The Boring PartsFederalLocal · USLocal · Canada
Chicopee, MA

Chicopee public meetings in 2023

203 substantive meetings from 2023, with official agendas or minutes and plain-English summaries.

Thu Dec 21, 2023

License Commission

License Commission to review new eatery licenses and 2024 renewals

The Chicopee License Commission is meeting to consider several new and transferred common victualer (food service) licenses, including for McKinstry Gardens, Petro's, Doc's Place, and Exquisite Cafe. The board will also review 2024 license renewals, noting that some businesses have closed and others owe taxes or lack certificates of inspection. The agenda includes a large list of establishments for renewal across various license categories.

licensesfood-servicealcoholrenewalspublic-hearing
Wed Dec 20, 2023

City Council - Zoning Committee

Chicopee Zoning Committee to consider deleting language on motor vehicle storage

The Zoning Committee will discuss and possibly vote on an ordinance amendment to delete language from Chapter 275-51 regarding the storage of inoperable or unregistered motor vehicles. The committee will also review minutes from its November 29 meeting. The meeting is scheduled for 6:30 PM on December 20, 2023, in the Council Chambers at City Hall Annex.

zoningordinance-amendmentmotor-vehiclespublic-hearingchicopee
Wed Dec 20, 2023

Conservation Commission

Conservation Commission to hear flood control extension and Szot Park PCB soil removal

The Chicopee Conservation Commission will hold a public hearing on December 20, 2023, to discuss two main items: an extension of conditions for continued flood control system maintenance, and a notice of intent for removing PCB-impacted soils at Szot Park. The meeting also includes approval of prior minutes, signing bills, and updates on enforcement orders and erosion control.

conservationwetlandsflood-controlpcb-removalparkserosionpublic-hearing
Wed Dec 20, 2023

Retirement Board

Chicopee Retirement Board holds regular monthly meeting

The Chicopee Contributory Retirement System will hold a regular meeting to conduct routine board business. The agenda includes approving previous minutes, expense warrants, and various retirement-related applications.

retirementgovernment-administrationpersonnelchicopee
Tue Dec 19, 2023

City Council - Mayor's Briefing

Mayor briefs City Council on various fund appropriations and donations

The Mayor will brief the City Council regarding several Mayoral Orders for fund appropriations and the acceptance of donations. These items include funding for library salaries, public works accounts, and human resources expenses.

budgetpublic-workslibraryhuman-resourcessenior-services
Tue Dec 19, 2023

Board of Registrars

Board of Registrars to review November registration stats and 2024 calendar

The Chicopee Board of Registrars of Voters is holding a regular meeting to approve minutes, review November registration statistics, and discuss correspondence and new business including the 2024 calendar and a computer system update from the Secretary of State. The agenda is largely procedural, with no major policy decisions or public hearings listed.

electionsvoter-registrationpassportscity-clerkmeeting
Tue Dec 19, 2023

City Council

Chicopee Council to vote on $286,600 for roads, $150,000 safety, and more

The Chicopee City Council will consider several mayoral appropriations from the Stabilization Fund, including $286,600 for roads and sidewalks, $150,000 for safety improvements, and smaller amounts for library salaries, wastewater and water claims, and HR expenses. They will also vote on accepting donations and grants, including $19,000 for the library and $7,369 for the Council on Aging, and approve numerous 2024 license renewals for auto dealers, repair shops, and other businesses.

budgetroadssafetydonationslicensesappointments
Wed Dec 13, 2023

Golf Commission

Golf Commission to discuss 2024 fees, liquor license, concession contract

The Chicopee Golf Commission will meet on December 13, 2023, at 6:00 p.m. at the Chicopee Country Club. The agenda includes routine items like minutes approval and reports, plus new business on 2024 golf fees, liquor license renewal, and a concession contract. Old business covers updates on tree planting, the 12th hole green, cart path RFP, and maintenance contracts.

golffeesliquor-licenseconcessionsmaintenance
Wed Dec 13, 2023

Parks Commission

Parks Commission reviews dam removal, pool projects, and new sidewalk machine request

The Chicopee Parks and Recreation Commission is meeting to approve bills, hear public input, and receive maintenance and recreation reports. Old business includes ongoing construction on the Bemis Pond Dam Removal, the Open Space and Recreation Plan Renewal, and design work on the Sarah Jane Splash Pad. New business includes an appropriation request for a sidewalk machine and a review of park rules and ordinance updates.

parksrecreationdam-removalsplash-padbudgetmaintenanceordinance
Wed Dec 13, 2023

Zoning Board of Appeals

ZBA to hear variance request for new lot at 371 East St.

