projects under technical review

The City of Charleston Technical Review Committee will review site plans, preliminary plats, and road construction plans for nine developments. Projects include a redevelopment at 2079 Austin Ave, a 15-lot subdivision on James Island, a 22-unit conservation development on Johns Island, a mixed-use with 119 units near the peninsula, and subdivisions with 83 and 103 lots. All items are under review; no final decisions are made at this meeting.

technical-review-committeesite-plansubdivisiondevelopmentcharlestonzoning
Thu May 22, 2025

Technical Review Committee

TRC reviews 119-unit mixed-use at 31 George St, plus other developments

The Technical Review Committee will discuss and provide feedback on nine site plans, subdivision concept plans, preliminary plats, and road construction plans. All items are under review, with most resulting in a request for revisions. The most notable project is the proposed 119-unit mixed-use development at 31 George Street, along with a redevelopment of 2079 Austin Avenue for boat storage and parking.

technical-review-committeesite-planssubdivisionsmixed-useresidential-developmentboat-storagecharleston
Thu May 22, 2025

Public Works and Utilities Committee

Committee to consider shifting stormwater fees from water bills to property tax bills

The Public Works and Utilities Committee will discuss and vote on several items, including an ordinance to change stormwater utility fee billing from water bills to county property tax bills. They will also consider approving a $409,345 fee amendment for the Lake Dotterer Flood Reduction Project, a $1.7 million FEMA grant application for acquiring flood-prone properties on James Island, and a $260,142 change order for ADA ramp modifications at Low Battery Phase IV. Other items include accepting sidewalk maintenance on Oceanic Street and Clements Ferry Road, granting a utility easement on Scott Island Court, and authorizing a $20,000 MOU for sediment cleanup at Charlestowne Estates.

public-worksutilitiesstormwaterfloodingordinancefeesgrantssidewalk
✓ Decided: Committee unanimously approved annexations of two West Ashley properties

The Real Estate Committee approved the April 21, 2025 meeting minutes. It also authorized the mayor to execute a deed transferring 695 sq ft of right‑of‑way to Charleston County for $2,600 to support intersection improvements. Finally, the committee unanimously approved annexing two West Ashley parcels—1963 Green Park Avenue and 1812 Debbenshire Drive.

Thu May 22, 2025

City Council

Council to consider leasing Meeting Street space as temporary fire station

The Committee on Real Estate will consider several real estate actions, including a lease with Clemson University for use of 292 and 296 Meeting Street as a temporary fire station for $1 annually. Other items include a quitclaim of a right-of-way, a park lease extension, a property sale for intersection improvements, a police substation license at Citadel Mall, and two annexations.

real-estatefire-stationpolice-substationannexationleasestransportation
✓ Decided: Committee approved two West Ashley residential annexations

The Real Estate Committee unanimously approved the April 21 meeting minutes and authorized several actions, including a $2,600 deed to Charleston County for intersection improvements, a $1‑per‑year lease with Clemson University for a temporary fire station, a five‑year lease extension with Dominion Energy for Freddie Whaley Park, and a license agreement for a police substation at the Citadel Mall. The committee also unanimously approved the annexation of two West Ashley properties.

Thu May 22, 2025

Board of Architectural Review

Full demolition renewal for Clemson-owned 292 Meeting Street considered

The Board of Architectural Review – Small will consider 15 applications, including demolition requests, new construction, and an appeal of a staff decision. Notable items include a full demolition renewal for a Clemson University property at 292 Meeting Street and after-the-fact approval for partial demolition at 190 Nassau Street. One application (158 Spring Street) has been withdrawn by the applicant.

historic-preservationdemolitionnew-constructionboard-of-architectural-reviewcharlestonpublic-hearing
Thu May 22, 2025

Board of Architectural Review

Board of Architectural Review to consider three demolition requests

The Board of Architectural Review - Small is meeting to review minutes and consider three applications regarding the demolition of structures or portions of structures in Wagener Terrace and the Old and Historic District.

demolitionhistoric-preservationzoningarchitecture
Thu May 22, 2025

Board of Architectural Review

Board approves demolition of 292 Meeting Street for temporary fire station

The Board of Architectural Review – Small made decisions on nine applications. Approved full demolition of 292 Meeting Street for a temporary fire station, and approved with conditions partial demolitions at 20 Alberta Avenue and 17 Pinckney Street. Also granted conceptual approvals for new construction at 63 Kennedy Street and 194 Tradd Street, and deferred a new home proposal at 13 Trumbo Street for restudy.

architectural-reviewdemolitionhistoric-districtcharlestonnew-constructionpreservation
Thu May 22, 2025

Board of Architectural Review

Board of Architectural Review to consider demolition and construction requests

The Board of Architectural Review – Small will review 15 applications regarding property modifications. The board is deciding on requests for full and partial demolitions, new construction, and conceptual additions across various historic districts.

demolitionzoninghistoric-preservationresidential-constructionarchitecture
Wed May 21, 2025

Planning Commission

Planning Commission to vote on three West Ashley rezoning requests

The Charleston Planning Commission will consider three rezoning requests for properties in West Ashley, each seeking to change from county residential zoning to city single-family residential districts. One item (0 Folly Road) is deferred. The meeting includes public comment opportunities and approval of prior minutes.

zoningplanning-commissionwest-ashleyrezoningpublic-hearingcharleston
✓ Decided: Planning Commission approves three residential zoning requests and minutes

The commission approved the minutes from the April 16, 2025 meeting, with one abstention. It unanimously approved residential zoning for 1344 Vine Street, 1933 Ivy Hall Road, and 2484 Liverpool Drive. The zoning request for 0 Folly Road was deferred.

Wed May 21, 2025

Planning Commission

Planning Commission considers three rezoning requests in West Ashley

The Planning Commission will vote on recommendations for three rezoning requests to bring properties into the city's zoning code. All three parcels are currently zoned Residential (R-4) in Charleston County and would become city single-family residential districts (SR-3 or SR-1). Staff recommends approval for each. One item (0 Folly Road) is deferred.

planning-commissionzoningwest-ashleysingle-family-residentialrezoning
Wed May 21, 2025

Planning Commission

Approved SR-1 zoning for 2484 Liverpool Drive, deferred 0 Folly Road rezoning

The Planning Commission approved the April 16 minutes and a zoning change for 2484 Liverpool Drive to Single Family Residential (SR-1). A rezoning request for 0 Folly Road was deferred. Two other rezoning requests at 1344 Vine Street and 1933 Ivy Hall Road were listed but no vote recorded.

zoningplanning-commissioncharlestonjames-islandwest-ashleysingle-family-residentialdeferredminutes
Wed May 21, 2025

Planning Commission

Commission to vote on three West Ashley rezonings; Folly Road deferred

The Planning Commission will hold public hearings on four rezoning requests. One request (0 Folly Road, James Island) has been deferred. The remaining three seek to rezone parcels in West Ashley from county Residential R-4 to city single-family residential designations (SR-1 or SR-2). No public comments were submitted for the three active items; three opposing comments were submitted for the deferred item.

zoningplanning-commissionwest-ashleyjames-islandresidential-rezoningdeferred
Tue May 20, 2025

Public Safety Committee

Committee to consider ordinance establishing a juvenile curfew in Charleston

The Public Safety Committee will vote on a proposed ordinance to add a new Section 21-114 to the city code creating a juvenile curfew. The committee also reviews several grant applications: a $1.7 million port security grant requiring a $431,900 match, a $299,170 subaward for community outreach, and an $8,200 grant for underwater sonar equipment. An appeal regarding a demonstration permit has been withdrawn.

public-safetypolicefiregrantsjuvenile-curfewordinancemousunderwater-response
✓ Decided: Committee unanimously approves amended juvenile curfew ordinance for downtown Charleston

The Public Safety Committee voted unanimously to amend and approve a new juvenile curfew ordinance (Section 21-114) that expands the curfew zone and adds June to the summer months. It also approved grant applications for $8,200 (Gary Sinise Foundation), $1,727,600 (FY25 Port Security Grant), and a subaward of up to $299,170.44 to Tri‑County S.P.E.A.K.S. under the FY24 Abby Honold Grant. The committee approved an MOU with the U.S. Coast Guard for rescue services on Cutter Kingfisher. An appeal regarding a First Amendment permit was withdrawn.

Tue May 20, 2025

Board of Zoning Appeals Zoning

Board to weigh office parking exception, setback variances for multiple properties

The Board of Zoning Appeals will hold public hearings and decide on several applications for special exceptions and variances from zoning regulations. Items include a request to allow office space without required parking at 28 Hasell St., a second-story addition extending a non-conforming setback at 1010 Ashley Ave., a generator stand setback variance at 2 King St., and a new home setback variance at 519 Rutledge Ave.

zoningvariancesspecial-exceptionboard-of-zoning-appealscharleston
Tue May 20, 2025

Board of Zoning Appeals Zoning

Board to rule on parking exception at 28 Hasell St. and three variances

The Charleston Board of Zoning Appeals - Zoning will consider a special exception for office space without required parking at 28 Hasell St. and variance requests for setback reductions at 1010 Ashley Ave., 2 King St., and 519 Rutledge Ave. The board will also approve minutes from previous meetings.

zoningvariancesspecial-exceptionsboard-of-zoning-appealscharleston
Tue May 20, 2025

Board of Zoning Appeals Zoning

Board approves special exception for office space at 28 Hasell St. without required parking

The Charleston Board of Zoning Appeals approved the minutes from the April 15 and May 6 meetings. It granted a special exception for 28 Hasell St. to allow 1,997 sf of office space without the four required parking spaces, with conditions. The board also approved a special exception for 1010 Ashley Ave. to add a second story, and variances for 2 King St. and 519 Rutledge Ave. were approved.

zoningspecial-exceptionvariancehistoric-districtboard-of-zoning-appeals
Tue May 20, 2025

Board of Zoning Appeals Zoning

Board to weigh parking exception for Hasell St. office

The Board of Zoning Appeals will consider two special exception requests. One seeks to allow 2,100 sq ft of office space at 28 Hasell St. without the required five parking spaces. The other seeks a second-story addition at 1010 Ashley Ave. that would extend an existing non-conforming side setback. Public comments submitted for both items will be acknowledged.

zoningboard-of-zoning-appealsspecial-exceptionparkingsetbackcharleston
Mon May 19, 2025

Design Review Board

Design Review Board considers new emergency department at 960 Charleston Regional Pkwy

The Design Review Board will conduct quick plan reviews for six staff-approved projects. The largest is a new 10,500-square-foot freestanding emergency department at 960 Charleston Regional Parkway. Other items include a fence replacement, new signs, and window upgrades.

design-reviewconstructionemergency-departmentfencesignswindowselectrical
Mon May 19, 2025

Board of Architectural Review

BAR staff processes 52 quick-plan permits for roofs, renovations, new construction

The Charleston Board of Architectural Review staff will review 52 quick-plan permit applications from May 19 to 23, 2025. Items include roofing replacements, exterior painting, renovations, and new construction, such as a three-story house at 205 Wentworth St and conversion of a church at 179 Fishburne St to a single-family residence. All approvals are administrative and do not require a board hearing.

board-of-architectural-reviewstaff-approvalsbuilding-permitsrenovationsnew-constructionpaintingcharleston
Fri May 16, 2025

Commission on Disability Issues

Commission on Disability Issues to discuss traffic safety for people with disabilities

The Mayor’s Commission on Disability Issues will meet to discuss traffic safety with a regional planner from the Berkeley-Charleston-Dorchester Council of Governments. The body will also review planning for a July 2025 celebration event.

disability-servicestraffic-safetyaccessibilitypublic-safety
✓ Decided: Commission unanimously approved March 2025 minutes as amended

The Charleston Disability Commission approved the March 2025 meeting minutes, amended as requested, with a unanimous vote. No members requested public comment. The commission received updates on the July ADA celebration and a traffic‑safety presentation, but no actions were taken on those items.

Thu May 15, 2025

Technical Review Committee

Technical Review Committee to review 15 site and subdivision plans

The Technical Review Committee is reviewing site plans, preliminary plats, and road construction plans for various developments. These reviews cover commercial, residential, and medical projects across the Peninsula, West Ashley, Cainhoy, and Johns Island.

zoningsite-planssubdivisionscommercial-developmenthousingroads
Thu May 15, 2025

Technical Review Committee

Technical Review Committee to review 15 site and subdivision plans

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans. The body is evaluating several residential and commercial developments across the Cainhoy, Peninsula, West Ashley, and Johns Island areas.

zoningsite-planssubdivisionsroad-constructioncommercial-developmenthousing
Thu May 15, 2025

Human Resources Committee

HR committee to discuss compensation study and director search

The Human Resources Committee will discuss several personnel matters including a staffing and retention report, a recruitment policy review, a compensation study update, and an update on the search for a new Human Resources Director. Old business includes follow-up on a CSI Committee discussion and sworn hiring practices. No votes or formal decisions are listed on the agenda.

human-resourcescompensationrecruitmentstaffinghiring
✓ Decided: Human Resources Committee unanimously approved February 20, 2025 minutes

The committee approved the February 20, 2025 Human Resources meeting minutes after a motion by Mayor Cogswell and a second by Councilmember Mitchell. The vote was unanimous. No other motions or votes were recorded during the meeting.

Thu May 15, 2025

Resilience & Sustainability Advisory Committee

Resilience & Sustainability Committee reviews Army Corps partnership, Rainproof programs

The committee receives updates on sustainability and resilience initiatives, including programmatic achievements, Rainproof partnerships, the Just Corridor, Army Corps partnership, Rosemont resilience, grant opportunities, and WaterWise Charleston. The chair offers comments, and a public comment period is held.

sustainabilityresiliencewaterpartnershipsgrantscommitteepublic-comment
Thu May 15, 2025

Community Development

Committee to discuss WestEdge investment, Missing Middle housing

The Community Development Committee will hold a public hearing and consider a resolution certifying 82 Radcliffe Street as an abandoned building under state law, enabling redevelopment incentives. Members will discuss and possibly vote on the city's next steps for its WestEdge investment, and hear a presentation on Missing Middle housing strategies. An ordinance amending the Human Affairs and Racial Conciliation board structure is also scheduled for discussion.

community-developmentabandoned-buildingswestedgemissing-middlehousingracial-conciliationordinance
✓ Decided: Committee recommended approval of up to $25M WestEdge property buyout

The committee unanimously approved the minutes from the March 20, 2025 meeting and a resolution certifying 82 Radcliffe Street as an abandoned building. It voted to recommend the city purchase the WestEdge property from MUSC for no more than $25 million, using $10 million cash and the remainder over time; Councilmember Parker abstained on that vote. The committee also unanimously deferred consideration of an ordinance to amend the HARCC commission until September.

Thu May 15, 2025

Livability Review Board

Board to review vacant structure at 94 Nassau St.

The Livability Review Board will hold a hearing to discuss the status of the vacant structure at 94 Nassau Street (c. 1890) in the Eastside neighborhood. Staff will also provide updates on other properties previously before the board.

vacant-propertieslivabilitycharleston
Thu May 15, 2025

Recreation Committee

Committee to vote on Municipal Golf Course rate increases

The Recreation Committee will consider approving rate increases for the Municipal Golf Course, with proposed green fee hikes ranging from $1 to $8 per round. The agenda also includes updates on capital projects, park maintenance, a proposed parks bond referendum, and discussions on recreation ordinance changes and park naming.

recreationparksgolf-coursefee-increasebond-referendumordinance
✓ Decided: Committee unanimously approved new rate increases for the Municipal Golf Course

The Recreation Committee approved the minutes from the April 17, 2025 meeting by unanimous vote. The committee then moved item 5.m, the Municipal Golf Course rate changes, to the top of the agenda and approved the proposed rate adjustments. The approved changes raise senior rates by $1, increase all other resident rates by $3, and raise non‑resident rates by $8, generating an estimated additional $150,000.

Wed May 14, 2025

Special Events Committee

Special Events Committee discusses permits for large events and street closures

The committee will approve minutes from April meetings and receive an update on the canceled DI Concert at Smythe Park. They will discuss 12 event permit applications, including the Charleston Duck Race, CPC Light the Lake (4,000 attendees), CPC Party for the Parks (closure of Ashley Ave), and IAAM Jubilee Soiree (closure of Concord and Inspection St). No votes are scheduled; items are under discussion only.

special-eventspermitsstreet-closuresfestivalspublic-safetycommunity-eventscharleston
Wed May 14, 2025

Special Events Committee

Committee approves Light the Lake, Duck Race, and other special events with conditions

The Special Events Committee approved several event applications with conditions, including the Charleston Duck Race, Light the Lake, Party for the Parks, and others. The committee also noted a canceled concert and received general updates. Applicants were present for most items.

special-eventspermitsstreet-closurespublic-safetycommunity-eventscharleston-sc
Wed May 14, 2025

Board of Architectural Review

BAR-L to review conceptual approval for new affordable housing at 275 Huger St

The Board of Architectural Review – Large will consider conceptual approval for four new construction projects, including an affordable housing building at 275 Huger Street, an apartment building at 162 Ashley Avenue, a hotel at 657 King Street, and stadium upgrades at The Citadel. The board will also review minutes from the April 9, 2025 meeting. Public comments may be submitted in writing or in person.

architectural-reviewnew-constructionaffordable-housinghotelcommercialpublic-hearinghistoric-district
Wed May 14, 2025

Board of Architectural Review

BAR to weigh conceptual OK for 162 Ashley Ave apartment+retail

The Board of Architectural Review (Large) will consider conceptual approval for a new apartment building with ground-floor retail at 162 Ashley Avenue in the Old City District. The applicant, LS3P, is presenting revised designs addressing prior board and staff comments on color and massing. The board will also approve minutes from the April 9, 2025 meeting.

architectural-reviewapartmentsretailzoningold-city-districtconceptual-approvalcharleston
Wed May 14, 2025

Board of Architectural Review

Board denies affordable housing project at 275 Huger Street

At its May 14 meeting, the Board of Architectural Review denied both a proposed affordable housing building at 275 Huger Street and a stadium upgrade at 68 Hagood Street (The Citadel). It granted conceptual approval with conditions to a new hotel at 657 King Street and an apartment project at 162 Ashley Avenue. The decisions are final for this meeting, with no items deferred.

architectural-reviewhistoric-districtnew-constructionaffordable-housinghotelcitadeldenialapproval
Wed May 14, 2025

Board of Architectural Review

BAR-L reviews conceptual approval for affordable housing at 275 Huger Street

The Board of Architectural Review – Large will consider four applications for conceptual approval: an apartment building with ground-level retail at 162 Ashley Ave, a new hotel at 657 King St, a stadium upgrade and additional facilities at The Citadel (68 Hagood St), and a new affordable housing building at 275 Huger St. One public comment was submitted objecting to the Citadel proposal's design and impact on the adjacent historic neighborhood. No final decisions are made at this stage.

architectural-reviewnew-constructionaffordable-housinghotelstadiumcitadelcharleston
Tue May 13, 2025

City Council

City Council to consider grants, park naming, and committee reports

The City Council will meet to consider resolutions naming a park, approve grant applications for flood monitoring and police equipment, and review committee reports on public safety, recreation, and public works.

city-councilgrantsparkspublic-safetystormwatertransportationcommittee-reports
✓ Decided: City Council unanimously approved April 22, 2025 meeting minutes

The council voted unanimously to approve the minutes from the April 22, 2025 meeting. No other motions were adopted. Public comments were heard but no further decisions were made.

Tue May 13, 2025

City Council

City Council considers $7.5 million wastewater and stormwater project

The Committee on Ways and Means will review several infrastructure contracts, real estate agreements, and land annexations. Key discussions include funding for drainage improvements and the relocation of City offices.

stormwaterinfrastructurereal-estateannexationsbudgetpublic-works
✓ Decided: Approved $5.6M wastewater project and $2.5M in IT, fire, and public works contracts

The Committee on Ways and Means voted unanimously on multiple items, including large procurement contracts for police IT, fire department equipment, and public works vehicles. It also approved a $5,625,000 federal wastewater infrastructure agreement with a matching city contribution of $1,875,000. Additional approvals were made to submit grant applications for the Financial Empowerment Center, a hazard mitigation grant, and a justice assistance grant.

Mon May 12, 2025

Design Review Board

DRB reviews demolition of Building R at Southern Lumber campus for new construction

The Design Review Board is reviewing 14 staff-approved permits for signs, demolitions, building alterations, and solar panel installations during its May 12 meeting. All items are quick plan reviews with no public hearings. Notable projects include the demolition of a building at 2029 King Street tied to a new building permit, and a 125-panel solar array on a commercial roof at 325 Longshore Street.

design-review-boardsignsdemolitionsolarcommercial-buildingcharleston
Mon May 12, 2025

Board of Architectural Review

BAR staff review plans for new hotel at 176 Concord St

The Board of Architectural Review staff reviewed 38 quick-plan permits for exterior alterations, signs, and new construction in historic districts. Notable projects include a new hotel with banquet, spa, and retail at 176 Concord Street and a multi-family building at 206 Saint Philip Street tied to the Peninsula project. No public hearings were held; all items were staff-level approvals.

historic-preservationbar-staff-approvalscharlestonconstructionhotelsmulti-familydemolition
Thu May 8, 2025

Human Affairs and Racial Conciliation Commission

Charleston Housing Authority to present to Human Affairs Commission

The Human Affairs and Racial Conciliation Commission will hear a presentation from the Charleston Housing Authority, approve minutes from the previous meeting, receive chairperson and manager updates, and discuss subcommittee reports. No votes on ordinances or contracts are scheduled.

housingracial-conciliationcommissionpublic-meetingcharleston
✓ Decided: Commission votes to drop “racial conciliation” from its name

The commission approved removing “racial conciliation” from its official title, passing the motion 4‑2 with one abstention. A later motion to remove subsection 2‑207 G initially failed but was approved on a second vote. The commission unanimously adopted new language for section 2‑208. Members agreed to set the commission’s membership to include two student members and two city‑council members.

Thu May 8, 2025

Charleston Basin Flood Action Committee

Flood committee to hear Army Corps partnership update

The Charleston Basin Flood Action Committee will receive updates on resilience efforts including the Army Corps partnership, Rosemont Resilience, grant opportunities, and WaterWise Charleston. They will also discuss the James Island Creek Pilot from the Harvard/Bloomberg Collaborative, a stormwater department update, and a city comprehensive mapping initiative. No votes or decisions are scheduled; the agenda consists solely of presentations and discussion.

floodresiliencestormwatermappingarmy-corpsjames-island-creekwaterwise-charleston
Thu May 8, 2025

Technical Review Committee

TRC to review 686-lot Somersby mixed-use development in West Ashley

The Technical Review Committee will consider nine site plans and subdivision proposals, including the large Somersby mixed-use development (293.69 acres, 686 lots), a new middle school, an oil change facility, a storage facility, affordable housing, and road construction plans. Most items are reviews or revisions to previously submitted plans. The meeting is held via Zoom.

technical-review-committeesite-planssubdivisionsmixed-use-developmentaffordable-housingschoolrezoningconstruction
Thu May 8, 2025

Technical Review Committee

TRC reviews major Somersby Subdivision concept plan and eight other site plans

The Charleston Technical Review Committee will meet on May 8, 2025 to review nine site‑plan and subdivision applications submitted to the city. Items include the major concept plan for the Somersby Subdivision (293.69 acres, 686 lots) which was sent back for revision, and revisions to the 500 E Bay mixed‑use project. The committee will also consider a new middle‑school site plan at 1776 William Kennerty Dr, a Take 5 Oil facility at 401 UT Spring Hollow Dr, and an affordable‑housing project at 1890 Ashley River Rd, among other proposals. Comments will be recorded and any required changes returned to the applicants.

zoningsubdivisionssite-planseducationhousingindustrialmixed-useinfrastructure
Thu May 8, 2025

Board of Architectural Review

BAR-S to rule on demolitions, window replacement, and new construction in historic districts

The Board of Architectural Review – Small will consider 12 applications for work on historic properties, including partial and full demolitions, window material changes, and new construction. Several items involve after-the-fact approvals or staff appeals. One application has been withdrawn by staff and another deferred by the applicant.

historic-preservationdemolitionwindowsnew-constructionboard-of-architectural-reviewcharleston
Thu May 8, 2025

Board of Architectural Review

Board to decide on partial demolition and restoration of 440 Sumter Street

The Board of Architectural Review - Small will consider a request for partial demolition and after-the-fact approval of work on a historic Freeman Cottage at 440 Sumter Street in Wagener Terrace. The property, built circa 1938, has severe water, rot, and termite damage; the homeowner plans to restore the original structure and rebuild a collapsed rear addition. The board will also review minutes from the April 24, 2025 meeting.

architectural-reviewdemolitionhistoric-preservationwagener-terracecharleston
Thu May 8, 2025

Board of Architectural Review

Board denies after‑the‑fact demolition at 440 Sumter St, defers two other projects

The Board approved the minutes from the April 24, 2025 meeting with conditions. It denied the after‑the‑fact demolition request for 440 Sumter Street, covering porch, siding and windows. Requests for partial demolition at 20 Alberta Avenue and 8 Magnolia Avenue were deferred for further review. Public comments expressed concern over loss of historic material.

historic-preservationdemolitionboard-reviewpublic-commentzoning
Thu May 8, 2025

Board of Architectural Review

BAR-S to weigh full demolition of 17 Reid Street bungalow

The Board of Architectural Review – Small will hear applications for partial and full demolitions, alterations, and new construction in historic districts. Notable items include a controversial full demolition of a c.1971 bungalow at 17 Reid Street, with public opposition, and a partial demolition at 8 Magnolia Avenue supported by the neighborhood association. Other items involve window replacements, additions, and a deferred application.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonpublic-hearingold-city-district
Wed May 7, 2025

Board of Zoning Appeals Site Design

Board to consider variances for tree removal, buffer encroachments

The Board of Zoning Appeals – Site Design will hear four applications: one for a variance to reduce an OCRM buffer (deferred), one for an encroachment into a visual buffer zone on Daniel Island, one for removal of grand trees and related variances at the Country Club of Charleston (deferred), and one for removal of four grand trees and omission of tree-per-acre requirements on Sam Rittenberg Boulevard. The meeting includes public comment opportunities.

zoningvariancestree-removalbufferspublic-hearingboard-of-zoning-appeals
Wed May 7, 2025

Board of Zoning Appeals Site Design

Board to consider variance for OCRM buffer at 1901 Scott Island Court

The Board of Zoning Appeals will vote on approving April meeting minutes and hear three variance and special exception requests. Active items include a buffer reduction at 1901 Scott Island Court, an encroachment into a visual buffer on Daniel Island, and tree removal at 1401 Sam Rittenberg Boulevard. A fourth request regarding grand tree removal at 1 Country Club Drive is deferred.

zoningvariancestree-removalenvironmental-bufferdaniel-islandwest-ashleyboard-of-zoning-appeals
Wed May 7, 2025

Board of Zoning Appeals Site Design

Board approves tree removal variances at 1401 Sam Rittenberg, defers two

The Board of Zoning Appeals – Site Design met and voted on four applications. They approved variances for tree removal at 1401 Sam Rittenberg Boulevard with conditions, and approved an encroachment variance at 547 Lesesne Street. Two applications were deferred before the meeting: 1901 Scott Island Court and 1 Country Club Drive.

zoningtree-removalvariancescharlestonboard-of-zoning-appealssite-designdaniel-islandwest-ashley
Wed May 7, 2025

Board of Zoning Appeals Site Design

Board considers tree removal variance at 1401 Sam Rittenberg Blvd

The Board of Zoning Appeals will hold a public hearing on May 7, 2025, to decide two variance requests. Two items (1901 Scott Island Court and 1 Country Club Drive) have been deferred. The active items include a request to remove four grand trees and omit the protected tree requirement at 1401 Sam Rittenberg Boulevard, which has drawn a public comment in opposition from a neighbor.

zoningvariancestreespublic-hearingdaniel-islandwest-ashleyjohns-island
Tue May 6, 2025

Board of Zoning Appeals Zoning

Citadel seeks clarification on concert series under residential zoning at 68 Hagood Ave.

The Board of Zoning Appeals will discuss a request from The Citadel to clarify whether a new concert series is permitted under the residential DR-1F zoning at 68 Hagood Ave., following a previous order. The board will also consider 17 other applications, including a first-year extension of a vested right for a 115-unit accommodations use on Market St., a special exception for a 10-unit accommodations use at 243 King St., and multiple variance requests for residential additions. Several items have been deferred or withdrawn.

zoningvariancesspecial-exceptionspublic-hearingsaccommodationscitadelresidential-development
Tue May 6, 2025

Board of Zoning Appeals Zoning

Board to consider fifth one-year extension for 115-unit Market St. accommodation

The Board of Zoning Appeals - Zoning will hear several variance and special exception requests, including a fifth one-year extension of a vested right for a 115-unit accommodation at Market St., and a clarification on a concert series ruling at 68 Hagood Avenue. Two special exceptions are on the agenda for rear vertical addition and a 10-unit accommodations use. One item at 28 Hasell St. has been deferred by the applicant.

zoningvariancesspecial-exceptionsvested-rightsaccommodationspeninsulacharleston
Tue May 6, 2025

Board of Zoning Appeals Zoning

Denied Citadel's concert series request at 68 Hagood Ave.

The Board of Zoning Appeals denied The Citadel's request to clarify that a new concert series was permitted at 68 Hagood Ave., a residential-zoned property. The board approved a one-year extension for a 115-unit accommodations use on Market St., and ruled on numerous variance and special exception requests, many approved. Several items were deferred or withdrawn.

zoningvariancesspecial-exceptionsboard-of-zoning-appealscitadelcharlestonaccommodations
Tue May 6, 2025

Board of Zoning Appeals Zoning

Board reviews request for clarification on concert series at Johnson Hagood Stadium

The Charleston Board of Zoning Appeals will consider a request for clarification of the June 4, 2024 order that denied a new concert series at 68 Hagood Ave, a property zoned DR-1F/S with a School Overlay. Thirteen public comments opposing the concerts have been submitted. The board will also review a special exception request to allow 2,100 sf of office space at 28 Hasell St without the required five parking spaces.

zoningconcertsspecial-exceptionparkingpublic-commentresidentialoverlay
Mon May 5, 2025

Design Review Board

Design Review Board to decide on Publix mock-up panel at 162 Seven Farms Dr.

The Design Review Board will consider a request to approve a completed mock-up panel for the new Publix grocery store at 162 Seven Farms Drive on Daniel Island.

design-review-boardpublixgrocerydaniel-islandcharlestonmock-up-panel
Mon May 5, 2025

Design Review Board

Design Review Board to consider 62-unit residential building on Maybank Highway

The Design Review Board will vote on three applications: two requests for completed mockup panels on Daniel Island (162 Seven Farms Drive for a Publix and 211 Seven Farms Drive for office/residential) and a preliminary approval for a 4-story, 62-unit residential building at Maybank Highway and Promenade Vista Street on James Island. The board will also review minutes from its April 7 meeting.

design-reviewzoningresidential-developmentcharlestondaniel-islandjames-islandpublic-hearing
✓ Decided: Design Review Board gave conceptual approval to 4‑story, 62‑unit project on James Island

The board unanimously approved mockup panels for two Daniel Island projects. It granted conceptual approval, with staff comments and board conditions, for the 4‑story, 62‑unit residential building at Maybank Highway and Promenade Vista Street, voting 5‑1 with one abstention. No public comments were received. The board also approved the minutes from the April 7 meeting.

Mon May 5, 2025

Design Review Board

DRB approves 62-unit residential building on Maybank Highway

The Design Review Board approved three applications. A 4-story, 62-unit residential building at Maybank Highway and Promenade Vista Street received conceptual and preliminary approval with conditions. Two mockup panels were approved for projects on Seven Farms Drive: one for a Publix grocery store and one for an office/residential building. The board also approved minutes from the April 7 meeting.

design-reviewzoningresidential-developmentdaniel-islandjames-islandpublixmockup-panel
Mon May 5, 2025

Design Review Board

DRB reviews 62-unit residential project on James Island

The Design Review Board will consider a preliminary approval for a new residential building and review mockup panels for two developments on Daniel Island.

zoninghousingdevelopmentjames-islanddaniel-island
Mon May 5, 2025

Design Review Board

Design Review Board reviews commercial changes and fencing projects

The Design Review Board is processing staff approvals for several commercial property modifications. These include a change of occupancy for a private club and various fencing installations.

commercial-developmentzoningsignagefencingdemolition
Mon May 5, 2025

Board of Architectural Review

New mixed-use building at 625 King St among 45 BAR permit reviews

This is a list of staff-level quick plan reviews approved by the Board of Architectural Review between May 5-9, 2025. No public hearings or board discussions are scheduled; all items are routine permits for residential and commercial alterations, painting, pool installations, and repairs.

architectural-reviewpermitsdevelopmenthistoric-preservationcharleston-sc
Thu May 1, 2025

Technical Review Committee

434-unit concept plan for Long Savannah leads TRC agenda

The Technical Review Committee will review six site plan and subdivision applications, including a concept plan for 434 units and 378 lots in the Long Savannah neighborhood, a new 158-unit multifamily development on Johns Island, revisions to the Courier Square II project at 635 King Street, a school expansion on James Island, a new free-standing emergency department in Cainhoy, and phase 1 revisions for the West Ashley Sewer Tunnel Extension. All items are under eReview via Zoom.

planningzoningsite-plansubdivisiondevelopmentcharleston
Thu May 1, 2025

Technical Review Committee

TRC reviews six site plan applications, including a new 158‑unit multifamily project

The Technical Review Committee will consider six site‑plan and concept‑plan submissions. Two items (Fenwick Hills and James Island Christian School) will be sent back for revisions. Two items (Courier Square II and West Ashley Sewer Tunnel Phase 1) received no return comments. The SensusOne Clement’s Ferry emergency department is open pending clarification, and the Long Savannah Neighborhood concept plan will be returned for revision.

zoningsite-plansdevelopmenthousinginfrastructure
Thu May 1, 2025

Special Facilities

Special Facilities Committee will receive an update from the director

The Special Facilities Committee will meet by conference call on May 1, 2025. The agenda includes approving the February 6, 2025 minutes and hearing a Special Facilities update presented by Director Romaine Heyward. No other items or decisions are listed.

special-facilitiescharlestoncity-councilmeeting
✓ Decided: Committee unanimously approved February 6, 2025 meeting minutes

The Special Facilities Committee approved the minutes from the February 6, 2025 meeting by unanimous vote. The remainder of the meeting consisted of updates on elevator problems, grant discussions, and building maintenance, with no further actions taken.

Thu May 1, 2025

Keep Charleston Beautiful

Keep Charleston Beautiful board to discuss recent cleanups and spring events

The Keep Charleston Beautiful board will meet to approve minutes, review a financial report, and discuss recent activities including the Great Charleston Cleanup and Youth Earth Day events. New business includes hiring Darby Reed as Events and Volunteer Coordinator. Upcoming spring projects such as a Star Wars-themed cleanup and National Pollinator Week will also be covered.

keep-charleston-beautifulbeautificationcleanupvolunteereventsyouth-education
Mon Apr 28, 2025

Design Review Board

Charleston Design Review Board to review hotel and commercial projects

The Design Review Board is scheduled to review five commercial projects, including new hotel construction and a food store renovation, for permits.

zoninghotelconstructionreviewcommercial
Mon Apr 28, 2025

Commission on Women

Commission on Women will approve minutes and hold a discussion

The Charleston Commission on Women will open the meeting, approve the minutes from March 24 , 202 5, hold a discussion on unspecified topics, and then adjourn.

womengovernmentmeeting
✓ Decided: Commission approved March 24 minutes, no other actions taken

The commission voted unanimously to approve the March 24, 2025 meeting minutes. The members discussed a community resource guide, the Barrier Islands Free Medical Clinic, My Sister’s House, a new Down syndrome program, and proposals for Mamava units and rapid‑housing Boxabl units, but no further resolutions were adopted.

Mon Apr 28, 2025

Board of Architectural Review

Board of Architectural Review staff approves building permits

The Board of Architectural Review staff is reviewing and approving a list of building permits for residential and commercial projects across Charleston, including restaurant renovations, roof replacements, and fence installations.

building-permitscharlestonconstructionzoningstaff-approvalsresidentialcommercial
Thu Apr 24, 2025

Minority Business Enterprise Advisory Board

Board to discuss ERC II applications and 395C King renovation

The Minority Business Enterprise Advisory Board holds its bimonthly meeting to discuss new business, including updates on Construction-Renovation at 395C King and the Entrepreneurial Resource Center (ERC I) updates. The board will also review the ERC II application and recruitment processes, partnerships, mentors, and future funding opportunities including grants and micro grants. The meeting is open to the public via Zoom.

minority-businessenterpriseeconomic-developmentsmall-businessconstructiongrants
Thu Apr 24, 2025

Redevelopment and Preservation Commission

Commission reviews rehabilitation requests and loan modification

The Redevelopment and Preservation Commission is meeting to review requests for approval regarding home rehabilitation programs and a loan modification. The body will consider specific properties for roof and substantial rehabilitation.

housingrehabilitationloanspreservation
Thu Apr 24, 2025

Technical Review Committee

TRC to review 7-story student housing and retail at 162 Ashley Ave

The Technical Review Committee will review six development proposals, including a 7-story student housing and retail building at 162 Ashley Avenue, a 13-unit townhouse project at 228 President Street, and a 183-lot subdivision in West Ashley. The committee also considers improvements to the Angel Oak Tree site on Johns Island and two office buildings at Hickory Knoll.

planningdevelopmentzoninghousingstudent-housingretailjohns-islandwest-ashley
Thu Apr 24, 2025

Technical Review Committee

Long Savannah Neighborhood Phase 1 preliminary plat and road plan reviewed

The Technical Review Committee will review six site‑plan and subdivision applications, including office buildings at 1791 Hickory Knoll, a townhouse project at 228 President St, improvements at Angel Oak, student housing at 162 Ashley Ave, and the Long Savannah Neighborhood Phase 1 preliminary plat and road construction. For each item the committee will provide comments and request revisions; no approvals are indicated.

zoningdevelopmenthousingroadsplanningsubdivision
Thu Apr 24, 2025

Board of Architectural Review

Board considers 14 applications including new 4-story mixed-use building on East Bay Street

The Board of Architectural Review – Small (BAR-S) will review 14 applications on April 24, 2025, including partial demolitions, renovations, and new construction. Notable items include a new 4-story mixed-use structure at 645 East Bay Street and conceptual approvals for raising a residence on Ashton Street for flood compliance. One item (440 Sumter Street) was deferred by staff and another (97 Gordon Street) withdrawn by the applicant. The public may attend in person or submit written comments by April 23.

board-of-architectural-reviewdemolitionnew-constructionhistoric-preservationrenovationflood-compliancecharleston
Thu Apr 24, 2025

Board of Architectural Review

Board to consider after-the-fact demolition approval for 190 Nassau Street

The Board of Architectural Review – Small will consider two demolition requests under the Historic Materials Demolition Purview District. Agenda Item #1 seeks after-the-fact approval for partial demolition including exterior walls at 190 Nassau Street. Agenda Item #2 requests partial demolition of rear decks, porches, rear brick façade, and total demolition of carport and shed at 109 Magnolia Avenue.

historic-preservationdemolitionboard-of-architectural-reviewcharleston
Thu Apr 24, 2025

Board of Architectural Review

Board denies after-the-fact demolition of 190 Nassau Street cottage

The Board of Architectural Review approved, denied, or deferred several demolition and renovation requests. Notably, it denied after-the-fact demolition of a historic Freedman's cottage at 190 Nassau Street, requiring its restoration. It also denied a full roof demolition at 1006 Ashley Avenue. Partial demolitions were approved at 109 Magnolia Avenue and 134 Dunnemann Street with conditions, while conceptual approvals were given for renovations at 5 Ashton Street and 208 Saint Philip Street.

historic-preservationdemolitionboard-of-architectural-reviewcharlestonfreedmans-cottageflood-requirementsrenovation
Thu Apr 24, 2025

Board of Architectural Review

Board to consider new 4-story mixed-use building on East Bay Street

The Board of Architectural Review – Small will decide on 13 applications, including requests for partial demolitions, after-the-fact approvals, and conceptual approvals for renovations. A new 4-story mixed-use structure at 645 East Bay Street is the most significant new construction item. Several items have public comments from residents and Historic Charleston Foundation.

architectural-reviewdemolitionhistoric-preservationnew-constructionmixed-usepublic-hearingcharleston
Wed Apr 23, 2025

Special Events Committee

Committee to discuss 10K-attendee concerts, Food & Wine Classic

The Special Events Committee will discuss permit applications for two Credit One Stadium concerts (Brandon Lake on May 1-2, 2026, and Pitbull on Aug 22, 2025), each expecting 10,000 attendees, and the Food & Wine Classic Charleston on Nov 14-15, 2025, requiring closure of Ann St and the Bus Shed/Visitor Center parking lot for 2,000 attendees. Multiple city-sponsored Piccolo Spoleto events, including the Sunset Serenade with street closures, are also up for discussion. No voting or final decisions are indicated on this agenda; the meeting includes approval of prior minutes and an update from the Special Event Manager.

eventspermitsstreet-closuresspecial-eventsconcertsfestivalspeninsuladaniel-island
Wed Apr 23, 2025

Special Events Committee

Charleston committee approves 2025 special event road closures

The Special Events Committee approved permits for 2025 events including the Food & Wine Classic, Piccolo Spoleto concerts, and Credit One Stadium shows. The committee also discussed using the Visitor Center parking garage for the Food & Wine Classic.

eventspiccolo-spoletofood-wine-classicroad-closuresconcertsvisitors-centerdaniel-islandmarion-square
Tue Apr 22, 2025

City Council

Council to consider rezoning 11 acres on West Ashley Circle for planned development

City Council will hold public hearings on a dozen zoning changes, including rezoning an 11-acre West Ashley Circle site to Planned Unit Development. The council also faces a consent agenda with a lease for 200 Meeting Street and two flood-related grant applications. Several annexation ordinances are up for first and second reading, while a few items have been withdrawn or deferred.

zoningrezoningwest-ashleyannexationflood-mitigationcity-councilpublic-hearing
✓ Decided: No substantive decisions were made at the April 22 City Council meeting

The council held a regular meeting with invocations, proclamations, and presentations on rezoning, PUD amendments, and annexations. Item 10 (2362 Brevard Road) was withdrawn by the applicant. No votes or approvals were recorded.