The Chicopee Zoning Board of Appeals will hold a public hearing on December 13, 2023, to consider a variance request to reduce frontage from 100 to 60 feet to create a new single-family lot at 371 East St. The agenda also includes approval of prior meeting minutes, discussion of old/new business, and adjournment.

zoningvariancepublic-hearinghousing
Tue Dec 12, 2023

City Council - Ordinance Committee

Ordinance Committee to discuss vehicle size, doxing, and parking restrictions

The Ordinance Committee is reviewing proposals for new city ordinances and amendments to existing codes. The meeting includes requests for public hearings on vehicle size on private property, doxing, and truck signage.

zoningparkingordinancespublic-safetytrash-collection
Tue Dec 12, 2023

City Council - Human Resources Committee

Human Resources Committee considers mayoral appointments

The Human Resources Committee will meet to review two mayoral appointments and the minutes from September 28, 2023. The committee is considering members for the Planning Board and the Housing Authority.

appointmentsplanning-boardhousing-authoritygovernment-administration
Tue Dec 12, 2023

Historical Commission

Historical Commission discusses Belcher School redevelopment and church rights

The Commission will hear a presentation regarding the redevelopment of the former Belcher School into apartments. Members will also receive updates on the Assumption Church Rectory, Holy Name Church, and the Edward Bellamy House.

housinghistoric-preservationredevelopmentgovernment-updates
Thu Dec 7, 2023

Planning Board

Planning Board to review frontage waiver for 371 East St

The Chicopee Planning Board will hold a public hearing to consider a frontage waiver and a lot release. The board will also review minutes from the November 2, 2023 meeting.

zoningland-useresidential-development
Tue Dec 5, 2023

City Council - Mayor's Briefing

Mayor briefs City Council on several fund appropriations and a Planning Board appointment

The Mayor will brief the City Council on several Mayoral Orders and provide general city updates. The discussion focuses on transferring funds from the Stabilization Fund to various departments and accepting grants and donations.

budgetappointmentsgrantssenior-servicespublic-safety
Tue Dec 5, 2023

City Council

Mayor proposes $535,212.74 in fund transfers and accepts $33,906.15 in grants and donations

The Chicopee City Council will review a series of Mayoral Orders to transfer funds between city accounts, primarily from the Stabilization Fund to public works and library salaries. The Council is also scheduled to accept several grants and donations, including a $19,000 gift to the Public Library and a $7,369 grant for the Council on Aging. These items are presented for consideration at the December 19, 2023 meeting.

budgetpublic-workslibrarysenior-servicesfinance
Mon Dec 4, 2023

Library

Library trustees to hear November financial and usage reports

The Board of Trustees will review the November 2023 financial report and the director's report on library statistics including circulation, computer usage, and programs. New business includes a report on a meeting with ListenTech and Valley Communications, and publicity plans for a Tactile Images display.

libraryfinancial-reportstatisticspublicity
Mon Dec 4, 2023

City Council - Public Safety Committee

Council to review fatal Chicopee Street crashes and James/Montcalm intersection

The Public Safety Committee will hear from the Chief of Police about the causes of fatal pedestrian and vehicle accidents on Chicopee Street, and will hold a public hearing on the James Street and Montcalm Street intersection. The committee will also approve minutes from August 15, 2023, and adjourn.

public-safetytrafficpolicepublic-hearing
Wed Nov 29, 2023

City Council - Zoning Committee

Zoning Committee to weigh beer/wine permit, mixed-use, zone change

The Chicopee Zoning Committee will hold a public meeting to consider three applications: a special permit for beer and wine sales at a restaurant, a special permit to create a residential unit in a business building, and a zone change for a Boys & Girls Club property. The committee will also review minutes and adjourn.

zoningspecial-permitalcoholhousingzone-change
Tue Nov 28, 2023

City Council - Public Works Committee

Chicopee council to discuss traffic safety on Chicopee Street, street acceptance

The Public Works Committee will discuss traffic safety measures on Chicopee Street, including yield signs, speed limit corrections, and speed tables. They will also consider accepting 61 Everett Street as a city street and review prior meeting minutes. The meeting is scheduled for November 28, 2023, at 6:30 PM in Council Chambers and via Zoom.

traffic-safetystreetspublic-workspedestrian-safetyspeed-limits
Mon Nov 27, 2023

City Council

City Council to hold tax classification hearing and set tax rate

The Chicopee City Council will hold a special meeting to conduct a tax classification hearing and set the tax rate. This is a routine annual procedure where the council decides how to distribute the property tax burden among different classes of property.

taxesbudgetcity-council
Tue Nov 21, 2023

City Council - Mayor's Briefing

Mayor briefs City Council on appropriations and donations

The Mayor will brief the City Council on three mayoral orders and provide general city updates. The council will consider funding for water department expenses and the acceptance of donations for the library and Council on Aging.

budgetdpwlibrarysenior-servicesdonations
Tue Nov 21, 2023

Board of Registrars

Board of Registrars to review voter registration stats and 2024 Census prep

The Board of Registrars is holding a regular meeting to approve prior minutes, review October voter registration statistics, and discuss new business including nomination papers, passport annual certification, a state voter registration system upgrade, and 2024 Census preparations. The agenda is largely procedural and administrative.

electionsvoter-registrationcensuspassportsadministration
Tue Nov 21, 2023

Board of Registrars

Chicopee election board to review registrations, census prep

The Board of Registrars of Voters is holding a regular meeting to approve minutes, review registration statistics, and discuss nomination and petition papers. They will also address the Secretary of State's VRIS system upgrade and preparations for the 2024 Census.

electionsvoter-registrationcensustechnologymeeting
Mon Nov 20, 2023

City Council - License Committee

License Committee to review two home occupation license applications and ordinance

The Chicopee City Council License Committee is meeting to consider two applications for home occupation licenses: one for a cake and cupcake business at 120 Applewood Drive, and one for administrative tasks in a home office at 156 Pendexter Avenue. The committee will also review the Home Occupation License ordinance, approve minutes from October 2, 2023, and adjourn. This is a routine licensing and administrative meeting with no major policy decisions expected beyond the ordinance review.

licenseshome-occupationordinance-reviewcity-councilchicopee
Thu Nov 16, 2023

License Commission

License Commission hears multiple license applications and 2024 renewals

The Chicopee License Commission is meeting to conduct hearings on several establishments, consider new license applications, and review 2024 license renewals. The agenda includes public input, minutes, and administrative items such as filing fees and police reports.

licensesalcoholfood-permitspublic-hearingsrenewals
Wed Nov 15, 2023

Conservation Commission

Conservation Commission to hear Michelin demolition NOI at 154 Grove St.