Tue Apr 22, 2025

City Council

Council to decide on $375K FEMA grant for flood monitoring with $125K city match

The City Council will consider two items: approval to sign a Memorandum of Understanding with Increasing H.O.P.E. for fundraising at the Financial Empowerment Center, and authorization to submit a FEMA Hazard Mitigation Grant Program application. The grant requests $375,000 with a $125,000 city match (75/25 cost-share) to improve flood communications, data, and monitoring. The application deadline is April 30, 2025, and the city match would come from the FY2026 General Fund.

femagrantsfloodfinancial-empowermentmouresiliencebudget
✓ Decided: Committee approved lease for 19,226‑sq‑ft city office at 200 Meeting St

The Committee on Ways and Means unanimously approved several contracts and purchases, including a $205,312.80 lease purchase of golf‑course equipment, a $101,537.86 IT maintenance renewal, and a $750,000 used ladder truck for the fire department. It also approved the city’s application for a $446,155 Hazard Mitigation Grant and a $375,000 FEMA HMGP grant with a $125,000 city match, and signed a lease for approximately 19,226 rentable square feet at 200 Meeting Street for city offices. Additionally, the committee authorized an amended architectural services contract with Sottile and Sottile and signed an MOU with Increasing H.O.P.E for fundraising, all by unanimous vote.

Tue Apr 22, 2025

Traffic and Transportation Committee

Committee considers taking ownership of 0.57 miles of King Street from SCDOT

The Traffic and Transportation Committee will discuss the transfer of ownership and maintenance of a section of King Street from the state to the city. The body will also receive updates on the Ashley River Crossing, Safe Streets for All grants, and parking meter installations.

roadstransportationinfrastructureparkinggrants
✓ Decided: No substantive decisions were recorded by the Traffic & Transportation Committee

The April 22, 2025 meeting agenda included items such as the Ashley River Crossing update, a request to transfer ownership of a segment of King Street, and grant updates. However, the minutes do not document any approvals, denials, votes, or other formal actions on these items. Consequently, no substantive decisions were recorded.

Mon Apr 21, 2025

Design Review Board

Design Review Board reviews 10 staff approval requests

The Design Review Board is processing staff approvals for various commercial permits. These include signage updates, electrical and plumbing work, and one new construction project.

signscommercial-developmentpermitsconstruction
Mon Apr 21, 2025

Public Works and Utilities Committee

Committee to consider public hearing on Scott Island Court abandonment

The Public Works and Utilities Committee will decide whether to set a public hearing on abandoning Scott Island Court. They will also accept rights-of-way and easements for several subdivisions, approve a permanent encroachment at 111 Beresford Creek St, and receive updates on stormwater projects including the MUSC pump station upfit and Church Creek Bridge flood storage.

public-worksutilitiesstormwaterencroachmentsrights-of-waypublic-hearingflood-mitigationinfrastructure
✓ Decided: Committee approved Army agreement for wastewater and stormwater infrastructure project

The Public Works & Utilities Committee voted unanimously to approve the March 24 minutes and to set a public hearing on the proposed abandonment of Scott Island Court. It also approved rights‑of‑way and easement dedications for the Cainhoy Del Webb Phase 1 and Daniel Island Phase 2A projects, acceptance of curb and sidewalk maintenance on King, St. Philip, and Spring Streets, a temporary construction easement for drainage stabilization, a permanent encroachment at 111 Beresford Creek St, the MUSC Pump Station Upfit Fee Amendment #01, and an agreement with the U.S. Army for wastewater and stormwater infrastructure work.

Mon Apr 21, 2025

City Council

City Council to consider expanding parking agreement for 55 Romney apartments

The City Council is being asked to consent to an amendment and assignment of a parking agreement that would increase the number of leased parking spaces from 40 to 50 in the Charleston Tech Center Parking Garage for the 55 Romney Street multi-family project. The agreement would be assigned from MSP 741 Meeting LLC to MSP KB 55 Romney LLC, which would have the right to sublease spaces back to 741 Meeting. Rent is set at $165 per space per month, but will not begin until parking passes are activated or by March 1, 2026, whichever comes first.

parkingagreementamendmentdevelopmenthousingcity-council
✓ Decided: City approves amendment assigning parking agreement to 55 Romney

The City of Charleston consented to amend the 2020 Parking Agreement, adding ten parking spaces and changing the total to fifty unreserved spaces for the 55 Romney Project. The agreement was assigned from MSP 741 Meeting LLC to MSP KB 55 Romney LLC, and the City authorized subleasing of those spaces. The termination provision was removed and the notice address was updated to the assignee’s address.

Mon Apr 21, 2025

Board of Architectural Review

BAR staff approves 49 routine repair and maintenance permits

This agenda lists 49 staff-level quick plan reviews for properties in Charleston's historic district. All items are approved administratively without a public hearing. The board is not taking any decisions or discussions at this meeting.

architectural-reviewhistoric-preservationpermitsrepairscharleston
Thu Apr 17, 2025

Technical Review Committee

TRC to review 285-unit mixed-use project at 1401 Sam Rittenberg Blvd

The Technical Review Committee will review seven development proposals including site plans, subdivisions, and road construction. Notable items include a mixed-use building with 285 residential units at 1401 Sam Rittenberg Blvd, a 22-lot subdivision on Johns Island, and renovations to the Stern Student Center at the College of Charleston. The committee will also consider a bikeway improvement in West Ashley and road construction in Cainhoy.

site-planssubdivisionsmixed-usehousingroad-constructionbike-pathscollege-of-charleston
Thu Apr 17, 2025

Technical Review Committee

TRC reviews multiple site plans, including mixed-use project on Sam Rittenberg Blvd

The Charleston Technical Review Committee will meet virtually on April 17, 2025 to review seven applications. Items include a bikeway improvement in West Ashley, a mixed‑use development at 1401 Sam Rittenberg Blvd, a concept plan for Cane Slash Road, and several site‑plan extensions. The committee will consider revisions, returns, or approve paperwork for each project.

zoningdevelopmentroadsplanningmixed-usebikewaysubdivision
Thu Apr 17, 2025

Recreation Committee

Recreation Committee to review ordinance, park improvements, aquatic center

The committee will discuss updates to recreation ordinances, appointments, and surveys. They will review status of negotiations for Longborough Dock, landscaping at James Lewis Apartments, and power washing of walls at College Park. Capital projects, maintenance, and the timeline for W.L. Stephens Aquatic Center are also on the agenda.

recreationparksordinancelandscapingcapital-projectspublic-hearingsfeedback
✓ Decided: Committee approved updated recreation ordinance to forward to City Council

The Recreation Committee unanimously approved the minutes from the March 24 meeting. It also unanimously approved updates to the Recreation Ordinance and will send them to the City Council for consideration. Other items such as QR‑code feedback signs, Longborough Dock funding, and park programming were discussed but no formal actions were taken.

Wed Apr 16, 2025

Planning Commission

Commission to consider rezoning 529 & 537 Meeting St to Accommodations Overlay Zone

The Planning Commission will vote on several rezoning requests, including a controversial proposal to rezone 529 & 537 Meeting St to the Accommodations Overlay Zone, which could affect short-term rental regulations. They will also consider a subdivision concept plan for 55 single-family attached lots at The Pointe at Governor's Cay, and two ordinance amendments regarding department name changes and pool standards. Two items have been deferred: 1819 & 1821 Folly Rd and 81 Wentworth St.

zoningshort-term-rentalssubdivisionordinance-amendmentspoolscollege-of-charlestonhousinghearing
✓ Decided: Rezoning of 126 Romney St denied by 5-4 vote

The Planning Commission deferred approval of the February 19, 2025 meeting minutes. A request to rezone 126 Romney St from Diverse Residential (DR-1F) to Limited Business (LB) was rejected, with the motion failing 4‑5. Commissioners Bailey, Joyce, Harrison, and Vice Chair Lesesne voted in favor, while the remaining members voted against. The rezoning applications for 1819 & 1821 Folly Rd and 529 & 537 Meeting St were also deferred with no final vote recorded.

Wed Apr 16, 2025

Planning Commission

Planning Commission to recommend on Meeting Street hotel overlay

The Charleston Planning Commission will hold a public hearing on April 16, 2025, to consider three rezoning requests and approve minutes from February and March. The Commission will make recommendations to City Council on each item. Staff recommends approval for two rezonings and disapproval for the accommodations overlay request at 529 & 537 Meeting St.

zoningrezoningaccommodations-overlayhotelsplanning-commissionpublic-hearingcharleston
Wed Apr 16, 2025

Planning Commission

Planning Commission approves zoning ordinance amendments and department name change

The commission approved two amendments to the City’s zoning ordinance, including renaming the Planning, Preservation and Sustainability Department and adding standards for pools and utility platforms. It also approved the rezoning of 1735 Hollydale Court to Business Park and the subdivision concept plan for The Pointe at Governor’s Cay. Several rezoning requests (126 Romney St, 529 & 537 Meeting St, 81 Wentworth St) were rejected or deferred. Minutes from the February and March meetings were approved unanimously.

zoningordinancerezoningsubdivisionplanningdevelopment
Wed Apr 16, 2025

Planning Commission

Commission to vote on rezoning 529 & 537 Meeting St to hotel overlay

The Planning Commission is considering five rezoning requests, including a controversial proposal to rezone 529 and 537 Meeting Street into the Accommodations Overlay Zone for hotel use, which has drawn 13 public comments opposing it. Also on the agenda is a deferred rezoning at 126 Romney Street with 32-signature petition opposing commercial rezoning, and requests to rezone 1819 & 1821 Folly Road, 1735 Hollydale Court, and height district changes at 106 Coming Street for College of Charleston.

rezoningaccommodations-overlayhotel-developmentpublic-hearingcollege-of-charleston
Wed Apr 16, 2025

Ad Hoc Budget Advisory Committee

Ad Hoc Budget Advisory Committee to discuss Capital Improvement Plan

The Ad Hoc Budget Advisory Committee will hold a conference call to discuss the Capital Improvement Plan. The meeting agenda lists 'Other Business' as the final item before adjournment.

budgetcapital-improvement-planad-hoc-committeeconference-call
Tue Apr 15, 2025

Public Safety Committee

Police seek approval for $446,155 flood monitoring camera grant

The Public Safety Committee will consider a police department request to apply for a $446,155 FEMA Hazard Mitigation Grant for flood monitoring cameras, along with an after-the-fact grant application for $53,167 for patrol bicycles and radiation detectors. The committee also will vote on a memorandum of agreement for a 90-day sobering services pilot.

policegrantsflood-monitoringhurricane-helenepublic-safetybicycle-patrolradiation-detectorssobering-services
✓ Decided: Committee unanimously approved three police grant applications and a sobering services pilot

The Public Safety Committee approved the March 18 minutes. It voted unanimously to submit a $446,155 Hazard Mitigation Grant application for flood monitoring cameras, to apply for a $53,167 Edward Byrne Justice Assistance Grant for patrol bicycles and detectors, and to approve a memorandum of agreement for a 90‑day sobering services pilot with Charleston Center.

Tue Apr 15, 2025

Board of Zoning Appeals Zoning

Board to hear variance for restaurant with no parking at 58 Line St.

The Charleston Board of Zoning Appeals – Zoning will consider 11 new applications and review minutes from its April 1 meeting. Items include requests for variance extensions, special exceptions for undersized lots, and several setback and parking variances. One notable request is a restaurant on Line Street seeking to operate with zero parking spaces (30 required).

zoningvariancesboard-of-zoning-appealscharlestonparkingrestaurantsaccessory-dwelling-units
Tue Apr 15, 2025

Board of Zoning Appeals Zoning

Board will consider a variance to reduce setbacks for a single‑family home on 8 H St.

The Board of Zoning Appeals will approve the April 1, 2025 meeting minutes. It will hear a variance request to lower side setbacks for a single‑family home at 8 H St. in the Westside district. The board will also consider two one‑year extensions of vested rights for properties at 10 Westedge St. (late‑night restaurant) and 35 Broad St. (non‑conforming duplex expansion).

zoningvariancesvested-rightshousingwestsidecharlestowne
Tue Apr 15, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves multiple variance requests

The Charleston Board of Zoning Appeals met on April 15, 2025, to review and decide on various zoning applications. The board approved several variance requests for properties across the city, including requests for accessory dwelling units, restaurant expansions, and reduced setbacks. One application was withdrawn by the applicant prior to the meeting.

zoningvariancesboard-of-appealshousingcharleston
Tue Apr 15, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to review variance requests for four properties

The Board of Zoning Appeals is considering several variance and special exception requests regarding setbacks, lot occupancy, and land use. These requests include the addition of a staircase, an accessory dwelling unit, a restaurant, and a new single-family residence.

zoningvariancesparkinghousingrestaurants
Mon Apr 14, 2025

Design Review Board

Design Review Board reviews commercial construction and demolition permits

The Design Review Board is processing staff approvals for various commercial projects. These include new construction, partial and complete demolitions, and signage updates.

commercial-developmentdemolitionzoningsignageconstruction
Mon Apr 14, 2025

Board of Architectural Review

BAR staff approves 54 quick-plan reviews for residential and commercial projects

This agenda lists 54 quick-plan reviews approved by staff between April 14 and 18, 2025, covering roofing, painting, demolition, and renovations at various addresses. No board discussion or public hearing is scheduled; these are routine staff-level approvals.

board-of-architectural-reviewquick-plan-reviewbuilding-permitscharlestonstaff-approvals
Thu Apr 10, 2025

Human Affairs and Racial Conciliation Commission

Human Affairs and Racial Conciliation Commission to discuss annual report

The Commission will meet to review the annual report and receive updates from the Human Affairs Working Group and subcommittees. The meeting includes a period for public comment.

human-affairsracial-conciliationcity-government
✓ Decided: Commission unanimously approved the March 13, 2025 meeting minutes

The Human Affairs and Racial Conciliation Commission voted unanimously to approve the March 13, 2025 meeting minutes as amended. No other actions or votes were recorded during the April 10, 2025 meeting.

Thu Apr 10, 2025

Technical Review Committee

TRC to review 336-unit apartment complex and 174-lot subdivision

The Technical Review Committee will consider nine development proposals, including site plans, subdivision revisions, and a mixed-use building. The most significant items are a 336-unit apartment building in Cainhoy and revised plans for a 174-lot subdivision. All reviews are conducted remotely via Zoom.

developmenthousingsite-plansubdivisioncommercialmixed-usepublic-hearing
Thu Apr 10, 2025

Technical Review Committee

Technical Review Committee to review 9 site and subdivision plans

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans. The body is evaluating proposed developments ranging from golf course improvements to new mixed-use and residential buildings.

zoningsite-planshousingcommercial-developmentroads
Thu Apr 10, 2025

Board of Architectural Review

Board of Architectural Review to review demolition and construction requests

The Board of Architectural Review – Small is meeting to consider 14 applications for property alterations. The board will review requests for full and partial demolitions, new construction, and exterior modifications in various historic districts.

zoningdemolitionhistoric-preservationconstructionarchitecture
Thu Apr 10, 2025

Board of Architectural Review

BAR to decide on after-the-fact demolition at 59 Poplar Street

The Board of Architectural Review - Small will review minutes from March 27 and consider an application for after-the-fact approval of demolition at 59 Poplar Street, a c. 1935 structure in the North Central area. The board will decide whether to approve the already-completed demolition.

historic-preservationdemolitionboard-of-architectural-reviewcharleston
Thu Apr 10, 2025

Board of Architectural Review

Board denies demolition of historic Freedman's cottage at 290 Ashley Avenue

The Board of Architectural Review – Small met on April 10, 2025, to consider six applications. It denied demolition of a Freedman's cottage at 290 Ashley Avenue, requiring stabilization, and also denied after-the-fact demolition at 59 Poplar Street with conditions to rebuild to original design. Other items were deferred or approved with conditions.

architectural-reviewdemolitionhistoric-preservationcharlestonboard-of-architectural-review
Thu Apr 10, 2025

Board of Architectural Review

BAR-S to consider after-the-fact demolition approval for 59 Poplar Street

The Board of Architectural Review – Small will hear 14 applications for work in historic districts, including several requests for demolition or partial demolition. Public opposition is strongest against the retroactive demolition at 59 Poplar Street, with residents urging denial. Other items range from new construction to minor alterations.

historic-preservationdemolitionboard-of-architectural-reviewpublic-hearingcharlestonzoninghousing
Wed Apr 9, 2025

Special Events Committee

Special Events Committee reviews applications for 2025-2026 events

The Special Events Committee is discussing several event applications for the Peninsula and Daniel Island. The meeting includes reviews for races, parades, and festivals. One application for Ted’s Block Party was withdrawn.

special-eventspermitsfestivalsparadespublic-gatherings
Wed Apr 9, 2025

Special Events Committee

Special Events Committee approves multiple parades, races, and festivals

The committee reviewed and voted on permit applications for various public events on the Peninsula and Daniel Island. Most requests were approved, including a half marathon and several cultural festivals.

special-eventspermitspublic-safetyfestivalsparades
Wed Apr 9, 2025

Board of Architectural Review

Board will consider conceptual approval for a new hotel at 245 Huger Street

The Charleston Board of Architectural Review – Large will review minutes from its March 12 meeting and consider several applications. Items include extensions of vested rights for two mixed‑use projects, conceptual approvals for a new hotel, façade alterations on affordable housing, and an apartment building with ground‑level retail. The board will also review preliminary approvals for exterior renovations on two downtown properties.

zoningdevelopmenthistoric-districthousingconstruction
Wed Apr 9, 2025

Board of Architectural Review

BAR considers conceptual approval of new Montford Hotel on Huger and Meeting Streets

The Board of Architectural Review will consider conceptual approval for a new hotel development at 245 Huger Street and 590 Meeting Street, including a request for a 25-foot-tall ground floor. The board will also vote on two requests for one-year extensions of vested rights for previously approved projects at 584 Meeting Street and 214-216 Spring Street.

architectural-reviewhoteldevelopmentzoningvested-rightsminutes
Wed Apr 9, 2025

Board of Architectural Review

Board approves conceptual hotel project at 245 Huger Street with conditions

The Charleston Board of Architectural Review approved the minutes from its March 12 meeting and granted a one‑year extension of vested rights for a mixed‑use apartment at 584 Meeting Street. It gave conditional conceptual approval to a new hotel at 245 Huger Street and to façade alterations for six affordable housing buildings at 562 Meeting Street. The board deferred a proposed apartment building with ground‑level retail at 162 Ashley Avenue for further study.

zoningdevelopmenthistoric-districthousinghotelsapprovals
Tue Apr 8, 2025

City Council

Council approves $1.125 M design‑builder contract for Lowline Phase I

The Ways and Means Committee will consider several financial approvals, including the Lowline Phase I design‑builder contract, a NOAA grant request for Newmarket Creek, a fire‑training facility fee amendment, a Central Park drainage improvement change order, and an emergency procurement to upfit 108 Meeting Street. Each item lists a specific dollar amount and its funding source. The committee will also address real‑estate actions such as easement agreements and annexations.

lowlinegrantfire-trainingdrainageprocurementreal-estate
✓ Decided: Committee unanimously approves $6 million NOAA grant request and other contracts

The Committee on Ways and Means voted unanimously to submit a $6,000,000 NOAA Transformational Habitat Restoration & Community Resilience grant for Newmarket Creek. It also approved several contracts and purchases, including a $151,984.63 IT services payment, a $231,130.31 sports‑lighting upgrade, a $1,125,200.00 Lowline Phase I design‑builder contract, a $2,547,292.00 fire‑training facility fee amendment, a $45,500.00 Central Park drainage change order, and a $650,000 emergency construction services contract. The committee also approved the meeting minutes and the Real Estate report.

Tue Apr 8, 2025

City Council

Council to vote on Lowline Phase 1 contract ($1.1M) and NOAA grant ($6M)

The City Council will hold a State of the City address, public hearings, and vote on several contracts and grants. Key decisions include a $1.1M design-build contract for the Lowline Linear Park Phase I, a $6M NOAA grant application for Newmarket Creek restoration, and a $2.5M fee amendment for the Fire Training Facility. The agenda also includes police grants, a rideshare ordinance amendment, and public works items.

city-councilpolicegrantsparksinfrastructurepublic-safetytransportation
✓ Decided: City Council unanimously approved March 25 meeting minutes

The council voted unanimously to approve the minutes from the March 25, 2025 meeting. No other actions, approvals, or denials were recorded during the April 8 session. The meeting included public comments but yielded no further decisions.

Mon Apr 7, 2025

Design Review Board

DRB to review visitor center at Angel Oak Preserve and townhomes on Theresa Dr.

The Design Review Board will consider conceptual approval for two development projects. The board will also review minutes from the March 3, 2025 meeting.

zoningdevelopmentparkshousing
✓ Decided: Design Review Board gives conceptual approval to Angel Oak visitor center

The board approved the minutes from the March 3, 2025 meeting (5‑0). It granted conceptual approval for the 1‑story visitor center at 3688 Angel Oak Rd. with a 5‑0 vote. It also granted conceptual approval for the Theresa Dr. Townhomes project with a 3‑1 vote and one abstention.

Mon Apr 7, 2025

Design Review Board

DRB to review conceptual approval for Angel Oak Preserve visitor center

The Charleston Design Review Board will hold a conceptual review of a proposed project at 3688 Angel Oak Rd. The agenda item seeks approval for a new one‑story visitors center and restroom building, along with a parking lot, trail system, playground, and enhanced landscape within Angel Oak Preserve. The board will discuss the design plans and site layout for this project.

design-reviewplanningrecreationpreservationconstruction
Mon Apr 7, 2025

Design Review Board

DRB approves conceptual plans for Angel Oak Preserve visitor center

The Design Review Board reviewed conceptual applications for two development projects. The board granted conceptual approval for a new visitor center and townhome project.

zoningland-usehousingpublic-facilities
Mon Apr 7, 2025

Design Review Board

DRB reviews visitor center at Angel Oak Preserve and townhomes on James Island

The Design Review Board is considering conceptual approval for two development projects. The board will review a new visitor center and infrastructure at Angel Oak Preserve and a 16-unit townhouse complex on Theresa Drive.

zoninghousingparksjames-islandjohns-island
Mon Apr 7, 2025

Board of Architectural Review

Board of Architectural Review staff reviews 53 property permits

The Board of Architectural Review staff is reviewing a series of quick plan permits for residential and commercial properties. The items include a mix of routine maintenance, exterior renovations, and new construction projects.

zoningarchitecturepermitscommercial-developmentresidential-renovation
Thu Apr 3, 2025

Technical Review Committee

TRC to review continuing care community with 209 units at 625 King St

The Technical Review Committee will review multiple site plans, subdivision plats, and road construction plans on April 3, 2025. Key items include a proposed 209-unit continuing care community, a 151-lot subdivision phase at Point Hope, and a 181-unit townhome development in the Magnolia PUD.

site-planssubdivisionshousingcommercial-developmentinfrastructurezoningroad-construction
Thu Apr 3, 2025

Technical Review Committee

TRC to review Peninsula continuing care community with 209 units

The Technical Review Committee will review 14 development proposals, including site plans, preliminary plats, and road construction plans. Items range from a stormwater masterplan at the airport to new subdivisions and a continuing care community. Some proposals are flagged for revision; others have no comments.

site-plansubdivisioncontinuing-carehousingroadscommercial-developmentzoning
Wed Apr 2, 2025

Board of Zoning Appeals Site Design

Board to consider variance and special exception for grand tree removal at 2701 Bees Ferry Road

The Board of Zoning Appeals – Site Design will review minutes from its March 5 meeting and consider one new application. The applicant, Bees Ferry Flex Industrial L.P., requests a variance to remove seven grand trees and a special exception to remove six grand trees at 2701 Bees Ferry Road in West Ashley (Council District 2, zoned LI). No other applications are on the agenda.

zoningtreesvariancespecial-exceptionwest-ashley
Wed Apr 2, 2025

Board of Zoning Appeals Site Design

Board reviews request to remove 13 grand trees at 2701 Bees Ferry Road

The Board of Zoning Appeals - Site Design will meet to approve previous meeting minutes and review a request for 2701 Bees Ferry Road. The applicant is seeking a variance and special exception to remove 13 grand trees.

zoningtreeswest-ashleysite-design
Wed Apr 2, 2025

Board of Zoning Appeals Site Design

Board approves tree removal requests for 2701 Bees Ferry Road

The Board of Zoning Appeals – Site Design met to review minutes and a new application. The board approved a request to remove grand trees at a West Ashley site subject to specific planting and preservation conditions.

zoningtree-removalwest-ashleysite-designenvironmental-regulations
Wed Apr 2, 2025

Commission on History

History Commission to discuss memorial garden and approve minutes

The Charleston Commission on History will meet to approve the March 5, 2025 minutes and discuss the Peter and Patti McGee Memorial Garden. The meeting will be held at City Hall and streamed live.

historyparksmemorialcommissionmeeting
✓ Decided: Commission approved wording for the Peter and Patti McGee Memorial Garden marker

The History Commission unanimously approved item B1 from the meeting minutes. It also unanimously approved the final wording for the Peter and Patti McGee Memorial Garden marker. No other actions were taken; a request to add a legal‑related agenda item was discussed but not approved.

Tue Apr 1, 2025

Board of Zoning Appeals Zoning

Board considers special exception to modify 150-unit accommodations on Huger/Meeting St

The Board of Zoning Appeals will hear eight applications, including a request to amend a previously approved 150-unit accommodations use at 245 Huger St and 590 Meeting St, several residential setback variances (pergola, additions, parking), and a pool variance. One application has been withdrawn by staff (84-86 Society St) and one deferred (8 H St). The meeting will be streamed live.

zoningspecial-exceptionvarianceaccommodationssetbacksparkingcharleston
Tue Apr 1, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals to review special exceptions for accommodations and setbacks

The Board of Zoning Appeals is meeting to consider special exception requests for property modifications. The board will review requests regarding accommodations use and a residential setback variance.

zoningspecial-exceptionaccommodationssetbacks
Tue Apr 1, 2025

Board of Zoning Appeals Zoning

BZA approves 150-unit accommodations use at 245 Huger St

The Charleston Board of Zoning Appeals approved a special exception to amend a previously approved 150-unit accommodations use to include 590 Meeting St. The board also approved a variance for parking spaces at 299 Seven Farms Dr, denied a variance for a rear addition at 716 Old Plantation Rd, and approved several other setback variances and extensions. Several items were withdrawn or deferred before the meeting.

zoningboard-of-zoning-appealsspecial-exceptionvarianceaccommodationssetback
Tue Apr 1, 2025

Board of Zoning Appeals Zoning

Board to consider three zoning variance requests

The Board of Zoning Appeals will meet to consider three variance requests: a special exception for a pergola at 2326 Sunnyside Ave., a rear addition variance at 716 Old Plantation Rd., and a parking variance for 299 Seven Farms Dr. on Daniel Island.

zoningvariancespecial-exceptionparkingcharlestondaniel-islandwagener-terrace
Mon Mar 31, 2025

Design Review Board

Design Review Board staff approves 15 quick-plan permits

This agenda lists 15 quick-plan review permits approved by Design Review Board staff between March 31 and April 4, 2025. Items include electrical work, signage, solar panels, building repairs, and a new metal building for a county park. No board discussion or public hearing is scheduled.

design-reviewpermitsquick-plan-reviewsignagesolar-panelsbuilding-repairscharleston
Mon Mar 31, 2025

Board of Architectural Review

Board to approve $1.9 million commercial roof replacement at 550 Meeting St

The Charleston Board of Architectural Review will hold quick‑plan reviews of 46 staff‑approved permits. Items cover exterior painting, roof replacements, HVAC and electrical upgrades, fence repairs, sign installations and a commercial restaurant renovation. The board will vote on each listed request during the meeting.

roofingelectricalmechanicalcommercialresidentialpermitsconstruction
Thu Mar 27, 2025

Redevelopment and Preservation Commission

Commission to review rehabilitation requests for three properties

The Redevelopment and Preservation Commission is meeting to consider approval requests for home rehabilitation programs. The body will review one property for substantial rehabilitation and two for roof rehabilitation.

housingrehabilitationpreservation
Thu Mar 27, 2025

Technical Review Committee

Technical Review Committee to review six site plans and subdivision projects

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans. The body will evaluate new development proposals and revisions to previously approved plans across the Peninsula, West Ashley, and Cainhoy areas.

site-planszoningdevelopmenthealthcareindustrial
Thu Mar 27, 2025

Technical Review Committee

Technical Review Committee to review six site plans and subdivision projects

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans. The committee evaluates these applications for compliance with planning, zoning, engineering, and safety standards.

zoningsite-plansdevelopmenthealthcareindustrial
Thu Mar 27, 2025

Board of Architectural Review

Board to consider demolition after fire at 688 King Street

The Board of Architectural Review – Small will meet on March 27, 2025 to consider 10 applications for demolition, renovation, and conceptual approvals in historic districts. Notable items include a request to demolish a building at 688 King Street after a structure fire, and partial demolition at 257 W. Poplar Street and 51 Peachtree Street. The board will also review conceptual renovations at 56 Nassau Street and an appeal of a staff roofing decision at 48 Poplar Street.

board-of-architectural-reviewdemolitionhistoric-districtrenovationsconceptual-approvalscharleston
Thu Mar 27, 2025

Board of Architectural Review

Board reviews minutes and three demolition requests, including fire‑damaged 688 King St.

The Charleston Board of Architectural Review will first review the minutes from its March 13 meeting. It will then consider three demolition applications for historic properties: a partial demolition of a rear addition at 257 W. Poplar Street, a partial roof demolition at 51 Peachtree Street, and a full demolition of a fire‑damaged building at 688 King Street.

demolitionhistoric-preservationarchitectureboard-of-architectural-review
Thu Mar 27, 2025

Board of Architectural Review

Board denies demolition of historic 688 King Street after fire

The Board of Architectural Review – Small met on March 27, 2025, and acted on eight applications. It denied demolition of a historic building at 688 King Street after a structure fire, approved several renovations with conditions, deferred one project, and rejected a request for Bahama shutters at 80 Alexander Street.

board-of-architectural-reviewhistoric-preservationdemolitionrenovationscharlestonpublic-hearings
Thu Mar 27, 2025

Board of Architectural Review

Board to consider demolition of fire-damaged building at 688 King Street

The Board of Architectural Review – Small will review 10 applications for historic properties, including a full demolition after a structure fire at 688 King Street, partial roof demolitions, and an appeal of a staff decision on roofing at 48 Poplar Street. Most items seek conceptual or preliminary approval for renovations and restorations in Charleston's historic districts. No public comment is scheduled for oral testimony; written comments are accepted.

historic-preservationdemolitionrenovationspublic-hearingcharlestonboard-of-architectural-review
Wed Mar 26, 2025

Special Events Committee

Special Events Committee to review 2025 parade and festival permits

The Special Events Committee will review permits for 10 events, including the Charleston Pride Parade and the BBQ and Boots Festival. The committee will also discuss an ordinance amendment update and approve minutes from the previous meeting.

special-eventsparadefestivalpermitszoningcharleston
Wed Mar 26, 2025

Special Events Committee

Committee approves 2025 Pride Parade, updates on ordinance amendments

The Special Events Committee approved multiple event permits for 2025, including the Charleston Pride Parade, Veterans Day Run, and several block parties. An update noted that ordinance amendments were pulled from council agenda and an unpermitted wedding parade resulted in a summons.

eventspermitsparadesfestivalsroad-closurespolice
Tue Mar 25, 2025

City Council

City Council to consider bond issuance and multiple rezoning requests

City Council will hold public hearings on seven rezoning requests and amendments to the City Comprehensive Plan and City Plan. The body is also considering the issuance of General Obligation Bonds for parks, public works, and fire training facilities.

zoningbondshousingpublic-workspoliceinfrastructure
✓ Decided: City Council held public hearings; no decisions were made

Council members heard nine public speakers on two rezoning requests and two Comprehensive Plan amendments. The Planning Commission had previously recommended approval of the proposals, but the Council recorded no votes or actions. The meeting was limited to hearing comments and did not result in any formal decisions.

Tue Mar 25, 2025

City Council

Council to consider $7.5M contract for Municipal Operations Complex and bond issuance

The Ways and Means Committee will consider an ordinance authorizing the sale of General Obligation Bonds Series 2025A, 2025B, and 2025C for parks, public works, fire training, and refunding. They will also vote on a $7.5 million fee amendment for Phase 1 of the Municipal Operation Complex, a $385,597 construction contract for a retail incubator at 395 King Street, and several police grants including body-worn cameras and SRO funding. Emergency stormwater repairs at Brittlebank Park for $340,169 are also up for approval.

bondsparkspublic-workspolicegrantsstormwatermunicipal-operations-complex
✓ Decided: Committee unanimously approved a bond ordinance and $7.5 M fee amendment

The Ways and Means Committee approved the minutes from the March 11 meeting and a series of contracts and purchases, including IT services, public‑works equipment, and a $385,597 construction contract for a women‑minority business incubator. It also adopted an ordinance to issue General Obligation Bonds and authorized a $7,528,385 fee amendment for Phase 1 of the Municipal Operations Complex. Additional approvals covered several police grant subawards, grant applications, and an emergency storm‑water repair at Brittlebank Park. All actions were approved unanimously.

Tue Mar 25, 2025

Traffic and Transportation Committee

Committee to vote on rideshare ordinance adding food delivery rules, pick-up zones

The Traffic & Transportation Committee will consider an ordinance amending the city's rideshare program to define food delivery services and food delivery vehicles, and to create pick-up and drop-off zones with time and location rules. The committee will also receive updates on the Lowline project, Charleston County transportation sales tax projects, River Road improvements near a Johns Island elementary school, and SCDOT road safety audits. A certificate of public convenience and necessity for Old Village Transportation, LLC is also on the agenda.

ridesharetransportationfood-deliveryordinancesinfrastructure
✓ Decided: Committee unanimously approves rideshare ordinance amendment

The Traffic and Transportation Committee approved the February 25, 2025 meeting minutes unanimously. It then approved the Rideshare Program Ordinance Amendment, allowing food‑delivery drivers to use rideshare zones and disabled riders to request alternate pickup and drop‑off locations. The Committee also approved a Certificate of Public Convenience and Necessity for Old Village Transportation, LLC. An update noted the Lowline Phase 1 bid process is closed and a contract will be presented to City Council on April 8.

Mon Mar 24, 2025

Design Review Board

250-unit multifamily project at 3900 William E Murray Blvd under review

The Design Review Board is reviewing staff approvals for seven items, including a major 250-unit multifamily development (236 apartments + 14 townhomes) with amenities at 3900 William E Murray Blvd. Other items involve minor commercial alterations, signs, and temporary fencing.

design-reviewmulti-family-housingdevelopmentcommercial-alterationssignagefencing
Mon Mar 24, 2025

Public Works and Utilities Committee

Committee to vote on $340,169 emergency stormwater repair at Brittlebank Park

The Public Works and Utilities Committee will consider approving an emergency repair at Brittlebank Park and Lockwood Drive costing $340,169 for cured-in-place piping. They will also set a public hearing on abandoning a portion of Sheppard Street and accept several stormwater drainage easements and right-of-way maintenance agreements. Director updates from Public Service and Stormwater Management are also on the agenda.

public-worksutilitiesstormwateremergency-repaireasementssidewalkspublic-hearing
✓ Decided: Approved $340,169 emergency stormwater pipe repair at Brittlebank Park

The committee unanimously approved the minutes from the February 24, 2025 meeting. It unanimously authorized a public hearing within 40 days on the proposed abandonment of a 40‑foot portion of Sheppard Street. The committee approved exclusive stormwater drainage easement agreements for the Maybank Townhomes development and multiple parcels in Ferguson Village, and accepted maintenance of sidewalks, a ramp and a retaining wall on North Romney Street and granite curbs on Coming St. and George St. It also unanimously approved a $340,169 emergency repair of the drainage pipe system at Brittlebank Park and Lockwood Drive, funded from the 2025 small‑projects stormwater budget.

Mon Mar 24, 2025

Commission on Women

Commission on Women to hear guest presentations on March 24

The Commission on Women will meet to approve the February 24, 2025, minutes and hear from two guest presenters. The meeting includes a general discussion period.

womenleadershipcommunity-outreach
✓ Decided: Commission on Women unanimously approves February 2024 minutes

The Commission on Women approved the February 24, 2024 meeting minutes by unanimous vote. The meeting featured presentations on funeral pre‑planning and veteran burial benefits. Chair Khouri said she will follow up with the Mayor’s office, the Clerk of Council’s office, and propose Mamava services for future consideration. No other actions were voted on.

Mon Mar 24, 2025

City Council

Committee on Real Estate to consider land transfers and annexations

The Committee on Real Estate is meeting to discuss several property transactions, including easements for the Lowline Linear Park and a quitclaim deed for Sheppard Street. The body will also consider an amendment to the Joint County Industrial Park agreement and three property annexations.

real-estateannexationeasementsindustrial-parkinfrastructure
✓ Decided: Committee approves easement, quitclaim, industrial park amendment, and annexations

The Committee on Real Estate unanimously approved the minutes from the February 24 meeting. It approved the form of the Linear Park easement agreement and authorized the Mayor to sign it. The Committee also authorized a quitclaim deed for a 40‑foot portion of Sheppard Street right‑of‑way, approved an amendment to include additional property in the Joint County Industrial Park, and unanimously approved annexations of three residential parcels on Agatha Street, Saint James Drive, and Ashley River Road.

Mon Mar 24, 2025

Board of Architectural Review

Board of Architectural Review staff approve 49 residential and commercial permits

Staff reviewed and approved 49 quick plan permits for various property modifications. The items primarily consist of residential renovations, painting, and roofing updates across the city.

zoningresidential-constructionhistoric-preservationpermits
Mon Mar 24, 2025

Recreation Committee

Recreation Committee discusses ordinance review, dock negotiations, and park updates

The Recreation Committee will consider updates to the recreation ordinance, appointments, surveys, and QR codes for parks. It also plans to discuss the status of Longborough Dock negotiations, landscaping at James Lewis Apartments and Cleveland Street, power washing at College Park, and Martin Park. New business includes capital projects, maintenance, spring/summer programming, Thomas Johnson Park, Johns Island Recreation Center, W.L. Stephens Aquatic Center timeline, Parks and Recreation Master Plan GO Bonds, and hybrid meetings starting in April.

recreationparksordinancesmaintenancecapital-projectsprogramminglongborough-dockjames-lewis-apartments
✓ Decided: Recreation Committee unanimously approved February 24, 2025 minutes

The committee voted unanimously to approve the minutes from the February 24, 2025 Recreation Committee meeting. No other formal actions or votes were recorded; the remaining agenda items were discussed without a decision.

Fri Mar 21, 2025

Commission on Disability Issues

Commission discusses July celebration planning and ADA updates

The Mayor’s Commission on Disability Issues will hear a brief report on planning the July 2025 Celebration Event, discuss items of importance identified in the February 2025 meeting with city building officials, and receive a report from the ADA Coordinator. The meeting also includes public comment, approval of prior minutes, announcements, and scheduling of the next meeting.

disabilityadaeventsplanningcity-government
✓ Decided: Commission will address Archdale and Market St accessibility issues starting April 15

The commission unanimously approved the minutes from the January and February 2025 meetings. They decided not to invite durable medical companies to the July 23 ADA anniversary celebration and will organize the event in a table‑format to encourage interaction. The commission agreed to begin addressing water‑grate and steep‑ramp problems at the Archdale Street and Market Street intersection starting April 15, 2025. The meeting was adjourned following a motion by Vice‑Chair Jackson.

Thu Mar 20, 2025

Technical Review Committee

Jordan Tract Conservation Development concept plan reviewed

The Technical Review Committee will review fifteen applications, including a major concept plan for the Jordan Tract conservation development, several site plans for commercial, mixed‑use and residential projects, and road and intersection improvement plans. Decisions will be made on items that require board approvals such as the Planning Commission and the Development Review Board. The meeting will be held virtually via Zoom.

zoningdevelopmentsubdivisionroadshousingcommercial
Thu Mar 20, 2025

Technical Review Committee

TRC reviews 15 site plans, including 449-unit mixed-use and 313-unit development

The Technical Review Committee will review 15 site plans, subdivisions, and road construction plans at its March 20 meeting. Items include large residential and mixed-use projects on Johns Island, West Ashley, the Peninsula, Cainhoy, and Daniel Island. Decisions are advisory and most results are 'Revise and Return' or awaiting reviews.

zoningsite-plansubdivisionmixed-useconservationemergency-roomroad-constructioncharleston
Thu Mar 20, 2025

Community Development

Update on 993 & 995 Morrison Drive acquisition

The committee will discuss updates on the acquisition of properties at 993 and 995 Morrison Drive, hear a presentation from the Charleston Redevelopment Corporation, and consider proposed zoning changes to define pools, adjust setbacks, and create exceptions for elevated mechanical equipment stands.

community-developmentacquisitionmorrison-drivezoningpoolscharleston-redevelopment-corporation
✓ Decided: Committee approved acquisition terms for 993 & 995 Morrison Drive

The Community Development Committee unanimously approved amending the agenda to consider the proposed acquisition of 993 and 995 Morrison Drive. The committee then voted to approve the acquisition terms and directed Mayor Cogswell and staff to negotiate with Charleston County, with Councilmember Parker abstaining. The committee also unanimously approved the minutes from the February 20, 2025 meeting.