The Chicopee Conservation Commission will hold a public hearing on November 15, 2023, to discuss a Notice of Intent for demolition and hazardous material removal at 154 Grove St. by Michelin North America. The commission will also consider a Certificate of Compliance for an Eversource project, approve minutes and bills, and receive updates on enforcement orders and erosion control.

conservationwetlandsdemolitionhazardous-materialseversourceerosionpublic-hearing
Wed Nov 15, 2023

Retirement Board

Chicopee Retirement Board to review monthly expenses and 2024 budget

The Chicopee Contributory Retirement System will conduct its monthly meeting to approve expense warrants and review the 2024 budget. The board will also discuss membership applications, refunds, transfers, and manager performance regarding SEI Investments.

retirementbudgetfinancegovernment-administration
Tue Nov 14, 2023

Historical Commission

Historical Commission to hold public hearing on house tour, elections, bylaws

The Chicopee Historical Commission will hold a public hearing to discuss several administrative items, including postponing a tour of the Edward Bellamy House to December 12, 2023, holding elections for Chair, Vice Chair, and Clerk, and reviewing the Odd-Year Bylaw (Article XIII). The meeting will also include approval of October minutes and new business.

historical-commissionpublic-hearingelectionsbylawsedward-bellamy-house
Tue Nov 14, 2023

Parks Commission

Parks Commission to review drone training, 5K request, pickleball courts

The Chicopee Parks and Recreation Commission is meeting to approve bills, hear public input, and discuss communications including a request for a 5K run at Szot Park and police drone training there. They will also review maintenance and recreation reports, old business like dam removal and playground projects, and new business including potential pickleball courts at Williams Park.

parksrecreationdrones5kpickleballplaygrounddam-removal
Thu Nov 9, 2023

City Council - Mayor's Briefing

Mayor briefs Council on $1.25M Anna Barry Elementary School study

The Mayor will brief the City Council on several Mayoral Orders and general city updates. The items include funding for a school feasibility study, multiple police department appropriations and grants, and a sewer project grant.

schoolspolicebudgetinfrastructuregrantsseniors
Thu Nov 9, 2023

City Council

Council to vote on $1.25M feasibility study for Anna Barry Elementary School

The Chicopee City Council will consider multiple appropriations, grants, and zoning changes. The most significant item is a $1.25 million transfer from the Stabilization Fund for a feasibility study on Anna Barry Elementary School. Other actions include accepting various state and federal grants for police, fire, and infrastructure projects, as well as several zoning amendments and special permits.

budgetschoolsgrantszoningpoliceroadspublic-safety
Mon Nov 6, 2023

Library

Library trustees to discuss LED sign, shade structure, and HVAC projects

The Chicopee Public Library Board of Trustees will review financial reports, director's statistics, and correspondence from the Friends of the Library. New business includes discussion of a proposed LED sign project funded partly by the Friends, an update on a shade structure, the ListenTech project, and HVAC refurbishment.

librarytrusteesled-signshade-structurehvaclistentechfinancial-report
Thu Nov 2, 2023

Planning Board

Planning Board to review three zone changes and three site plan proposals

The Planning Board will hold public hearings to consider three requests for zoning changes to allow for housing and office space. The board will also review site plans for a contractor's yard, a drive-thru coffee shop, and modifications to a Food Bank facility.

zoninghousingsite-planscommercial-development
Wed Nov 1, 2023

Conservation Commission

Conservation Commission to hear food bank enforcement response, PCB work, contractor yard expansion

The Chicopee Conservation Commission will hold a public hearing on November 1, 2023, to address several items, including a response to an enforcement order from the Western Massachusetts Food Bank, a request for a determination of applicability for PCB soil delineation at Szot Park, and a notice of intent for a contractor yard expansion near wetlands. The commission will also review minutes, sign bills, and receive updates on enforcement orders and erosion control. This is a regular meeting with substantive public hearing items.

conservationwetlandsenforcementpublic-hearingparksconstruction
Wed Oct 25, 2023

City Council - Zoning Committee

Zoning Committee to discuss attached agenda items

The Chicopee Zoning Committee will meet on October 25, 2023, at 6:30 PM in City Hall Council Chambers to discuss items listed in the attached agenda. The specific agenda items are not included in this notice.

zoningmeetingchicopee
Wed Oct 25, 2023

Retirement Board

Chicopee Retirement Board to review retirement applications and expenses

The Chicopee Contributory Retirement System will hold its monthly meeting to process retirement, disability, and membership applications. The board will also approve monthly expense warrants and review PERAC memos.

retirementgovernment-financechicopeepersonnel
Tue Oct 24, 2023

City Council - Finance Committee

Finance Committee to discuss moving $15M HR budget line item

The Chicopee Finance Committee will meet to discuss removing a $15 million line item from the Human Resources budget and moving it to the appropriate budget where it is expended. The agenda also includes approval of the September 13, 2023 minutes and adjournment.