Thu Mar 20, 2025

Livability Review Board

Board reviews status of vacant structure at 112 Peachtree St.

The Livability Review Board will meet on March 20, 2025, to review and discuss the condition of the vacant building at 112 Peachtree Street, known as Wagener Terrace (circa 1938). Staff will provide updates on this property and any related items previously before the board. The meeting includes standard ADA accommodation notices.

housinghistoric-preservationlivabilityboard-meeting
Wed Mar 19, 2025

Planning Commission

Planning Commission to consider rezoning West Ashley Circle to a PUD

The Charleston Planning Commission will review a request to rezone about 11 acres of West Ashley Circle from Gathering Place to a Planned Unit Development. It will also consider an amendment to the Essex Farms Village Center PUD to permit a senior independent living facility of up to 80 units. In addition, the commission will hear multiple single-site zoning applications for commercial and residential uses on Wappoo Road and other West Ashley parcels.

zoningplanned-unit-developmentsenior-housingwest-ashleycommercialresidential
✓ Decided: Planning Commission unanimously approves rezoning, senior housing and zoning changes

The commission deferred the February 19, 2025 meeting minutes. It unanimously approved rezoning West Ashley Circle from Gathering Place to Planned Unit Development. It also unanimously approved an amendment to the Essex Farms PUD to allow a senior independent living facility of up to 80 units. Additional unanimous approvals were made for several commercial, office and residential zoning requests.

Wed Mar 19, 2025

Planning Commission

Planning Commission to consider rezoning West Ashley Circle to a Planned Unit Development

The commission will review a request to change approximately 11 acres of West Ashley Circle from Gathering Place (GP) to a Planned Unit Development (PUD). The applicant is Kimley‑Horn & Associates, Inc. for owner Whitfield Construction Company. Staff recommends approval of the rezoning before it proceeds to City Council for a second public hearing.

zoningplanningdevelopmentrezoningwest-ashley
Wed Mar 19, 2025

Planning Commission

Commission approves West Ashley Circle rezoning to Planned Unit Development

The Planning Commission voted 7-0 to rezone approximately 11 acres on West Ashley Circle from Gathering Place (GP) to Planned Unit Development (PUD), owned by Whitfield Construction Company. Commissioners also approved a PUD amendment for Essex Farms Village Center to allow a senior independent living facility of up to 80 units, and recommended zoning changes for 12 parcels across West Ashley, all by 7-0 votes.

zoningplanned-unit-developmentwest-ashleysenior-housingrezoningplanning-commissioncharleston
Wed Mar 19, 2025

Planning Commission

Planning Commission to consider 80-unit senior living PUD amendment

The Planning Commission will consider a PUD amendment to allow an 80-unit senior independent living facility at Essex Farms Village Center on Henry Tecklenburg Drive, alongside a rezoning of approximately 11 acres on West Ashley Circle from Gathering Place to Planned Unit Development. The agenda also includes zoning requests for 10 properties in West Ashley, mostly to single-family residential designations. Public comments on the senior living proposal raised concerns about traffic, flooding, and overdevelopment.

planning-commissionzoningwest-ashleypudsenior-housingpublic-hearingrezoningcharleston
Tue Mar 18, 2025

Public Safety Committee

Police committee approves subawards and grant applications for equipment and training.

The Public Safety Committee will consider approving subaward agreements for communications and policing services, as well as applications for various state and federal grants to fund equipment, training, and school resource officers.

policebudgetgrantsequipmenttrainingsrocops
Tue Mar 18, 2025

Board of Zoning Appeals Zoning

Board to weigh 20 variance requests, including after-the-fact commercial use on Savannah Hwy.

The Charleston Board of Zoning Appeals – Zoning will consider 20 applications for variances and special exceptions, ranging from residential additions to commercial uses. Notable items include a request to allow an art gallery at 12 Line St., a use variance for an office at 1 Rosemont St., and an after-the-fact variance for a driveway serving commercial properties at 580 Savannah Hwy. The board will also review minutes from three prior meetings.

zoningvariancesboard-of-zoning-appealspublic-hearingspecial-exceptionscommercial-useresidential
Tue Mar 18, 2025

Board of Zoning Appeals Zoning

Board reviews multiple variance and special‑exception requests for downtown properties

The Board will consider three minutes approvals from February and March. It will then discuss four applications: a special‑exception for a rear addition at 28 Carolina St., a use variance for an office at 1 Rosemont, a use variance for a 927 sf art gallery at 12 Line St., and a combined office and parking‑variance request at 1 I St.

zoningvariancesspecial-exceptiondowntownplanning
Tue Mar 18, 2025

Board of Zoning Appeals Zoning

Zoning board approves 19 of 20 items, denies 9 Tradd St. porch

The Board of Zoning Appeals decided on 20 applications at its March 18 meeting. It approved 19 items including variances for additions, porches, and commercial uses, denied a screen porch at 9 Tradd St. for exceeding lot coverage, and deferred one application. One item at 913 5th Ave. received partial approval and partial denial.

zoningvariancesboard-of-zoning-appealscharlestonresidentialporchesspecial-exceptionsland-use
Tue Mar 18, 2025

Board of Zoning Appeals Zoning

Board to consider four deck setbacks for Daniel Island townhomes

The Board of Zoning Appeals considers six variance requests at its March 18 meeting. The most contested items are four rear setback variances for decks at the Marshes development on Etta Way (Daniel Island), opposed by the Daniel Island Neighborhood Association but supported by the Architectural Review Board. Other items include a use variance for office space at 1 Rosemont St. and several residential setback requests.

zoningvariancescharlestonpublic-hearingdaniel-islandresidential-developmentsetback
Mon Mar 17, 2025

Design Review Board

DRB staff approves 16 quick-plan reviews for minor projects

The Design Review Board staff approved 16 quick-plan reviews for routine projects including accessory structures, roofing replacements, and mechanical equipment changes. No public hearings or major policy decisions were on the agenda.

design-reviewstaff-approvalsquick-plan-reviewaccessory-structuresroofingcommunication-towermechanical
Mon Mar 17, 2025

Board of Architectural Review

Board of Architectural Review staff approve 61 property permits

Staff reviewed and approved a series of quick plan reviews for residential and commercial properties. The approvals cover a range of maintenance, renovations, and new construction projects.

zoningconstructionpermitsarchitecturerenovation
Thu Mar 13, 2025

Human Affairs and Racial Conciliation Commission

Director of Housing presents updates to the Human Affairs and Racial Conciliation Commission

The commission will approve the February 13 meeting minutes, hear a presentation by Geona Johnson, the City of Charleston Director of Housing & Community Development, and discuss old business items such as the annual report, the Human Affairs Working Group, and subcommittee updates. The meeting also includes a public comment period and open discussion before adjournment.

housingcommunity-developmentpublic-commentreportscity-commission
Thu Mar 13, 2025

Charleston Basin Flood Action Committee

Charleston Basin Flood Action Committee to review water and stormwater plans

The committee will meet to discuss the city's flood action objectives and goals. The agenda includes an overview of the Charleston Water Plan and a report from the Stormwater Department on capital projects and maintenance.

floodingstormwaterinfrastructurewater-management
Thu Mar 13, 2025

Technical Review Committee

TRC to review fourth submission for Charleston Place Hotel exterior renovations

The Technical Review Committee will review 8 items including site plans, preliminary plats, and road construction. Notable projects include a fourth review of exterior renovations at The Charleston Place Hotel (205 Meeting St), a proposed new daycare at St. Johns Square Phase 2 (3309 Maybank Hwy), and demolition of a parking lot for a new Ronald McDonald House building (84 Barre St). Subdivisions on James Island (Cooper Judge Lane, 7 lots) and Fern Hill (11 lots) are also proposed.

site-planssubdivisionscharleston-place-hotelronald-mcdonald-housedaycarejames-islanddevelopment
Thu Mar 13, 2025

Technical Review Committee

Technical Review Committee to review site plans and subdivision plats

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans. The body is evaluating applications for new residential developments, commercial buildings, and exterior renovations.

zoningsite-planssubdivisionsresidential-developmentcommercial-development
Thu Mar 13, 2025

Board of Architectural Review

BAR-S to review new four-story mixed-use building on East Bay Street

The Board of Architectural Review – Small (BAR-S) will meet on March 13, 2025, to consider 14 applications for demolition, renovations, and new construction in historic districts. Items include conceptual approval for a four-story mixed-use building at 645 E Bay Street and a new single-family home at 2 Kennedy Court. The board will also review minutes from previous meetings.

historic-preservationdemolitionnew-constructionrenovationconceptual-approvalboard-of-architectural-review
Thu Mar 13, 2025

Board of Architectural Review

Board of Architectural Review to consider three partial demolition requests

The Board of Architectural Review - Small is meeting to review applications for partial demolitions of residential properties. The board will determine if the requested removals of materials and structures are permissible.

demolitionhistoric-preservationzoningresidential
Thu Mar 13, 2025

Board of Architectural Review

Board defers approval of a new three‑story home at 2 Kennedy Court.

The board approved with conditions the demolition of parts of historic homes at 110 Darlington Avenue, 56 Devereaux Street, 41 Woodall Court, and 11 Bedons Alley. It also approved with conditions the conceptual renovation of 123 Meeting Street and the screened‑porch addition at 35 Gibbes Street. The board deferred the conceptual approval of a new three‑story single‑family home at 2 Kennedy Court pending restudy of height, scale, and other design elements. All motions passed unanimously with five votes for and none against.

historic-preservationdemolitionnew-constructionarchitecturezoning
Wed Mar 12, 2025

Special Events Committee

Committee reviews large‑scale event permits including a Blink‑182 stadium concert

The Special Events Committee will consider a series of event applications for 2025, some with the applicant present and others without. Items include a post‑game drone show, a Greek festival, bike races, street closures for festivals, and a Blink‑182 concert at Credit One Stadium. The committee will discuss each proposal but no formal actions are indicated in the agenda.

special-eventspermitsfestivalsconcertsparksstreets
Wed Mar 12, 2025

Special Events Committee

Special Events Committee approves drone show, Greek Festival, and other event permits

The Special Events Committee met on March 12, 2025, and voted to approve permits for eight events, including the Charleston RiverDogs drone show, the Greek Festival, and several parades and festivals. Discussions addressed parking, security, and ADA compliance for each event.

eventspermitsspecial-eventsdronesparkingada-compliance
Wed Mar 12, 2025

Board of Architectural Review

BAR-L to consider final approval for senior living facility at 625 King Street

The Board of Architectural Review – Large will review six applications, including a full demolition request, a mock-up panel, façade revisions, and new construction projects. The board will decide on final approval for a senior living facility at 625 King Street and conceptual approvals for a hotel at 657 King Street and a garden pavilion at 68 Spring Street. Public comment is accepted in person or in writing.

board-of-architectural-reviewdesign-reviewhistoric-districtnew-constructiondemolitionsenior-livinghotel
Wed Mar 12, 2025

Board of Architectural Review

Board to consider full demolition of gas station at 590 Meeting Street

The Board of Architectural Review will decide on a request to fully demolish a former gas station building at 590 Meeting Street, described as non-contributing and in poor condition (built circa 1945-1951). The board will also review a mock-up panel for The Charles development at 1 Barre Street. Approval of the February 12, 2025 meeting minutes is also on the agenda.

demolitionhistoric-districtdesign-reviewurban-developmentcharlestonbar
Wed Mar 12, 2025

Board of Architectural Review

Board approves senior living facility at 625 King Street with Art Deco move

The Board of Architectural Review approved five applications at its March 12 meeting, including final approval for a new senior living facility at 625 King Street that involves moving an Art Deco building on site. The board also approved demolition of a gas station at 590 Meeting Street, approved a mock-up panel for The Charles at 1 Barre Street, and issued a split decision on façade revisions at 155 Meeting Street. A conceptual proposal for a new hotel at 657 King Street was deferred for restudy of massing and scale.

architectural-reviewdemolitionnew-constructionsenior-livinghotelhistoric-preservationcharleston
Tue Mar 11, 2025

City Council

Council to vote on fire station acquisition via eminent domain for Cainhoy area

Charleston City Council will consider a resolution authorizing property acquisition, including eminent domain, for a fire station in the Cainhoy area. Other actions include approval of a $9.2 million lease-purchase agreement for vehicles and equipment, several annexations in West Ashley, and contracts for flood resilience planning and emergency drainage repairs. Several proclamations and committee updates are also on the agenda.

fire-stationeminent-domainpublic-safetybudgetannexationflood-resiliencecontracts
Tue Mar 11, 2025

City Council

Council to review a 5‑year $107,944/year service contract with Johnson Controls

The City Council will consider a Planned Service Agreement between the City and Johnson Controls for the GAILLARD MANAGEMENT CENTER. The contract covers preventative maintenance for five years starting March 1 2025, with a first‑year price of $107,944. The agreement includes automatic one‑year renewals unless notice is given, and refrigerant costs are billed separately.

contractsfacilitiesmaintenancebudgetservices
Mon Mar 10, 2025

Design Review Board

New freestanding emergency department proposed at 3075 Maybank Hwy

The Design Review Board staff is approving 10 quick-plan review items, including a new 11,700-square-foot freestanding emergency department with 11 treatment rooms as a satellite of Trident Regional Medical Center. Other items include a new two-story commercial building, sign installations, and mechanical replacements. No public hearings or ordinance changes are on this agenda.

design-reviewcommercial-developmentemergency-departmentsignscharleston
Mon Mar 10, 2025

Board of Architectural Review

New single-family home at 190 1/2 Nassau St among 54 permit approvals

This agenda lists 54 staff-level quick plan reviews for building permits in Charleston's historic district. Permits cover renovations, new construction, roofing, painting, and electrical work, with several projects requiring flood elevation compliance as substantial improvements.

architectural-reviewhistoric-districtbuilding-permitsrenovationsnew-constructionflood-compliancecharleston
Thu Mar 6, 2025

Technical Review Committee

Technical Review Committee to review site plans for schools, condos, and storage

The Technical Review Committee is reviewing site plans, subdivision concept plans, and road construction plans for several developments. The committee evaluates these applications for compliance with zoning, engineering, and safety standards.

zoningsite-planshousingeducationroadscommercial-development
Thu Mar 6, 2025

Technical Review Committee

Technical Review Committee to review site plans and subdivisions

The Technical Review Committee is reviewing several development applications, including residential subdivisions, a new middle school, and commercial projects. The body is evaluating concept plans, preliminary plats, and road construction plans for various locations across the city.

zoningsite-planshousingeducationinfrastructure
Thu Mar 6, 2025

Keep Charleston Beautiful

Keep Charleston Beautiful to discuss spring cleanup events

The Keep Charleston Beautiful board will review recent activities and plan upcoming spring projects, including the Great Charleston Cleanup and Earth Day events. The meeting will also cover the High Water Music Festival fundraiser and a Star Wars-themed cleanup.

cleanupenvironmenteventsvolunteerscommunitycharleston
Wed Mar 5, 2025

Board of Zoning Appeals Site Design

Board to consider removal of 29 grand trees at Hollydale Court

The Board of Zoning Appeals – Site Design will hear several applications including a deferred item from Hollydale Court on Johns Island requesting variances and special exceptions to remove 29 grand trees. New applications include individual tree removals and a request to reduce the OCRM Critical Line Buffer width at 2079 Austin Avenue. The meeting is open for public comment in person or by written submission.

zoningboard-of-zoning-appealsgrand-treesvariancesspecial-exceptionstree-removalbuffer-reductionpublic-hearing
Wed Mar 5, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to review grand tree removal and buffer requests

The Board of Zoning Appeals-Site Design will consider several requests for variances and special exceptions. These include requests to remove grand trees at multiple locations and a reduction in a critical line buffer width.

zoningtree-removalenvironmental-bufferland-use
Wed Mar 5, 2025

Board of Zoning Appeals Site Design

Board approves tree removal variances with conditions

The Charleston Board of Zoning Appeals approved four requests to remove trees, including a large project on Hollydale Court and a variance to omit a tree density requirement on St. Philip Street.

zoningtree-removalboard-of-appealscharlestonenvironmentvariancespecial-exception
Wed Mar 5, 2025

Board of Zoning Appeals Site Design

Board considers variance to remove 29 grand trees on Johns Island

The Board of Zoning Appeals – Site Design will hold a public hearing on March 5, 2025, to consider several applications, including a request to remove 20 grand trees (variance) and 9 grand trees (special exception) at Hollydale Court on Johns Island. The board will also review minutes from February 5, 2025, and decide on several other tree removal and buffer reduction requests.

zoningtree-removalvariancesgrand-treesjohns-islandpublic-hearingboard-of-zoning-appeals
Wed Mar 5, 2025

Commission on History

Commission on History to consider Byrnes Downs marker

The History Commission will review and potentially approve a proposed historical marker for the Byrnes Downs neighborhood in West Ashley. The meeting includes approval of minutes from previous meetings and miscellaneous business. The marker text highlights the neighborhood's WWII-era origins and its naming for James F. Byrnes.

historymarkersbyrnes-downswest-ashleyneighborhoodswwii-housingjames-f-byrnes
Tue Mar 4, 2025

Board of Zoning Appeals Zoning

BZA considers café, home additions, and lot size variance

The Board of Zoning Appeals will review deferred applications including a special exception for a café at 115 ½ Wentworth St., a vertical extension variance at 40 Piedmont Ave., a lot size variance for a new home at 1011 Mamie St., and setback and lot occupancy variances for a rear addition at 176 Smith St. New applications were moved to March 18 due to a noticing error.

zoningvariancesspecial-exceptionscafehousingboard-of-zoning-appealscharleston
Tue Mar 4, 2025

Board of Zoning Appeals Zoning

Board to decide on special exception for Wentworth St. café

The Board of Zoning Appeals will consider two special exception requests: one for a café at 115½ Wentworth St. and another to extend a non-conforming structure at 40 Piedmont. The meeting also includes approval of previous meeting minutes.

zoningboard-of-zoning-appealsspecial-exceptioncafenon-conforming-structurecharleston
Tue Mar 4, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves four property exceptions and variances

The Board of Zoning Appeals reviewed several requests for special exceptions and variances regarding parking, setbacks, and lot size. All new applications for this meeting were shifted to March 18, 2025, due to a public noticing error.

zoningparkingsetbacksvarianceshousing
Tue Mar 4, 2025

Board of Zoning Appeals Zoning

Board to decide on special exception for cafe at 115 ½ Wentworth St with reduced parking

The Board of Zoning Appeals will consider a request for a special exception to allow an 847-square-foot café at 115 ½ Wentworth Street with only 4 parking spaces instead of the required 9. The item has been carried over from previous meetings due to cancellations and lack of quorum. Public comments express both support and concern about parking and operating hours.

zoningparkingspecial-exceptioncafecharlestonharleston-village
Mon Mar 3, 2025

Design Review Board

Design Review Board to consider retail and commercial projects

The Design Review Board will review four applications for demolition and construction projects. The board is deciding on conceptual approvals for new retail buildings and a market conversion, as well as partial demolitions of windows and doors.

zoningcommercial-developmentdemolitionretail
Mon Mar 3, 2025

Design Review Board

Design Review Board to consider demolitions and new retail construction

The Design Review Board is reviewing requests for partial demolitions of buildings over 50 years old and conceptual approvals for a market conversion and new retail buildings.

demolitionretailzoningpreservationcommercial-development
Mon Mar 3, 2025

Design Review Board

Design Review Board approves retail and market projects in West Ashley and James Island

The Design Review Board decided on several demolition and conceptual renovation requests. The board granted approvals for building modifications and new retail construction across three different sites.

zoningdemolitionretailcommercial-developmentwest-ashleyjames-island
Mon Mar 3, 2025

Design Review Board

Approval of 90 affordable housing apartments at Laurel Oak Lane

The Design Review Board will consider quick‑plan approvals for two new multi‑family apartment projects at 795 and 755 Laurel Oak Lane, each providing 90 affordable units and a clubhouse. It will also review a safety repair for the pool house at 200 River Landing, a mock‑up panel for the 211 Seven Farms Drive mixed‑use project, and a phasing permit for 24 units at 420 Brooking Square Ln. Additional items include gas lanterns at Indigo Grove, a commercial re‑roof at 1243 Harbor View Rd, temporary stadium seating at 161 Seven Farms Dr, and plumbing work for a pool pavilion at 1002 UT Waterline St.