budgetfinancehuman-resources
Tue Oct 24, 2023

City Council - Recreation Committee

Recreation Committee to discuss expanding pickleball in Chicopee

The Recreation Committee will meet to discuss the expansion of pickleball in the city. The agenda also includes approval of minutes from December 2019 and adjournment.

recreationpickleballchicopee
Thu Oct 19, 2023

License Commission

License Commission to review manager change, premises alteration, and hearings

The Chicopee License Commission is meeting to consider several license-related applications and hearings. Items include a change of manager for Applebee's, an alteration of premises for The Rumbleseat, hearings for Eagles Club and The Vibez, and a new common victualer application for Coli's Market. The commission will also review police reports and ABCC approvals.

licensesalcoholpublic-hearingsbusiness
Wed Oct 18, 2023

Parks Commission

Parks Commission to weigh church Thanksgiving event and park lights request

The Chicopee Parks and Recreation Commission is meeting to discuss routine business, including approving bills, hearing public input, and reviewing communications. Notable items include a request from First Central Bible Church to hold its annual Thanksgiving service and bonfire, and a request from Sean Goonan to turn off all flood lights in city parks. The commission will also receive updates on ongoing projects and recreation programs.

parksrecreationpublic-hearingmaintenanceevents
Wed Oct 18, 2023

Conservation Commission

Conservation Commission to hear food bank's response to enforcement order

The Chicopee Conservation Commission is holding a public hearing to discuss wetland-related matters. The main item is the Western Massachusetts Food Bank's response to an enforcement order issued on September 15, 2023. The commission will also review meeting minutes, sign bills, and get updates on other enforcement orders and an erosion control project.

conservationwetlandsenforcementerosionfood-bank
Tue Oct 17, 2023

Board of Registrars

Board of Registrars to review registration statistics and nomination papers

The Board of Registrars of Voters will hold a regular meeting to approve minutes from September 19, 2023. The meeting includes a report on September registration statistics and the processing of nomination and petition papers.

electionsvoter-registrationgovernment-administration
Tue Oct 17, 2023

City Council - Mayor's Briefing

Mayor to brief council on orders for $3,231 demolition overtime and $5,170 senior meals

The Mayor will brief the City Council on three proposed Mayoral Orders before the council's regular meeting. The orders include appropriations for building department overtime and janitor supplies, plus acceptance of donations for senior meals.

budgetcity-councildemolitiondonationssenior-services
Mon Oct 16, 2023

Library

Library trustees to consider flag, notary, and internet policy changes

The Chicopee Library Board of Trustees is meeting to review routine reports and consider several proposed policy changes. The board will discuss a new flag policy, a policy for notary public services, and revisions to the internet and internet safety policies. No final decisions are noted on the agenda.

librarypoliciesinternetnotaryflag
Wed Oct 11, 2023

Zoning Board of Appeals

ZBA to hear continued variance for garage at 234 College St.

The Chicopee Zoning Board of Appeals will hold a public hearing on a variance request for a front setback reduction at 234 College St., continued from September 13 due to lack of quorum. The board will also review minutes from prior meetings and discuss any old or new business before adjourning.

zoningvariancepublic-hearingconstruction
Tue Oct 10, 2023

City Council - Ordinance Committee

Chicopee Ordinance Committee to consider dumpster rule repeal, stop signs, and parking ban

The committee will vote on deleting a dumpster ordinance due to state law superseding it, and discuss installing stop signs at two intersections, a parking ban on Rivers Avenue, a no-truck sign on Ludlow Road, and a drive-thru proposal. Minutes from September 12 will also be approved.

ordinance committeetrafficparkingstop signsdumpstersdrive-thrupublic hearing
Tue Oct 10, 2023

Historical Commission

Historical Commission holds public hearing on presentations and elections

The Chicopee Historical Commission is holding a public hearing to discuss several items, including presentations on historic speech patterns and the Springfield Diocese's Holy Name and Assumption, as well as commission elections and a bylaw review. The meeting also includes discussion of a future meeting at the Bellamy House and approval of prior minutes.

historical-commissionpublic-hearingelectionsbylaw-reviewpresentations
Thu Oct 5, 2023

Planning Board

Food Bank site plan, frontage waiver on Planning Board agenda

The Chicopee Planning Board will hold a public hearing on a modified definitive site plan for The Food Bank of Western Massachusetts at 25 Carew St., and will take up a tabled frontage waiver request to create a new building lot at 35 Whitin Ave. The board will also review approval-not-required (ANR) plans and minutes from the September 7 meeting.

planning-boardsite-planfrontage-waiverfood-banksubdivisionpublic-hearing
Wed Oct 4, 2023

Conservation Commission

Conservation Commission to review restoration plan, ratify enforcement orders

The Chicopee Conservation Commission is holding a public hearing to review a restoration plan for 129 Dejordy Lane, discuss enforcement orders for properties on McKinstry Avenue, and handle routine business like approving minutes and bills. The meeting also includes an update on the emergency certification for the Chicopee Comprehensive High School project.

conservationenforcement-orderswetlandsrestorationpublic-hearing
Tue Oct 3, 2023

City Council - Mayor's Briefing

Mayor to brief council on orders including $24,546.39 transfer and grants

The Mayor will brief the City Council on nine mayoral orders to be considered later that evening, covering appropriations, donations, grants, and early voting. The briefing also includes general city updates. The agenda is substantive, with specific financial items.

budgetgrantselectionslibrarycouncil-on-aging
Mon Oct 2, 2023

City Council - License Committee

Council to review Royal Coach Sales licenses, may modify or revoke

The License Committee will consider several license applications and a review of Royal Coach Sales' licenses, which could be modified, suspended, fined, or revoked. The meeting includes public hearings on new licenses for ice cream vending, junk dealing, and auto body work.

licensespublic-hearingjunk-dealersauto-bodyice-cream
Thu Sep 28, 2023

City Council - Human Resources Committee

Committee to vote on two mayoral appointments to boards

The Human Resources Committee will consider two mayoral appointments: Yadira I. Medina to the Housing Authority (term through January 2028) and Audrey L. Monroe to the Council on Aging (term through July 2026). The committee will also vote on approving the minutes from August 29, 2023.

appointmentshousing-authoritycouncil-on-agingminutes
Thu Sep 28, 2023

City Council - Education Committee

Education Committee to discuss Bowie School traffic, bus safety, enrollment, playground

The Chicopee City Council's Education Committee is meeting to discuss traffic, school bus safety, enrollment, and playground equipment at Bowie School. The committee will also review minutes from its June 8, 2023 meeting and then adjourn. No votes or decisions are listed on the agenda.

educationschool-safetytrafficenrollmentplayground
Wed Sep 27, 2023

City Council - Zoning Committee

Zoning Committee to weigh special permits, zone changes, and a sign relocation

The Chicopee Zoning Committee will review five applications, including special permits for residential units, a sign relocation, and dumpster revisions, plus two zone changes. They will also approve minutes from August 30, 2023, and adjourn.

zoningspecial-permitzone-changesignsbusinesshousing
Wed Sep 27, 2023

Retirement Board

Chicopee Retirement Board to hold monthly meeting on September 27

The Chicopee Contributory Retirement System will conduct its regular monthly meeting. The agenda includes reviewing retirement and membership applications, disability calculations, and approving monthly expense warrants.

retirementpensiongovernment-financechicopee
Thu Sep 21, 2023

License Commission

License Commission to weigh alcohol license changes, new eatery, and event permits

The Chicopee License Commission is meeting to decide on several alcohol license applications, including a change of category for a Korean restaurant, a transfer of a license, and multiple one-day permits for community events. They will also review 2024 filing fees and police reports. The agenda includes public input and routine administrative items.

alcohol-licensespermitspublic-hearingfeesevents
Thu Sep 21, 2023

Parks Commission

Parks Commission to review monument request, tennis program, field rules

The Chicopee Parks and Recreation Commission is meeting to discuss several requests and reports, including a monument at Aldenville Commons, a tennis program at Szot Park, and updates on ongoing projects. They will also review field use forms, codes of conduct, and rates for high school games.

parksrecreationmonumenttennisfield-usemaintenance
Tue Sep 19, 2023

City Council - Mayor's Briefing

Mayor proposes $800K fire pumper, $125K pump station repairs

The City Council will hear a mayoral briefing on 13 orders to be voted at the regular meeting. Items include appropriations for a fire pumper and sewer pump station repairs, acceptance of grants and donations, and reappointments to the Council on Aging.

budgetfire-departmentpublic-worksgrantslibrarycouncil-on-aging
Tue Sep 19, 2023

ARPA Committee

ARPA Committee reviews projects, Moose Lodge proposal

The Chicopee ARPA Advisory Committee is meeting to receive updates from the mayor and administration, approve minutes, and review project status reports. They will hear presentations on the Homeowner Resiliency and Library Redevelopment projects, and consider a proposal from the Moose Lodge for the non-profit program. Updates on prior proposals, including Bellamy House, are also on the agenda.

arpacommunity-developmentlibrarynon-profithousing
Mon Sep 18, 2023

City Council - Public Works Committee

Chicopee Public Works Committee to discuss speed limits, sidewalks, and traffic studies

The Public Works Committee will meet to discuss and potentially refer to public hearings a range of road and sidewalk issues, including inconsistent speed limits on Chicopee Street, sidewalk installations, and traffic studies on several streets. The agenda includes 18 substantive items, mostly orders for discussion or DPW studies, plus approval of prior minutes and adjournment.

public-worksroadssidewalkstrafficspeed-limitssafety
Wed Sep 13, 2023

City Council - Finance Committee

Finance Committee to vote on $52,388 HR salary transfer and discuss trestle warning system

The Chicopee Finance Committee will meet to consider appropriating $52,388.72 from the Stabilization Fund to the Human Resources Salary Account for a Benefits Coordinator. They will also discuss funding for an Overheight Warning System at the Prospect Street train trestle. The agenda includes approval of minutes from July 31, 2023, and adjournment.

budgetfinancesalarytransportationsafety
Wed Sep 13, 2023

Zoning Board of Appeals

ZBA to hear variance request for garage setback at 234 College St.