housingzoningconstructionsafetyutilities
Mon Mar 3, 2025

Board of Architectural Review

BAR staff review 52 routine repair and renovation permits

The Board of Architectural Review staff is processing 52 quick plan review permits for March 3-7, 2025, covering exterior repairs, roofing, painting, and mechanical work on historic and non-historic properties in Charleston. These are staff-level approvals, not public hearings. Notable items include a tenant upfit to convert a library to an event space at 81 Mary St and a renovation with new rear addition at 1 1/2 Addison St.

architectural-reviewhistoric-preservationpermitscharlestonbuilding-repairsroofingsolar-panelsstaff-approvals
Thu Feb 27, 2025

Minority Business Enterprise Advisory Board

MBE board to discuss Expo, ERC updates, board vacancies

The Minority Business Enterprise Advisory Board meets to receive updates on the Small Business Opportunity Expo scheduled for April 1, 2025, the Entrepreneurial Resource Center's application process and report, and current board vacancies. No formal votes or actions are on the agenda.

minority-businesssmall-businessentrepreneurshipadvisory-board
Thu Feb 27, 2025

Redevelopment and Preservation Commission

Commission reviews rehabilitation requests for Hagood Avenue and King Richard Drive

The Redevelopment and Preservation Commission is meeting to review requests for approval regarding housing rehabilitation programs. The body will consider specific projects under the Limited Substantial Rehabilitation and Roof Rehabilitation programs.

housingrehabilitationpreservation
Thu Feb 27, 2025

Technical Review Committee

Charleston TRC reviews 19 site plans and subdivisions

The Technical Review Committee will review 19 site plans and subdivision applications, including school expansions, road construction, and utility upgrades, via Zoom on February 27, 2025.

zoningdevelopmentinfrastructureroadssubdivisionsschoolplanning
Thu Feb 27, 2025

Technical Review Committee

Committee reviews plans for 336-unit Alliance Apartments in Cainhoy

The Technical Review Committee reviews 19 development applications, including site plans, preliminary plats, and road construction proposals. Most items receive 'revise and return' results, indicating the committee requires revisions before approval. Notable projects include a 336-unit apartment complex, a 91-lot subdivision, and school expansions.

site-plan-reviewsubdivisionroad-constructionhousingapartmentsdrainageschool-expansioninfrastructure
Thu Feb 27, 2025

Board of Architectural Review

Board of Architectural Review – Small to review demolition and construction requests

The Board of Architectural Review – Small will consider several applications for new construction, conceptual approvals for additions, and partial demolition requests. The board will also hear appeals of staff decisions regarding roofing materials and window graphics.

zoninghistoric-preservationdemolitionconstructionarchitecture
Thu Feb 27, 2025

Board of Architectural Review

Board reviews mixed-use development proposal for 12 Oliver Court

The Board will consider several demolition requests for historic properties and a new mixed‑use building at 12 Oliver Court. The Oliver Court project seeks conceptual approval for a three‑story building with a fitness center and residential units, requiring a parking special exception and a landscape buffer variance. The Board will also hear applicant presentations for the demolition applications.

historic-demolitionmixed-usezoningparkinglandscape-buffer
Thu Feb 27, 2025

Board of Architectural Review

Board denies demolition at 275 Ashley Ave and approves multiple projects

The Charleston Board of Architectural Review approved the minutes from three prior meetings, denied a demolition request for 275 Ashley Avenue, and approved several new construction and renovation applications, some with conditions. Approvals included a roof demolition at 40 Piedmont Avenue, a mixed‑use building at 12 Oliver Court, a rear addition at 55 Elizabeth Street, and a new single‑family home at 2 F Street. Several projects received specific conditions regarding roof visibility, shutter design, and façade detailing.

historic-preservationconstructionzoningmixed-useresidential
Thu Feb 27, 2025

Board of Architectural Review

BAR-S to consider new mixed-use building at 12 Oliver Court, other historic district requests

The Board of Architectural Review – Small will consider 14 applications including demolitions, new construction, and appeals of staff decisions. Two items (110 Darlington Street and 342 King Street) have been withdrawn. Public comments were submitted for the 8 Motley Lane and 11 Montagu Street proposals.

architectural-reviewhistoric-districtdemolitionnew-constructionpublic-hearingcharleston
Wed Feb 26, 2025

Tourism Commission

Tourism Commission to review carriage company permits and film guidelines

The Tourism Commission will hear subcommittee reports on quality of life and tourism rules, then discuss applications for certificates of appropriateness from three sightseeing companies (Adventure Sightseeing, Palmetto Carriage Works, Old South Carriage Company). The board will also review proposed updates to film and photography guidelines and an amendment to the Special Events Ordinance. No final votes are guaranteed; action may or may not be taken.

tourismcarriage-companiescertificates-of-appropriatenessfilm-guidelinesspecial-events-ordinancepublic-hearing
Wed Feb 26, 2025

Tourism Commission

Tourism subcommittee to review Adventure Sightseeing certificate applications

The Tourism Commission Routes, Parking and Tourism Rules Subcommittee will meet virtually and in person on February 26. The primary discussion item is a review of applications for Certificates of Appropriateness from Adventure Sightseeing. Public comments may be submitted in writing before the meeting or made in person.

tourismsubcommitteecertificates-of-appropriatenessadventure-sightseeingpublic-comment
Wed Feb 26, 2025

Special Events Committee

Committee to discuss permits for 10,000-person concerts at Credit One Stadium

The Special Events Committee will discuss and potentially decide on permits for several large events, including multiple concerts at Credit One Stadium with attendances up to 10,000. Items with applicants present include the Walk to End Alzheimer's, the South Carolina Aquarium block party, and a food truck competition film shoot. Additional items without applicants include farmers markets, runs, and festivals across the peninsula and West Ashley.

eventspermitsconcertscharity-walkblock-partyfarmers-marketspecial-events-committee
Wed Feb 26, 2025

Special Events Committee

Special Events Committee denies late Wine & Food Local permit application

The Special Events Committee denied a late permit application from Wine & Food Local and approved numerous event permits, including the Walk to End Alzheimer's, SC Aquarium block party, and multiple concerts at Credit One Stadium. The committee also received an update on a new representative from the Department of Livability and Tourism and discussed conditions for several events.

eventspermitspoliceconcertspublic-safetycommunity-engagement
Tue Feb 25, 2025

City Council

Council to hear housing goals, vote on annexations and zoning changes

This meeting includes public hearings on six zoning reclassifications, second-reading votes on 10 annexation ordinances, and a presentation on the City of Charleston Housing Goals by Bloomberg Associates. Council will also consider a $178,709 stormwater contract and authorizing the city to facilitate a mortgage for the Gibbes Museum.

zoninghousingannexationsstormwaterpublic-hearingmuseumspublic-works
Tue Feb 25, 2025

City Council

City Council to consider $736,731 contract for police video storage

The Committee on Ways and Means will review several city contracts and real estate agreements. The body is deciding on funding for public works, fire department equipment, and a mortgage accommodation for the Gibbes Museum.

public-safetyinfrastructurereal-estatebudgettransportation
Tue Feb 25, 2025

Traffic and Transportation Committee

Public hearing on Senate Street one-way conversion

The Traffic & Transportation Committee will hold a public hearing on converting Senate Street from two-way to one-way traffic. The agenda also includes updates on the Ashley River Crossing project, the Lowline, River Road improvements near a Johns Island elementary school, and a presentation on Lime Bikeshare. Discussion and potential action on six nighttime pedicab decals is also scheduled.

trafficone-way-streetsbikesharepedicabstransportationpublic-hearingpedestrian-projects
Mon Feb 24, 2025

Design Review Board

Design Review Board reviews 19 commercial construction permits

The Design Review Board is reviewing 19 commercial construction permits, including roof replacements, mechanical upgrades, and signage approvals. The agenda includes a plan review for a new medical office shell building and a temporary construction trailer for the Porter-Gaud Chapel project.

constructionpermitszoningcommercialsignagebuildingmechanical
Mon Feb 24, 2025

Public Works and Utilities Committee

Committee to weigh $200K flood resilience plan for Rosemont, Bridgeview

The Public Works and Utilities Committee will consider a $200,000 contract amendment with Black & Veatch for a flood resilience project in the Rosemont and Bridgeview neighborhoods, funded by General Fund Reserves. They will also vote on a $178,709 emergency lining contract for a 36-inch CMP in the Sandhurst neighborhood and authorize a $200,000 engineering contract with Robinson Design Engineers. Additionally, the committee will accept easements for the Marshes at Daniel Island phases and an exclusive stormwater drainage easement for the Spinx West Wildcat gas station project.

public-worksutilitiesstormwaterflood-resiliencecontractseasementssandhurstrosemont
Mon Feb 24, 2025

Commission on Women

Commission on Women meets for procedural discussion only

The Charleston Commission on Women is holding a meeting with a single substantive item: discussion. The agenda also includes approval of minutes from November 20, 2024, and standard procedural items. No specific topics, proposals, or votes are listed for discussion.

commission-on-womencharlestonmeetingprocedural
Mon Feb 24, 2025

City Council

Committee to vote on 10-year lease for Lowcountry Senior Center with Roper St. Francis

The City Council Committee on Real Estate will consider several real estate actions, including a consolidated lease and management agreement for the Lowcountry Senior Center at 865 Riverland Drive for a 10-year term with Roper St. Francis Healthcare. Other items include a quitclaim deed for right-of-way on Pier View Street and Daniels Landing Drive, an accommodation party mortgage for the Gibbes Museum at 135 Meeting Street, an easement agreement on Bees Ferry Road, and nine annexations in West Ashley. The committee is also approving minutes from a previous meeting.

real-estateleasesenior-centerannexationquitclaimeasementmuseum
Mon Feb 24, 2025

Board of Architectural Review

Board reviews expansion of 141 Meeting St building and museum link

The Board of Architectural Review will consider a core‑and‑shell expansion of the 141 Meeting St commercial building, adding a rear west‑side addition and a connector to the Gibbes Museum at 135 Meeting St. The board will also review a new multi‑family construction at 89 Fishburne St that requires prior TRC approval, and several residential repair and renovation permits. All items are scheduled for quick plan review between February 24 and February 28, 2025.

zoningconstructionhistoric-preservationhousingmuseumplumbingroofing
Mon Feb 24, 2025

Recreation Committee

Committee to discuss Longborough Dock negotiations and recreation ordinance update

The Recreation Committee will review the status of Longborough Dock negotiations and consider updates to the recreation ordinance. Other topics include landscaping at James Lewis Apartments and Cleveland Street, a request to power wash walls around College Park, and a discussion on making meetings hybrid.

recreationparksdocksordinancelandscapingmeeting-format
Fri Feb 21, 2025

Commission on Disability Issues

Commission reviews plan for ADA compliance in City facilities

The Mayor’s Commission on Disability Issues will review a plan to make City facilities fully ADA compliant. The body will also receive a report on a July 2025 celebration event and discuss ideas with City building officials.

ada-compliancecity-facilitiesdisability-servicespublic-planning
Thu Feb 20, 2025

Technical Review Committee

TRC reviews 158-unit mixed residential project at 1472 Clements Ferry Rd

The Technical Review Committee will review four site plans and subdivision concepts: a 158-unit mixed residential development at 1472 Clements Ferry Rd, a utility installation at 2235 Hagood Rd, a mixed-use building at 9 Linguard St, and an early site package at Long Savannah. These are technical reviews, not final decisions.

site-plan-reviewtechnical-review-committeemixed-residentialutility-installationmixed-useearly-site-packagedevelopment
Thu Feb 20, 2025

Technical Review Committee

TRC reviews Restore at Point Hope (158 units) and other site plans

The Technical Review Committee will review four site plans and subdivision proposals, including a 158-unit mixed residential development at 1472 Clements Ferry Road and an early site package for future development in Long Savannah. The committee will decide whether to approve items or require revisions; two items have returned with 'no return/paperwork comments' (likely administrative approval) and two with 'revise and return'.

zoninghousingdevelopmentsite-planssubdivisions
Thu Feb 20, 2025

Human Resources Committee

Human Resources Committee will review the new Human Resources Ordinance

The committee will discuss several updates, including a staffing and retention report, an overview of a proposed Human Resources Ordinance, and updates on customer service initiatives and the search for a new HR Director. These items are for informational review and potential recommendation to the City Council.

human-resourcesordinancestaffingemployee-benefitscity-government
Thu Feb 20, 2025

Community Development

City to discuss housing options and waterfront redevelopment

The Community Development Committee will meet to approve minutes, discuss rapid housing options, and review a waterfront redevelopment plan. The committee will also consider an accommodations tax revenue analysis.

housingwaterfrontredevelopmentplanningminutes
Thu Feb 20, 2025

Livability Review Board

Vacant structure review at 8 Pratt St. on Livability Board agenda

The Livability Review Board will hold a hearing to review and discuss the status of vacant structures, specifically at 8 Pratt St. (TMS# 351-16-00-110). The board will also receive staff updates on properties previously before it. No other business is listed.

livabilityvacant-structurescode-enforcementhousingboard-meeting
Wed Feb 19, 2025

Planning Commission

Planning Commission to consider comprehensive plan amendment allowing ATAX for workforce housing

The Planning Commission will vote on several rezonings, including two on the Peninsula: 15 Radcliffe Street from Diverse Residential to General Business and 120 Saint Philip Street from General Business to Diverse Residential. They will also consider two comprehensive plan amendments: one to incorporate a housing impact analysis from state Act 57 to allow Accommodations Tax (ATAX) for workforce housing, and another to rename the 'Future Planning Area' district to 'Urban Waterfront' district. Several zoning requests in West Ashley seek to establish city zoning on properties currently under county zoning, including requests for Single-Family Residential (SR-1) on five parcels. Two items are deferred: the West Ashley Circle rezoning and the 834 Wappoo Road zoning request.

planning-commissionrezoningcomprehensive-planhousingwest-ashleypeninsulazoning
Wed Feb 19, 2025

Planning Commission

Commission to consider ATAX housing amendment and waterfront district

The Planning Commission will hold a public hearing and vote on recommendations for two rezoning requests and two comprehensive plan amendments. Actions include rezoning properties at 15 Radcliffe Street and 120 Saint Philip Street, and amending the city plan to allow accommodations tax (ATAX) funds for workforce housing and to create a new Urban Waterfront land use district. Staff recommends approval on all items.

zoningcomprehensive-planhousingwaterfrontataxworkforce-housingrezoning
Wed Feb 19, 2025

Planning Commission

Planning Commission approves affordable housing tax amendment and rezonings

The Planning Commission decided on several rezoning requests and amendments to the City Comprehensive Plan. This includes a change to allow Accommodations Tax (ATAX) to support local workforce housing. The body also approved zoning changes for multiple properties in the Peninsula and West Ashley areas.

zoningaffordable-housingcomprehensive-planwest-ashleypeninsula
Wed Feb 19, 2025

Planning Commission

Planning Commission will consider rezoning of 15 Radcliffe St and 120 Saint Philip St

The commission will decide whether to change the zoning of two adjacent parcels on the Peninsula. 15 Radcliffe Street is proposed to shift from Diverse Residential (DR-2) to General Business (GB) to allow a parking garage. 120 Saint Philip Street is proposed to shift from General Business (GB) to Diverse Residential (DR-1). The agenda also includes several other rezoning requests, two comprehensive plan amendments, and public comment.

zoningplanningdevelopmentaffordable-housingwaterfront
Tue Feb 18, 2025

Design Review Board

Design Review Board reviews six commercial exterior and sign requests

The Design Review Board is reviewing staff approvals for commercial property modifications. These items include roofing updates and the installation or relocation of business signage.

commercial-developmentsignagedesign-reviewpermits
Tue Feb 18, 2025

Public Safety Committee

Committee to consider site for Fire Station 20, possible condemnation

The Public Safety Committee will hear a report on alternative locations for Fire Station 20 and may vote to authorize staff to begin acquisition, including condemnation. The committee will also consider approving a mutual aid agreement with the Columbia Police Department. Additionally, appointments of two Assistant Fire Marshals as code enforcement officers are on the agenda.

public-safetyfire-stationpolicemutual-aidcode-enforcementfire-departmentappointments
Tue Feb 18, 2025

Board of Architectural Review

BAR staff reviews 29 routine repair and construction permits

This is a staff-level agenda for the Board of Architectural Review, covering 29 quick-plan-review permits. Most items are minor repairs, painting, roofing, HVAC changes, and pool installations. One new single-family home at 99 Hanover Street is proposed, and a restaurant renovation at 40 Broad Street is included. No public hearings or major policy decisions are scheduled.

architectural-reviewpermitsstaff-approvalshistoric-districtcharleston
Tue Feb 18, 2025

Board of Zoning Appeals Zoning

Board to consider special exception for 5,965sf event venue at 729 East Bay St.

The Board of Zoning Appeals will hear 11 applications, including special exceptions, variances, and a fourth extension of a vested right for a 150-unit accommodations use. Key items involve a large event venue, a fitness center with no parking, and several requests to build on undersized lots or modify non-conforming structures. Several agenda items have been deferred due to lack of quorum or other reasons.

zoningspecial-exceptionvarianceboard-of-zoning-appealscharlestonpublic-hearingland-use
Tue Feb 18, 2025

Board of Zoning Appeals Zoning

Board considers extension of vested right for 150-unit accommodations at 245 Huger St

The Board of Zoning Appeals will hear two applications: a fourth one-year extension of a vested right for a 150-unit accommodations use at 245 Huger St, and a special exception to vertically extend a non-conforming building at 20 Maranda Holmes St. The board may approve, deny, or defer each item after public hearing.

zoningboard-of-zoning-appealsspecial-exceptionvariancehousingaccommodationscharleston
Tue Feb 18, 2025

Board of Zoning Appeals Zoning

Board of Zoning Appeals approves multiple special exceptions and variances

The Board of Zoning Appeals reviewed several requests for zoning variances and special exceptions. The body decided on property modifications, parking reductions, and lot size exceptions for residential and commercial sites.

zoningvariancesparkinghousingcommercial-development
Tue Feb 18, 2025

Board of Zoning Appeals Zoning

Board to decide café parking variance at 115 ½ Wentworth St.