The Chicopee Zoning Board of Appeals will hold a public hearing on a variance request to reduce the front setback from 25 feet to 16.5 feet to build an attached garage at 234 College St. The board will also review minutes from the previous meeting and discuss old/new business.

zoningvariancepublic-hearinggaragesetback
Tue Sep 12, 2023

City Council - Ordinance Committee

Ordinance Committee to hold public hearings on stop signs, speed limits, and parking restrictions

The Ordinance Committee will hold public hearings on 17 items including stop signs, speed limit changes, parking prohibitions, and a handicap parking request. The committee will also vote on minutes from the previous meeting.

trafficparkingpublic-hearingordinancechicopee
✓ Decided: Committee approved a stop sign and multiple parking prohibitions across Chicopee

The Ordinance Committee approved an isolated stop sign at the intersection of Dorothy Avenue and Manning Street. It approved parking prohibitions on Broadway, Clarion, Edgewood, Clairmont, Taylor, Pleasant, and Asinof streets. The committee postponed the proposed no‑truck sign for Ludlow Road pending further review. It also approved a speed‑limit change to 25 mph on Irene Street and the installation of rumble strips at Irene and Ingham Streets.

Mon Sep 11, 2023

Library

Library trustees to review tactile art exhibit and policy updates

The Chicopee Library Board of Trustees will discuss a proposal for a tactile art exhibit accessible to blind or low-vision patrons, and consider updates to the Hotspot Agreement and Room Reservations Policy. The meeting also includes financial and director's reports, as well as updates on staffing, building maintenance, and the Chicopee Public Library Plaza Improvements project.

librarytrusteesexhibitaccessibilitypolicymaintenanceplaza-improvements
✓ Decided: Library Trustees approve $6,000 accessible art exhibit for May 2024

The Trustees approved a contract for a Tactile Images art exhibit for the blind and low-vision community. The board also updated policies regarding hotspot returns and meeting room eligibility for non-profits.

Thu Sep 7, 2023

Planning Board

Planning Board to vote on zone change for Marion St. housing and Dunkin' Donuts site plan

The Chicopee Planning Board will hold a public hearing on several tabled ordinance amendments, a zone change for residential development, a definitive site plan for a new Dunkin' Donuts with a drive-thru, a liquor license alteration for The Rumbleseat, a frontage waiver, and adoption of the city's comprehensive plan. The meeting includes votes on these items and approval of previous minutes.

zoninghousingcommercial-developmentliquor-licensecomprehensive-plan
✓ Decided: Planning Board adopts Comprehensive Plan and approves Dunkin Donuts site plan

The Board adopted the Chicopee Comprehensive Plan and approved a definitive site plan for a new Dunkin Donuts. Several ordinance amendments were recommended for denial due to lack of representation. The Board also recommended approval for a zone change on Marion St. and a liquor license alteration on Springfield St.

🏢 Registered nonprofit at this address: Knights Of Columbus
🏢 Building at this address: DQ Grill & Chill · 1 floors
Wed Sep 6, 2023

Conservation Commission

Chicopee Conservation Commission to hear hydroelectric penstock replacement

The Chicopee Conservation Commission will hold a public hearing to discuss a Request for Determination of Applicability (RDA) for replacing steel penstocks at the Chicopee Falls Hydroelectric facility. The commission will also review minutes, sign a bill, and discuss an enforcement order at 129 Dejordy Lane.

conservationhydroelectricwetlandsenforcementpublic-hearing
✓ Decided: Commission approves penstock replacement at Chicopee Falls Hydroelectric facility

The Conservation Commission approved a request to replace existing penstocks at the Chicopee Falls Hydroelectric facility on Main St. The board also approved the minutes from the August 2, 2023 meeting. A property owner was advised to submit a restoration plan for a site under an enforcement order by September 20, 2023.

Tue Sep 5, 2023

City Council - Mayor's Briefing

Council to review $2.5M in appropriations and grants

The Chicopee City Council will hear a briefing from the Mayor on 31 proposed orders, including appropriations from reserve funds for equipment, facility upgrades, and vehicles, as well as acceptance of several state and federal grants. The council will also consider appointments and contracts for the Chief Human Resource Officer and DPW Superintendent.

budgetgrantspublic-safetyinfrastructureappointments
✓ Decided: City Council approves multiple equipment purchases and grant acceptances

The City Council approved several appropriations for public safety equipment, DPW vehicles, and facility maintenance. The council also accepted multiple state and federal grants for energy efficiency, digital equity, and climate vulnerability studies.

Tue Sep 5, 2023

City Council - License Committee

License Committee to review junk dealer license for Memorial Drive shop

The Chicopee City Council's License Committee will consider a Junk Dealers License application for Prestige Dance & Sports Consignment at 720 Memorial Drive. The committee will also approve minutes from its August 14 meeting and adjourn.

licensesjunk-dealerscity-council
✓ Decided: License Committee approves junk dealer license for Prestige Dance & Sports Consignment

The License Committee approved a junk dealer license application for a consignment business specializing in dance and gymnastics apparel. Approval is contingent upon the applicant providing a signed lease and a parking plan to the Clerk's office.

Tue Sep 5, 2023

City Council

✓ Decided: City Council approves multiple appropriations for city equipment and infrastructure

The City Council unanimously approved several Mayor's appropriations for vehicle purchases, HVAC replacements, and public safety equipment. The Council also accepted three grants for City Hall lighting, digital equity planning, and climate vulnerability assessment.