The Board of Zoning Appeals will hear two special exception requests: one to vertically extend a non-conforming building at 20 Maranda Holmes St., and another to allow a café at 115 ½ Wentworth St. with reduced parking (4 spaces instead of 9 required). Public comments have been submitted for both items, with over 20 letters for the Wentworth St. café.

zoningspecial-exceptionparking-variancenon-conforming-useharleston-villagewestsidecafe
Thu Feb 13, 2025

Human Affairs and Racial Conciliation Commission

Commission to review annual report and working group updates

The Human Affairs and Racial Conciliation Commission will convene to approve minutes from the previous meeting, review the annual report, and discuss updates from the Human Affairs Working Group and subcommittees.

commissionreportworking-groupsubcommitteepublic-comment
Thu Feb 13, 2025

Technical Review Committee

TRC to review 300-unit affordable housing project in Cainhoy

The Charleston Technical Review Committee will review site plans, subdivision plats, and road construction plans for several developments across the city. Notable items include a 300-unit multi-family development with affordable housing in Cainhoy, a 262-unit preliminary plat in the same area, and a 122-unit concept plan on Johns Island. The committee also will consider road improvements at Savage Road and US-17.

zoningdevelopmentaffordable-housingroadssite-planssubdivisionscainhoyjohns-island
Thu Feb 13, 2025

Technical Review Committee

TRC reviews 300-unit Woodfield Point Hope 4 with affordable housing

The Technical Review Committee will review seven site plans, subdivision plats, and road construction plans for developments across Johns Island, Cainhoy, and West Ashley. Items include a 122-unit multi-family and single-family concept plan, preliminary plats and road plans for 76-lot and 262-lot subdivisions, and a 300-unit multi-family development with affordable housing units. The committee will also consider intersection improvements at Savage Road and US-17. Results range from 'revise and return' to 'no return' based on technical compliance.

housingdevelopmentsubdivisionsroadsaffordable-housingjohns-islandcainhoywest-ashley
Thu Feb 13, 2025

Board of Architectural Review

BAR-S to consider 15 applications including demolitions and new homes

The Board of Architectural Review – Small will meet to review 15 applications for changes to historic properties in Charleston. Items include partial demolitions, new construction, and modifications requiring conceptual or final approval. Public comment may be submitted in writing or given in person.

historic-preservationdemolitionnew-constructionpublic-hearingboard-of-architectural-reviewcharleston
Thu Feb 13, 2025

Board of Architectural Review

Board of Architectural Review to review demolition and addition requests

The Board of Architectural Review - Small will consider a partial demolition request for a property on Hester Street and a conceptual rear addition for a residence on Rutledge Avenue.

zoninghistoric-preservationdemolitionresidential
Thu Feb 13, 2025

Board of Architectural Review

Board of Architectural Review denies two demolition requests

The Board of Architectural Review reviewed several applications for demolition and new construction. The board denied requests to demolish a caretaker's house and an after-the-fact demolition of a bungalow.

zoningdemolitionhistoric-preservationhousingarchitecture
Thu Feb 13, 2025

Board of Architectural Review

Board reviews numerous demolition, addition and solar panel requests, including 48 Rutledge Ave

The Charleston Board of Architectural Review – Small will consider 15 applications ranging from partial demolitions to new single‑family dwellings and roof projects. Several items, such as 48 Rutledge Avenue, have multiple public comments expressing concerns about scale, flood‑risk and zoning. One application (2 Council Street) has been withdrawn by staff. The board will also receive position statements on solar panels at 47 Athens Court and roof work at 17 Lenwood Boulevard.

historic-preservationdemolitionnew-constructionsolar-panelsroof-replacement
Wed Feb 12, 2025

Special Events Committee

Credit One Stadium Charleston Tennis Open approved for March 29‑April 6, 2025

The Special Events Committee will review a slate of event applications, including festivals, races, parades, and concerts. General updates will be provided with no action taken. Specific items include the Teddy Bear Picnic at the Fishburne Lot, The Citadel's Class of 2028 Recognition Day, and the Credit One Stadium Charleston Tennis Open. The committee will also discuss other events such as the Spring Artisan Market and several foot races.

eventsfestivalssportsconcertsracesparadesvenues
Wed Feb 12, 2025

Special Events Committee

Committee tables Bloom Charleston festival over parking concerns

The Special Events Committee reviewed 13 event applications, approving most but tabling the Bloom Charleston festival at Colonial Lake (Oct 17-18) because of parking and road closure issues. The Girls on the Run race at Hampton Park (May 17) was also tabled due to parking overload. Credit One Stadium events, including the Tennis Open (90,000 attendees), were approved with no concerns.

special-eventsfestivalsroad-closuresparkingpublic-safetypermitscharleston
Wed Feb 12, 2025

Board of Architectural Review

BAR-L to consider 40-unit apartment building with retail at 162 Ashley Ave

The Board of Architectural Review – Large will review several applications, including a conceptual approval for a 40-unit apartment building with ground-level retail at 162 Ashley Avenue, and a full demolition of the existing structure at the same address. Extension requests include a second-year extension for a two-story addition at 98 Wentworth Street, a first-year extension for development at 609 King Street, and a first-year extension for demolition of a motel at 155 Meeting Street. The meeting will also approve minutes from January 8, 2025.

architectural-reviewhistoric-districtnew-constructiondemolitionapartment-buildingretailcharleston
Wed Feb 12, 2025

Board of Architectural Review

40-unit apartment building with retail proposed at 162 Ashley Avenue

The Board will consider a full demolition request for a building at 162 Ashley Avenue, followed by conceptual approval for a new 40-unit apartment building with ground-floor retail on the same site. The board will also vote on extensions for previously approved projects at 98 Wentworth Street, 609 King Street, and 155 Meeting Street.

architectural-reviewdemolitionnew-constructionhistoric-districthousingcharleston
Wed Feb 12, 2025

Board of Architectural Review

Board defers decision on 40-unit apartment building at 162 Ashley Avenue

The Board approved multiple extensions for previous approvals and a full demolition, but deferred conceptual approval for a proposed 40-unit apartment building with ground-floor retail at 162 Ashley Avenue. The deferral came with conditions requiring restudy of height, massing, materials, and design to better fit the surrounding context. All other applications received unanimous approval.

board-of-architectural-reviewhistoric-districtdemolitionnew-constructionapartmentsdesign-reviewcharleston
Tue Feb 11, 2025

City Council

Council to give first reading to 13 code amendments and $2M operations complex fee amendment

Charleston City Council will consider a large package of ordinance amendments from the Ad Hoc Rules Advisory Committee, including changes to meeting times, board terms, and multiple city code chapters. The council will also vote on committee reports covering contracts for flood resilience planning, stormwater projects, park maintenance, and affordable housing construction. A modification to the Harper Tract planned unit development is scheduled for discussion.

administrationzoningtransportationbudgethousingstormwaterparkspolice
Tue Feb 11, 2025

City Council

City Council committee to consider $2.08M redesign contract for Municipal Operations Complex

The Ways and Means committee will vote on several contracts and amendments, including a $2.08 million redesign of the Municipal Operations Complex, a $200,000 flood resilience plan for Rosemont and Bridgeview neighborhoods, and a $254,644 increase for townhomes at 1555 Juniper Street. Items also cover court maintenance, stormwater drainage improvements, and a police grant. Real estate actions from a prior meeting are listed for approval.

city-councilcharlestoncontractsresiliencehousingparksstormwaterpolice
Mon Feb 10, 2025

Tourism Commission

Subcommittee to review film guidelines and special events ordinance

The Tourism Commission: Quality of Life Subcommittee will discuss and possibly take action on two items: a review of Film and Photography Guidelines and a review of an amendment to the Special Events Ordinance. Public comment is accepted before the meeting. The meeting is held virtually and in person at 75 Calhoun Street.

tourismquality-of-lifefilmphotographyspecial-eventsordinancepublic-comment
Mon Feb 10, 2025

Design Review Board

DRB reviews plans for new 4-story apartment buildings at Daniels Landing

The Design Review Board is conducting quick plan reviews for several projects, including new construction of two 4-story apartment buildings at 200 and 201 Daniels Landing, a commercial deck extension at 1101 Savannah Hwy, and multiple sign installations at 1980 Ashley River Rd and 1800 Produce Ln. No decisions are recorded; these are staff-level administrative reviews.

design-reviewmulti-familyconstructionsignscharlestonquick-plan-review
Mon Feb 10, 2025

Board of Architectural Review

Board reviews 32 staff-approved building permits

The Board of Architectural Review will review a list of 32 staff-approved permits for mechanical, electrical, plumbing, painting, fencing, roofing, signs, pools, and interior renovations. No public hearings or policy decisions are scheduled; the agenda consists entirely of administrative quick plan reviews.

architectural-reviewpermitsstaff-approvalshistoric-preservationbuilding-permits
Thu Feb 6, 2025

Home Ownership Initiative Commission

Home Ownership Initiative Commission to discuss 76 Lee Street update

The Home Ownership Initiative Commission is meeting to receive an update on 76 Lee Street and introduce new commission members. No other substantive business is scheduled.

housinghome-ownershipcommissionmeeting
Thu Feb 6, 2025

Technical Review Committee

Review of preliminary plat and road plans for 126-lot Point Hope subdivision

The Technical Review Committee will review a preliminary plat and road construction plans for the 126-lot Point Hope POD 4 Phase 1 on Clements Ferry Road. Other major items include a new free-standing emergency department on Clements Ferry Road, a proposed hotel at 860 Morrison Drive, and an early site package for a 102.8-acre future development. The committee also considers a concept plan for 95 townhomes on James Island and an expansion of the Rick Hendrick auto service center.

developmentsite-planssubdivisionshousingcommercialemergency-servicesroads
Thu Feb 6, 2025

Technical Review Committee

TRC reviews proposed free-standing emergency department on Clements Ferry Rd

The Technical Review Committee is reviewing 12 development applications, including site plans, subdivision plats, and concept plans. Items include a proposed free-standing emergency department at 5.8 acres on Clements Ferry Rd, a hotel at 860 Morrison Dr, and a 126-lot subdivision at Point Hope. Most applications received revision requests; no final decisions are made at this meeting.

site-planssubdivisionsdevelopment-reviewhotelemergency-departmentresidentialcommercialzoning
Thu Feb 6, 2025

Special Facilities

Special Facilities Committee to hear update and approve minutes

The Special Facilities Committee will hold a conference call meeting on February 6, 2025. The agenda includes approval of minutes from October 3, 2024, and an update from Special Facilities Director Romaine Heyward. No other substantive business is scheduled; this is a procedural meeting.

special-facilitiescommitteemeetingcharlestoncity-council
Thu Feb 6, 2025

Special Facilities

Special Facilities Committee meets for routine update

This is a procedural meeting of the Special Facilities Committee to approve prior minutes and receive an update from the Special Facilities Director. No specific projects, contracts, or financial decisions are listed on the agenda.

special-facilitiescommittee-meetingprocedural
Thu Feb 6, 2025

Resilience & Sustainability Advisory Committee

Committee to hear Climate Action Plan 2024 progress report

The committee will receive updates on sustainability and resilience initiatives, including the 2024 progress report on the Climate Action Plan, compost expansion, and recent grant awards. Resilience updates cover Army Corps partnerships and the Basin Flood Action Committee. The meeting also includes open discussion and a public comment period.

sustainabilityresilienceclimate-action-plancompostfloodingpublic-comment
Wed Feb 5, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals considers tree removal and buffer variance requests

The Charleston Board of Zoning Appeals will meet to consider three variance requests for tree removal and landscape buffers. One application has been withdrawn. The meeting will be held at 2 George Street.

zoningvariancetreesbufferbzacharleston
Wed Feb 5, 2025

Board of Zoning Appeals Site Design

Board of Zoning Appeals to review tree and landscape buffer variances

The Board of Zoning Appeals - Site Design will consider variance requests regarding tree removal and landscape buffers. One item regarding a road landscape buffer was withdrawn.

zoninglandscapingtreesvariances
Wed Feb 5, 2025

Board of Zoning Appeals Site Design

Board approves tree removal variance at 2079 Austin Avenue

The Board of Zoning Appeals approved a variance to remove two grand trees at 2079 Austin Avenue in Rosemont, subject to conditions including relocating palm trees and planting 53.25 caliper inches of native canopy trees. It also approved buffer reductions at 2080 Sam Rittenberg Boulevard near Citadel Mall. One application on Forrest Drive was withdrawn before the meeting.

zoningvariancestreeslandscape-bufferscharlestonboard-of-zoning-appeals
Wed Feb 5, 2025

Commission on History

Commission to consider marker for Frederick Deming Jr. Industrial School

The Charleston Commission on History will discuss and potentially approve a new state historical marker for the Frederick Deming Jr. Industrial School, to be placed at Deming Playground (1030 5th Avenue). The marker is sponsored by the Preservation Society of Charleston and honors an African American school founded in 1892 in the former Town of Maryville.

historyhistorical-markersschoolsafrican-american-historycharleston
Tue Feb 4, 2025

Board of Zoning Appeals Zoning

Board to consider restaurant parking variance at 158 Church St.

The Board of Zoning Appeals will review 11 new applications and deferred items, including variances for setbacks, special exceptions for non-conforming structures, and use variances. Key items include a restaurant with zero parking spaces (six required) at 158 Church St. and an expansion of a late-night bar within 500 feet of a residential zone at 472 Meeting St.

zoningvariancesspecial-exceptionsparkingrestaurantsetbacksboard-of-zoning-appeals
Tue Feb 4, 2025

Board of Zoning Appeals Zoning

Board to weigh restaurant with no parking at 158 Church St.

The Board of Zoning Appeals-Zoning will decide on several variance and special exception requests, including a restaurant at 158 Church St. that provides none of the required 6 parking spaces, and expansion of a late-night bar at 472 Meeting St. near residential zones. Other items involve a deck setback variance at 209 Wentworth St. and a vertical extension at 40 Piedmont Ave. The meeting also includes approval of prior minutes.

zoningvariancesspecial-exceptionsparkinglate-night-usecharleston
Tue Feb 4, 2025

Board of Zoning Appeals Zoning

Restaurant approved with no parking at 158 Church St.

The Board of Zoning Appeals made decisions on 11 variance and special exception requests. Approved items include a restaurant with zero parking spaces, a late-night bar expansion near residential zones, and a mobile home on an undersized lot. One deck variance was denied, and two items were deferred.

zoningvariancesspecial-exceptionsparkinglate-night-businessmobile-homesboard-of-zoning-appeals
Tue Feb 4, 2025

Board of Zoning Appeals Zoning

BZA to decide on cooking classes at 505 Folly Rd

The Board of Zoning Appeals – Zoning will hear three variance and special exception requests on February 4, 2025. Most notably, the board will consider a use variance to allow instructional cooking and food-tasting classes at 505 Folly Road, which has drawn 115 public comments, mostly in support. Other items include a side-setback variance for a deck at 209 Wentworth Street and a special exception to vertically extend a non-conforming structure at 40 Piedmont Avenue.

zoningboard-of-zoning-appealsvariancespublic-hearingcooking-classesharleston-villagewagener-terracejames-island
Mon Feb 3, 2025

Design Review Board

DRB will review two multi-family housing proposals and approve minutes

The Charleston Design Review Board will consider two development applications: a 2‑story affordable housing project with 11 units at 1890 Ashley River Rd., and a conceptual 4‑story multi‑family building with 61 units at Maybank Hwy. and Promenade Vista St. The board will also vote to approve the minutes from the December 2, 2024 meeting.

housingaffordable-housingdesign-reviewzoningminutes
Mon Feb 3, 2025

Design Review Board

DRB to consider preliminary approval for 11-unit affordable housing at 1890 Ashley River Rd.

The Design Review Board is reviewing a request for preliminary approval of a new 2-story, 11-unit affordable housing building at 1890 Ashley River Road. The project, proposed by the Charleston Redevelopment Corp., would be built on a vacant 0.34-acre parcel zoned CT (Commercial Transportation). The board will decide whether to grant preliminary approval for the design and site plan.

design-review-boardaffordable-housingmultifamilycharlestonpreliminary-approval
Mon Feb 3, 2025

Design Review Board

Board approves 61-unit apartment building on James Island

The Design Review Board granted conceptual approval for a 4-story, 61-unit multi-family building at Maybank Highway and Promenade Vista Street on James Island, with conditions. The board also gave preliminary approval for an 11-unit affordable housing building at 1890 Ashley River Road in West Ashley. Minutes from December and January meetings were approved.

design-reviewaffordable-housingmulti-familyjames-islandwest-ashleycharleston
Mon Feb 3, 2025

Design Review Board

Design Review Board staff reviews 23 commercial and residential permits

The Design Review Board staff is processing a series of quick plan reviews for various properties. These items include signage updates, building demolitions, and exterior renovations.

zoningdemolitionsignagecommercial-developmentrenovations
Mon Feb 3, 2025

Board of Architectural Review

Board of Architectural Review reviews 41 staff permit applications

The Board of Architectural Review is processing 41 staff-approved permit applications for residential and commercial projects across Charleston. The agenda includes reviews for exterior painting, roofing, demolition, and mechanical system upgrades.

charlestonbuildingpermitsarchitecturedemolitionroofingmechanicalcommercial
Thu Jan 30, 2025

Ad Hoc Rules Advisory Committee

Charleston council to discuss meeting start times and reorganize city departments

The Ad Hoc Rules Advisory Committee will discuss the start time of City Council meetings and review a package of ordinances to reorganize city departments, including the Municipal Court, Planning, and Public Service.

city-councilzoningmunicipal-courtbudgetpublic-serviceplanningminority-business
Thu Jan 30, 2025

Board of Architectural Review

Board will consider total demolition of the building at 534 King Street.

The Board of Architectural Review – Small will review minutes from the November 14, 2024, December 12, 2024, and January 9, 2025 meetings. It will consider a series of applications involving alterations, demolitions, and new construction in historic districts, including a total demolition request for 534 King Street. Other items include elevation changes at 63 Ashley Avenue, demolition of a garage at 1138 King Street, and various conceptual approvals for additions and new dwellings.

historic-districtdemolitionrenovationnew-constructionarchitectural-review
Thu Jan 30, 2025

Board of Architectural Review

Board to review historic home elevation permit

The Board of Architectural Review will consider a permit for a 63 Ashley Avenue home to be elevated 12 inches above the Base Flood Elevation. The request includes removing non-historic features and repairing siding and railings. The meeting will also include the approval of previous meeting minutes.

historic-preservationzoningflood-elevationcharlestonboard-of-architectural-reviewharleston-village
Thu Jan 30, 2025

Board of Architectural Review

BAR approves demolition of 534 King Street building over historic objections

The Board of Architectural Review – Small approved demolition of a building at 534 King Street in the Old and Historic District, despite staff recommendation for deferral and public comments about its significance to African American and Jewish heritage. Other actions included conceptual approval to elevate a house at 63 Ashley Avenue, approval of garage demolition at 1138 King Street, and deferrals for roof demolitions at 40 Piedmont Street and 287 Ashley Avenue. Minutes from previous meetings were approved or deferred.

architectural-reviewhistoric-districtdemolitionfloodplaincharlestonpreservation
Thu Jan 30, 2025

Board of Architectural Review

Board will consider demolition of 534-538 King Street building

The Board of Architectural Review – Small will review seven applications covering conceptual elevation, repairs, and multiple demolition requests in historic districts. The most prominent item is a total demolition request for 534‑538 King Street, which has attracted 22 public comments. Other items include a 12‑inch elevation request for 63 Ashley Avenue and demolition proposals for several historic homes and a garage. The board will record and summarize any written comments submitted in advance of the meeting.

historic-preservationdemolitionarchitecturezoningpublic-comments
Wed Jan 29, 2025

Tourism Commission

Subcommittee to review film guidelines and special events ordinance

The Tourism Commission's Quality of Life Subcommittee will discuss proposed revisions to the Film and Photography Guidelines and an amendment to the Special Events Ordinance. No final action is guaranteed; the meeting is for discussion only.

tourismfilmphotographyspecial-eventsordinancepublic-commentcharleston
Wed Jan 29, 2025

Special Events Committee

Special Events Committee to discuss upcoming festivals, parades, and concerts

The Special Events Committee is meeting to discuss various event applications for the Peninsula and Daniel Island areas. The agenda includes a mix of commercial filming, public festivals, and stadium concerts.

special-eventsfestivalsparadespublic-safetytourism
Wed Jan 29, 2025

Special Events Committee

Charleston Special Events Committee approves Volvo shoots, Dragon Boat, 2nd Sunday on King

The committee is reviewing and voting on a series of special event permits. They receive updates on the canceled Half Marathon and the MLK Parade after-action report. Several applications are approved with conditions, while the Teddy Bear Picnic and The Citadel parade are tabled pending further details.

special-eventspermitsfestivalscommercial-filmingparadesparkingsafety
Tue Jan 28, 2025

City Council

Council to consider funding Lowline Project Phase I construction

The City Council will hold public hearings and vote on several ordinances, including second readings for rezonings and annexations. Key items include a proposed commitment to fund Phase I of the Lowline Project, a contract amendment for the Lockwood Drive knee wall, and updates to tobacco store zoning rules. Several items are deferred from previous meetings.

zoningtransportationparkspublic-workscontractsartsannexationbudget
Tue Jan 28, 2025

City Council

Council to approve $15,800 contract amendment for USCG wave impact study

The Ways and Means Committee will consider several financial actions, including approving a contract amendment of $15,800 with JMT for a U.S. Coast Guard wave‑impact assessment. It will also discuss funding commitments for the Lowline Project Phase I, accept multiple arts and beautification grants, and approve a lease of 108 Meeting Street for city offices.

budgetcontractsartshousingwaste-management
Tue Jan 28, 2025

Traffic and Transportation Committee

Committee will consider funding for Lowline Phase I project

The Traffic & Transportation Committee will consider authorizing funding for Phase I of the Lowline project, as requested by Mayor Cogswell. The committee will also vote on a license agreement allowing the State Ports Authority parking lot to be used for food and beverage service employees. Additional items include a resolution supporting the Better North Bridge USDOT grant, a discussion on golf carts on multi‑use paths, an amendment restricting bicycles on the Battery Seawall, and a request to raise daily parking meter bag fees from $18 to $27.

lowlinefundingparkinggrantbicyclesfeestransportation
Tue Jan 28, 2025

Audit Committee

Audit Committee reviews 2024 audit results and 2025 plan

The Audit Committee will discuss department highlights, challenges, and the 2024 audit reviews, including a report that only 46% of planned audits were completed. The committee will also consider the proposed 2025 audit plan and timeline. The agenda includes updates on six completed audits and several postponed or cancelled items.

auditcity-councilfinanceinternal-auditmeeting
Mon Jan 27, 2025

Design Review Board

Design Review Board considers exterior painting at 718 Wappoo Rd

The Design Review Board is reviewing a staff approval request for a residential property. The applicant seeks to change the exterior paint color from peach-beige to classic white with light blue tones.

design-reviewpaintingresidential
Mon Jan 27, 2025

Public Works and Utilities Committee

Public Works Committee to consider $398,050 Barberry Woods contract amendment

The committee will discuss and potentially approve a $398,050 contract amendment for the Barberry Woods stormwater project, along with wetland mitigation credits. Other items include acceptance of easements for a cluster development, temporary encroachment approvals, and a $15,800 contract amendment for a wave assessment near Lockwood Drive. No public hearings or old business are scheduled.