Wed Aug 30, 2023

City Council - Zoning Committee

Zoning Committee to weigh mixed-use, zone change, apartment permits

The Chicopee Zoning Committee is meeting to review three applications: a special permit for a mixed-use building with a parking waiver, a zone change for a commercial contractor site, and a special permit for two apartments above a business. The committee will also approve minutes from its July 26 meeting. All items are under discussion; no final votes are listed on this agenda.

zoningspecial-permitzone-changeparkingmixed-useapartments
✓ Decided: Zoning Committee approves mixed-use permits and zone change for electrical contractor

The Zoning Committee approved three land-use applications, including a zone change to allow a commercial electrical contractor at 41 Robbins Road. Two special permits were granted for mixed-use residential units in business buildings. The committee also approved the July 26, 2023, meeting minutes.

⚠️ EPA compliance flag nearby: CALLAWAY GOLF BALL OPERATIONS INC (Significant Violation · significant violation)
Tue Aug 29, 2023

City Council - Human Resources Committee

Council committee to review three mayoral appointments to city boards

The Human Resources Committee will consider three mayoral appointments to local boards and commissions, and approve minutes from a prior meeting. The appointments are for the Zoning Board of Appeals, Housing Authority, and Council on Aging.

appointmentszoninghousingagingcity-council
✓ Decided: Human Resources Committee approves Anthony Gallant to Zoning Board of Appeals

The committee approved the mayoral appointment of Anthony Gallant to the Zoning Board of Appeals. Appointments for the Housing Authority and Council on Aging were postponed. The committee also approved the minutes from May 9, 2023.

Wed Aug 23, 2023

Retirement Board

Chicopee Retirement Board to review expenses, valuations, and insurance

The Chicopee Contributory Retirement System will hold its monthly meeting to review board minutes and monthly expense warrants. The agenda includes discussions on the 2023 actuarial valuation, cyber security insurance, and membership applications.

retirementbudgetinsurancepersonnelchicopee
✓ Decided: Retirement Board adopts more conservative investment portfolio

The Board voted to switch to a more conservative investment strategy (Portfolio A) based on a recommendation from SEI Investments. Other actions included approving a $30,000 supplemental budget and processing various membership, refund, and retirement requests.

Thu Aug 17, 2023

Parks Commission

Commission to discuss park policies with legal and police

The Chicopee Parks and Recreation Commission is meeting to approve bills, review minutes, and hear public input. They will discuss communications including requests to use Szot Park for a 5K race and Williams Park for a Gold Star Zoo program. The agenda also includes maintenance and recreation reports, old business updates on projects like the Bemis Pond Dam removal and pool improvements, and new business on park policies with legal and police.

parksrecreationpermitsmaintenancepublic-safety
✓ Decided: Parks Commission to develop new weapons policy for city programming

The Commission discussed establishing a zero-tolerance weapons policy for Parks & Rec program participants following a suspected firearm incident. The Superintendent will research other towns' policies to draft a version for Commission review. The board also approved several park use requests and monthly bills.

Tue Aug 15, 2023

City Council - Public Safety Committee

Public Safety Committee to hold hearing on Marion Excavating cease and desist

The Chicopee City Council's Public Safety Committee is meeting to hold a public hearing on a cease and desist order involving Marion Excavating Company, and to discuss resident concerns about Moreau Drive and surrounding streets with city departments. The agenda also includes approval of minutes from a previous meeting and adjournment.

public-safetypublic-hearingcease-and-desiststreetscity-council
✓ Decided: Public Safety Committee places Marion Excavating issue on file

The committee held a public hearing regarding cease and desist orders for Marion Excavating Company, but took no action other than placing the item on file. The committee also discussed traffic safety and stop sign compliance on Moreau Drive.

Mon Aug 14, 2023

Board of Registrars

Board of Registrars to discuss voting, nominations, passports

The Chicopee Board of Registrars of Voters is meeting to approve prior minutes and hear the Clerk's report on nomination papers, registration statistics, and department activities. New business includes discussions on in-person public voting, certified nomination papers, and national passport services. The agenda is otherwise routine administrative business.

electionsvotingregistrarspassportsadministration
Mon Aug 14, 2023

City Council - License Committee

License Committee to review 7 license applications and Royal Coach Sales compliance

The Chicopee License Committee will review seven license applications, including a hawkers and peddlers license for ice cream sales, several auto-related licenses, and junk dealer licenses. The committee will also discuss Royal Coach Sales, LLC's license compliance and consider a proposed address change. Minutes from May meetings will be reviewed.

licensesauto-repairjunk-dealershawkers-peddlerscompliance
✓ Decided: License Committee approves multiple auto and junk dealer license requests

The committee approved license applications for an auto business at 400 East Main Street and a name change for a junk dealer. Several other license applications were postponed due to applicant absence or pending information.

Thu Aug 10, 2023

License Commission

License Commission to review seven new or transferred food vendor licenses

The Chicopee License Commission will hold a public meeting to consider seven applications for Common Victualer licenses, including new establishments and changes of ownership. The commission will also take public input, review police reports, and discuss ABCC approvals and other administrative matters.

licensesfood-vendorspublic-hearingchicopee
✓ Decided: License Commission approves seven common victualer license applications

The Commission approved seven applications for common victualer licenses, including one mobile license. The board also reviewed police reports regarding violations at The Vibez and discussed mobile victualer zoning procedures.