public-worksutilitiesstormwatercontractseasementsencroachmentsbarberry-woods
Mon Jan 27, 2025

City Council

City Council committee to vote on 108 Meeting St lease for offices

The Committee on Real Estate will consider approving a lease of 108 Meeting Street from Historic Charleston Foundation for city offices, a fifth amendment extending the option to ground lease F Street for affordable housing, a mortgage accommodation for the Gibbes Museum, an extension of the Lowcountry Senior Center lease, and seven annexation requests in West Ashley.

real-estateleaseannexationaffordable-housinghistoric-preservation
Mon Jan 27, 2025

Board of Architectural Review

Verizon seeks approval to add or replace rooftop antennas at 24 N Market St

The Board of Architectural Review will consider staff approvals for 32 quick‑plan review permits. Items include residential full‑renovations, commercial interior upgrades, electrical and mechanical work, a Verizon communication‑tower antenna project, and other minor construction requests. The Board will decide whether to grant these BAR staff approvals.

building-permitsrenovationcommercialresidentialcommunicationsroofing
Thu Jan 23, 2025

Technical Review Committee

Committee reviews 110-unit townhome development and other projects

The Technical Review Committee will review preliminary plats, site plans, and road construction plans for several developments, including a 110-unit townhome project at 1730 Clements Ferry Rd and a 209-unit continuing care facility at 625 King St. Other items include a demolition/rebuild at 2031 King St Ext, a 7-lot subdivision at 806 Magnolia Rd, and a 103-unit phase of Long Savannah Neighborhood. All reviews are conducted electronically via Zoom.

zoningplanningdevelopmentsite-planssubdivisionstownhomescontinuing-careroad-construction
Thu Jan 23, 2025

Technical Review Committee

TRC reviews 110-unit townhome and 103-unit subdivision plans

The Technical Review Committee will review five development proposals, including two large residential projects. The 110-unit Point Hope Townhomes at 1730 Clements Ferry Rd and the 103-lot Long Savannah Neighborhood 9 Phase 1 at 390 Barons Dr are both in 'revise and return' or 'open pending' status. Also on the agenda are a demolition/rebuild at 2031 King St Ext, a 209-unit continuing care facility at 625 King St, and a 7-lot subdivision at 806 Magnolia Rd.

technical-review-committeesite-planssubdivisionszoninghousingdevelopmentcharleston
Thu Jan 23, 2025

Board of Architectural Review

Charleston BAR-S January 23 meeting cancelled due to weather

The Board of Architectural Review – Small meeting scheduled for January 23, 2025 has been cancelled because of weather conditions. The agenda included 16 applications for demolition, renovation, and new construction in historic districts. Check the city website for updates on rescheduled hearings.

board-of-architectural-reviewcancellationhistoric-preservationdemolitioncharlestonweather
Thu Jan 23, 2025

Board of Architectural Review

Board of Architectural Review to consider three demolition requests

The Board of Architectural Review - Small is meeting to review applications for the demolition of structures or portions of structures at three different properties. The board will also vote on the approval of minutes from three previous meetings.

demolitionhistoric-preservationzoning
Wed Jan 22, 2025

Special Events Committee

Committee to discuss large 2025 events including bridge run and King Street Sunday

The Special Events Committee will meet via Zoom to discuss and decide on permits for multiple 2025 events. Agenda items include approvals of previous minutes, updates from the Special Event Manager, and discussions on events with and without applicants present. Key decisions involve commercial film shoots, festivals, parades, and concerts with attendances ranging from 75 to 50,000.

special-eventspermitsfestivalsconcertsparadespublic-hearingspeninsuladaniel-island
Tue Jan 21, 2025

Design Review Board

DRB to review 5 staff-level quick plan approvals

This Design Review Board agenda consists solely of 5 quick-plan-review permits already approved by staff. Items include a temporary jobsite trailer, an office renovation, a grease interceptor, a shopping center addition, and a sign refacing. No board-level public hearings or policy decisions are scheduled.

design-review-boardpermitscommercial-renovationsignstaff-approvalsquick-plan-review
Tue Jan 21, 2025

Public Safety Committee

Committee to approve $3,000 Kennedy Center grant for underage drinking enforcement

The Public Safety Committee will consider approving the police department’s request to apply for a $3,000 Ernest E. Kennedy Center Alcohol Enforcement Team grant. The meeting also includes a presentation on alternative locations for Fire Station 20, with possible staff acquisition and condemnation, and a police department update from Chief Walker. Routine items such as approving the November 20, 2024 minutes, a moment of silence, and adjournment are also on the agenda.

policegrantunderage-drinkingfire-stationpublic-safety
Tue Jan 21, 2025

City Council

City Council hears updates from federal and state lobbyists

This is a workshop meeting where the Charleston City Council will receive presentations and updates from the city's federal lobbyists (Thorn Run Partners) and state lobbyists (Parker Poe). Councilmembers will then have the opportunity to ask questions and discuss the information. No formal votes or decisions are scheduled.

council-workshopfederal-lobbyingstate-lobbyingcity-councilcharleston
Tue Jan 21, 2025

Board of Architectural Review

Board of Architectural Review staff review 21 property modification requests

The Board of Architectural Review staff processed 21 quick plan reviews for residential and commercial properties. The requests include interior renovations, exterior painting, and structural modifications.

zoningarchitecturecommercial-developmentresidential-renovationpermits
Tue Jan 21, 2025

Board of Zoning Appeals Zoning

January 21 Board of Zoning Appeals meeting cancelled due to weather

The Board of Zoning Appeals meeting scheduled for January 21, 2025, was cancelled due to inclement weather forecasts. The original agenda included several requests for zoning variances and special exceptions.

zoningvariancesparkingland-usecharleston
Tue Jan 21, 2025

Board of Zoning Appeals Zoning

Board to decide on deck variance, extension for 150-unit project, and building height exception

The Board of Zoning Appeals-Zoning will hear three applications: a variance to build a deck at 209 Wentworth St with reduced side setback and increased lot occupancy; a request for a fourth one-year extension of a vested right for a 150-unit accommodations use at 245 Huger St; and a special exception to vertically extend a non-conforming building at 20 Maranda Holmes St. The board may approve, deny, or defer each item after a public hearing.

zoningvariancesspecial-exceptionsvested-rightspublic-hearingcharleston
Fri Jan 17, 2025

Commission on Disability Issues

Commission to develop plan for full ADA compliance of city facilities

The Mayor’s Commission on Disability Issues will approve or edit the list of ADA compliance items created in December 2024, then discuss and prioritize those issues for city facilities. The commission will also receive a report on planning for the July 2025 Celebration Event and a report from the ADA Coordinator. Public comment will be limited to two minutes per speaker, and the meeting will conclude with announcements and scheduling of the next session.

disabilityadacity-facilitiespublic-commentplanning
Thu Jan 16, 2025

Colonial Common and Ashley River Embankment Commission

Colonial Common Commission to review lake replanting and park reports

The commission will receive a progress report from city staff and discuss the Colonial Lake Replanting project. The meeting also includes reports on various park events and volunteer opportunities.

parksenvironmentcommunity-eventsvolunteering
Thu Jan 16, 2025

Technical Review Committee

Technical Review Committee to review 18 site and subdivision plans

The Technical Review Committee is reviewing various site plans, subdivision concept plans, and road construction plans. The body is evaluating proposals for residential, commercial, and industrial developments across the Peninsula, West Ashley, Cainhoy, and Johns Island.

zoningsite-planssubdivisionshousingcommercial-development
Thu Jan 16, 2025

Technical Review Committee

TRC will review the Magnolia PUD Phase 1B preliminary plat for 58.95 acres at 40 Braswell St.

The Charleston Technical Review Committee will consider a series of site‑plan and subdivision applications during its Jan. 16, 2025 meeting. Items include a PUD master plan for The Wedge, mixed‑use and residential projects, and road‑construction plans for future development. The committee will evaluate each proposal against required board approvals and zoning criteria.

zoningdevelopmentplanningsubdivisionspudmixed-useinfrastructure
Thu Jan 16, 2025

Livability Review Board

Board to review vacant structures at 62 Hanover St. and 92 Queen St.

The Livability Review Board will hold a hearing to review the status of vacant structures at 62 Hanover St. (Eastside, c. 1872) and 92 Queen St. (Harleston Village, c. 1870). Staff will also provide updates on properties previously before the board.

vacant-structureslivability-review-boardhistoric-propertieseastsideharleston-villagecharleston
Wed Jan 15, 2025

Planning Commission

Planning Commission to consider Maybank Landing subdivision and six rezoning requests

The Planning Commission will vote on minutes from previous meetings, review a subdivision request to modify Hollydale Court and extend Reva Ridge Drive for seven existing lots at Maybank Landing on Johns Island, and consider six applications to rezone parcels from county to city single-family residential designations (SR-1, SR-2, SR-6). Staff will also provide an update on the Zoning Code Rewrite.

zoningsubdivisionplanning-commissionresidentialcharlestonzoning-code-rewrite
Wed Jan 15, 2025

Planning Commission

Planning Commission to review subdivision and zoning requests

The Planning Commission will consider a subdivision modification on Johns Island and six separate residential zoning requests. The body will also receive an update from City staff regarding the Zoning Code rewrite.

zoningsubdivisionresidentialland-use
Wed Jan 15, 2025

Planning Commission

Planning Commission approves Maybank Landing subdivision road modifications

The Charleston Planning Commission approved the minutes from the December 18, 2024 meeting. It approved a request to modify Hollydale Court and extend Reva Ridge Drive within the Maybank Landing subdivision on Johns Island (approximately 14.87 acres). The commission also approved zoning changes for several parcels, converting them to single‑family residential designations in West Ashley, Cainhoy, and James Island.

zoningsubdivisionroadsplanningdevelopment
Tue Jan 14, 2025

City Council

Council to vote on $7.565M Clements Ferry land purchase

The council will vote on a $7.565 million land purchase on Clements Ferry Road and a $5.875 million drainage project in Barberry Woods. Other major items include a $1.29 million contract for Fort Pemberton park improvements and $3 million in brick arch repair contracts. The meeting also includes recognition of officials, approval of committee appointments, and several annexation requests.

stormwaterpublic-worksland-acquisitionannexationcontractsparkspolice
Tue Jan 14, 2025

City Council

City Council to vote on $5.9M Barberry Woods drainage project

The Committee on Ways and Means will consider approving a $5,875,000 construction contract for Barberry Woods drainage improvements and a $1,287,263 contract for Fort Pemberton park access upgrades. Other stormwater items include change orders for the Low Battery Seawall repairs totaling over $972,000 and multiple brick arch service contracts. The committee also reviews real estate transactions, including a $7,565,000 land acquisition on Clements Ferry Road and several annexations.

stormwaterparkspoliceconstructionreal-estategrantsannexation
Mon Jan 13, 2025

Design Review Board

Design Review Board staff approves 10 quick plan reviews

The Design Review Board staff is reviewing 10 items under its quick plan review process, including a communication tower antenna addition, a new carwash on Clements Ferry Road, and various commercial mechanical replacements and signage. No public hearings or ordinances are on the agenda; all items are staff-level approvals.

design-reviewcommercialsignstelecommunicationscarwash
Mon Jan 13, 2025

Board of Architectural Review

BAR staff approves 56 quick-plan reviews for January 13-17

The Board of Architectural Review staff reviewed and approved 56 quick-plan permit applications for properties in Charleston's historic districts. Items range from routine repairs and HVAC replacements to new construction and conceptual approval for the American Gardens Park Project. No public hearings or new policy decisions are on this agenda.

historic-districtbuilding-permitsconstructionarchitectural-reviewcharlestonquick-plan-review
Thu Jan 9, 2025

Human Affairs and Racial Conciliation Commission

Commission will approve minutes and discuss updates and open topics

The Human Affairs and Racial Conciliation Commission will approve the minutes from the 12/12/2024 meeting, receive manager updates, and review old business items such as the annual report, Human Relations Council, and subcommittee updates. The meeting also includes a public comment period, chairperson comments, and an open discussion segment.

human-affairsracial-conciliationpublic-commentcity-government
Thu Jan 9, 2025

Technical Review Committee

TRC to review 55-unit affordable housing at 678 King Street

The Technical Review Committee will review 13 site plans, subdivision concepts, and road construction projects. Items include a proposed 55-unit affordable housing development (Lowline Apartments) at 678 King Street, a 72-unit townhome project at 3030 Maybank Highway, and a stormwater masterplan for Charleston Executive Airport. Multiple items are follow-up reviews after previous submissions.

zoninghousingtransportationinfrastructureaffordable-housingstormwatersite-plan-review
Thu Jan 9, 2025

Technical Review Committee

TRC reviews Charleston Executive Airport Stormwater Masterplan (699 acres)

The Technical Review Committee will evaluate 13 site‑plan and development applications, providing revisions, returns, or pending status based on stormwater comments. Items include a stormwater masterplan for the airport, a new Ronald McDonald House building, affordable housing at Lowline Apartments, a multi‑family townhome project on Maybank Highway, and road extensions on Daniel Island. The committee will note which projects require further information before approval.

stormwaterhousingroadsdevelopmentplanningzoning
Thu Jan 9, 2025

Board of Architectural Review

Board of Architectural Review to review 15 property applications

The Board of Architectural Review – Small is meeting to consider various applications for demolitions, new constructions, and renovations. The board will review conceptual approvals for residential and mixed-use projects and hear two appeals of staff decisions.

zoninghistoric-preservationdemolitionhousingarchitecture
Thu Jan 9, 2025

Board of Architectural Review

Board to decide on partial demolition at 309 Grove Street

The Board of Architectural Review - Small will consider a request for partial demolition of an existing structure at 309 Grove Street, including removal of seven windows, one door, and portions of the roof. The board will also approve minutes from two prior meetings.

bardemolitionhistoric-preservationcharleston
Thu Jan 9, 2025

Board of Architectural Review

Board of Architectural Review - Small decides on demolition and new construction

The Board reviewed several applications for residential demolitions, new constructions, and additions. Decisions included approving a partial demolition at 309 Grove Street and denying a complete demolition of an accessory structure at 519 Rutledge Avenue.

zoningdemolitionhistoric-preservationhousingarchitecture
Thu Jan 9, 2025

Board of Architectural Review

BAR-S to review new affordable housing unit at 16 Hagood Avenue

The Board of Architectural Review – Small (BAR-S) will hear 15 applications on January 9, 2025, including requests for demolitions, new construction, additions, and two appeals of staff decisions. The meeting includes public comments submitted in advance and will consider a new 2.5-story affordable housing residential unit at 16 Hagood Avenue.

historic-preservationdemolitionnew-constructionaffordable-housingpublic-hearingarchitectural-reviewappeals
Wed Jan 8, 2025

Special Events Committee

Special Events Committee to discuss large-scale events including SEWE festival and three Credit One Stadium concerts

The committee will discuss special event permit applications for 2025, including several large gatherings. Items include the Southeastern Wildlife Exposition (SEWE) with 40,000 attendees, the Charleston Wine + Food Culinary Village, and concerts by Widespread Panic, Keith Urban, and Avril Lavigne at Credit One Stadium. The meeting also includes approval of prior minutes and an update on the Emancipation Day program.

special-eventsconcertsfestivalsevent-permitsstreet-closurescharleston
Wed Jan 8, 2025

Special Events Committee

Committee conditionally approves SEWE festivals with safety conditions after New Orleans attack

The Special Events Committee conditionally approved two Southeastern Wildlife Exposition (SEWE) events and Charleston Wine+Food's Culinary Village, adding conditions on parking, accessibility, and security. Following recent events in New Orleans, the committee discussed enhanced safety measures for park events, including requiring officers at park events. Several items were tabled or approved with conditions, such as the WLI Parade and Rock The Block.

special-eventsfestivalsparadessafetyparkingaccessibilityconcerts
Wed Jan 8, 2025

Board of Architectural Review

BAR-L reviews large special needs housing for Ronald McDonald House

The Board of Architectural Review–Large is considering three applications: a sample panel for a MUSC complex (withdrawn by staff), preliminary approval for a new 41,500 sqft, 5-story special needs housing development for Ronald McDonald House at 81 Gadsden Street, and conceptual approval for a new storefront at 348 King Street. The site visit scheduled for January 7 has been cancelled.

architectural-reviewzoninghousingspecial-needsronald-mcdonald-housecharleston
Wed Jan 8, 2025

Board of Architectural Review

BAR to review preliminary plans for Ronald McDonald House development

The Board of Architectural Review will consider preliminary approval for a new 41,500 sqft, 5-story special needs housing development at 81 Gadsden Street. The project includes a bridge connecting the new structure to the existing Ronald McDonald House.

zoninghousingarchitecturespecial-needs-housing
Wed Jan 8, 2025

Board of Architectural Review

Board approves preliminary plans for Ronald McDonald House housing development

The Board of Architectural Review reviewed applications for new construction and storefront modifications. The board granted preliminary approval for a special needs housing project and conceptual approval for a storefront redesign.

zoninghousingarchitecturecommercial-development
Wed Jan 8, 2025

Board of Architectural Review

BAR-L to review 5-story Ronald McDonald House at 81 Gadsden St

The Board of Architectural Review – Large is considering two applications: preliminary approval for a 41,500 sqft, 5-story special needs housing development for Ronald McDonald House at 81 Gadsden Street, and conceptual approval for a new storefront and vestibule at 348 King Street. A public comment opposing the scale of the Gadsden Street project has been submitted.

architectural-reviewbar-lnew-constructionspecial-needs-housinghistoric-districtcharleston
Tue Jan 7, 2025

Board of Zoning Appeals Site Design

Board to hear variance for grand tree removal at 2201 Heriot Street

The Board of Zoning Appeals – Site Design will consider three new applications: variances and a special exception for grand tree removal, and a reduced landscape area request. One application for removal of 29 grand trees on Johns Island is listed as deferred. The board will also review minutes from the December 4, 2024 meeting.

zoningvariancestree-removallandscapepublic-hearingcharleston
Tue Jan 7, 2025

Board of Zoning Appeals Site Design

Board to consider variance for removal of 20 grand trees on Johns Island

The Board of Zoning Appeals will hold public hearings on four requests for variances and special exceptions from tree preservation and landscape area requirements. Items include tree removals at several properties and a reduced landscape area in Cannonborough/Elliottborough.

zoningtree-removalvariancesspecial-exceptionslandscaping
Tue Jan 7, 2025

Board of Zoning Appeals Site Design

Board approves three variance requests, defers large tree removal on Johns Island

The Board of Zoning Appeals Site Design met on January 7, 2025 and approved three variance requests related to tree removals and landscape modifications, with conditions including replacement tree planting and fees. A request to remove 29 grand trees on Hollydale Court on Johns Island was deferred prior to the meeting.

board-of-zoning-appealstree-removalvarianceshabitat-for-humanitylandscapecharlestonjohns-island
Mon Jan 6, 2025

Design Review Board

Design Review Board to consider 72-unit townhome community on Johns Island

The Design Review Board will meet on January 6, 2025, at 4:30 p.m. to consider three applications: full demolition of eight structures (some over 50 years) and conceptual/preliminary approval for a 72-unit townhome community at 3030 Maybank Hwy; and conceptual approval for an 11-unit affordable housing building with a separate office space for lease at 1890 Ashley River Rd. The board will also vote on the minutes from its December 2, 2024 meeting.

design-reviewdemolitiontownhomesaffordable-housingjohns-islandwest-ashleycharleston
Mon Jan 6, 2025

Design Review Board

Board reviews demolition and multi-family development plans

The Design Review Board will consider approval for the demolition of several buildings over 50 years old at 3030 Maybank Hwy. The board will also review conceptual plans for a new multi-family development with 72 units at the same location.

zoningdemolitionhousingdevelopmentplanningmaybank-hwy
Mon Jan 6, 2025

Design Review Board

DRB approves demolition and townhome plans on Johns Island

The Design Review Board approved the demolition of eight structures at 3030 Maybank Hwy and granted conceptual approval for a 72-unit townhome community on the same property. The board also approved conceptual approval for an affordable housing building with 11 units at 1890 Ashley River Rd.

zoninghousingdemolitioncharlestonaffordable-housingdesign-review
Mon Jan 6, 2025

Design Review Board

Design Review Board staff reviews 17 commercial and residential projects

The Design Review Board staff is processing quick plan reviews for various commercial renovations, signage, and new constructions. These reviews include a mix of small-scale repairs and larger developments such as affordable housing.

zoningcommercial-developmentaffordable-housingsignageconstruction
Mon Jan 6, 2025

Board of Architectural Review

BAR staff reviews 46 routine architectural permits

The Board of Architectural Review Staff is approving 46 quick-plan-review applications for work in Charleston's historic districts, including painting, roofing, new construction, and commercial alterations. All items are staff-level approvals; no public hearing is listed.

historic-preservationarchitectural-reviewpermitsbuilding-constructioncharleston