Wed Aug 9, 2023

City Council - Rules Committee

Council rules panel to review charter report, open meeting complaint

The Chicopee City Council Rules Committee is meeting to consider two orders: accepting the Charter Review Committee's final report for review and recommendations, and discussing an Open Meeting Law complaint filed by Lisa Bienvenue on June 20, 2023. The committee will also approve minutes from its July 12 meeting. This is a working session focused on procedural review and next steps, not final adoption of any policy.

city-councilrules-committeecharter-reviewopen-meeting-lawminutes
✓ Decided: Rules Committee directs legal counsel to respond to Open Meeting Law complaint

The Rules Committee approved a legal response to an Open Meeting Law complaint filed by Lisa Bienvenue. The committee also received a report from the Charter Review Commission regarding proposed changes to the City Charter, which was placed on file.

Wed Aug 9, 2023

Zoning Board of Appeals

✓ Decided: Zoning Board approves variance for mixed-use building at 520 Chicopee St.

The Board approved a variance for side and rear yard setbacks to allow the reconstruction of a demolished mixed-use building. A six-month variance extension for a multi-family development was also granted. The Board approved the July 12, 2023, meeting minutes.

Tue Aug 8, 2023

City Council - Ordinance Committee

Parking bans, stop signs, and home occupation license rules up for vote

The Ordinance Committee is considering several traffic changes, including parking prohibitions on Meetinghouse Road and Chapel Street, a new stop sign at Dorothy Avenue and Prospect Street, and a no-stopping zone on Meetinghouse Road. It will also vote on adding a Benefits Coordinator position, amending special permit lapse rules for the Mill Conversion Overlay District, imposing a one-year development moratorium on Burnett Road, and replacing home occupation regulations with a new licensing system.

parkingtrafficzoningordinancebudgethome-occupationdevelopment-moratorium
✓ Decided: Ordinance Committee approves parking restrictions and Burnett Road moratorium

The committee approved amended parking and stopping restrictions on Meetinghouse Road. It also voted to extend a one-year moratorium on business, commercial, or industrial development on Burnett Road.

Thu Aug 3, 2023

Planning Board

Planning Board to vote on three tabled ordinance amendments and three zone changes

The Chicopee Planning Board will hold a public hearing on three ordinance amendments tabled from July 13, 2023, and three zone change applications. The amendments address regulations for Burnett Road, signs, and motor vehicle repair/storage. Zone changes include a 2-acre parcel at 41 Robbins Rd. for a commercial electrical contractor, two parcels at 523 James St. for a drive-thru coffee shop, and a 9,000 SF parcel at 580 Meadow St. for consistent zoning.

zoningordinance-amendmentpublic-hearingcommercial-developmentplanning-board
✓ Decided: Planning Board recommends two zone changes for City Council approval

The Planning Board recommended approval for zone changes at 41 Robbins Rd. and 580 Meadow St. A proposed zone change for a drive-thru coffee shop at 523 James St. failed to gain a recommendation due to a tied vote. Three ordinance amendments were tabled until September 7, 2023.

Wed Aug 2, 2023

Conservation Commission

Conservation Commission to hear backfill plan for Grove/West Main redevelopment

The Chicopee Conservation Commission will hold a public hearing on a Notice of Intent to backfill part of the Chicopee Falls Local Protection Project Easement and adjacent upland areas at 0 and 154 Grove Street and 75 (0) West Main Street to enable future redevelopment. The item was tabled from July 19, 2023. The commission will also discuss progress on an enforcement order at 129 Dejordy Lane and review minutes and sign bills.

conservationwetlandspublic-hearingenforcementredevelopment
✓ Decided: Commission issues Notification of Non-significance for Grove St. and West Main St. project

The Conservation Commission approved a Notification of Non-significance for the backfilling of a portion of the Chicopee Falls Local Protection Project Easement. The board also approved the July 19, 2023, meeting minutes. Discussion was held regarding an enforcement order at 129 Dejordy Lane.

Tue Aug 1, 2023

City Council - Mayor's Briefing

Mayor proposes $337K for police cruisers, $265K for sanitation truck

The Mayor will brief the City Council on 19 proposed orders to be voted on later that evening. Key items include appropriations for police cruisers, a sanitation packer, and new personnel, plus appointments and donations.

budgetpolicepublic-workspersonneldonationsappointmentscouncil-on-aging
✓ Decided: City Council approves funding for police cruisers and sanitation equipment

The City Council approved multiple appropriations from the Stabilization Fund for public safety and infrastructure, including new police cruisers and a sanitation packer. The council also authorized the creation of a second Benefits Coordinator position in Human Resources and accepted several departmental donations.

Tue Aug 1, 2023

City Council

✓ Decided: City Council approves $337,078 for new police cruisers

The City Council approved a significant appropriation for police vehicles and several smaller budget adjustments for DPW and City Hall. They also referred a request for a new Human Resources Benefits Coordinator to the Ordinance and Finance committees.

Mon Jul 31, 2023

City Council - Finance Committee

Chicopee Finance Committee to consider opting out of mail-in voting

The Finance Committee is meeting to discuss and potentially vote on two orders: opting out of mail-in voting for the 2023 primary and general election, and placing a non-binding question on the November ballot about hiring a code enforcement officer. The agenda also includes approval of minutes from February 23, 2023, and adjournment.

electionsvotingcode-enforcementballot-questionfinance-committee
✓ Decided: Finance Committee rejects opting out of mail-in voting

The Finance Committee voted against a proposal to opt out of mail-in voting for the 2023 municipal elections. A proposal to place a non-binding question on the November ballot regarding the employment of a code enforcement officer was also defeated.

Wed Jul 26, 2023

City Council - Zoning Committee

Zoning Committee to review four special permit applications

The Chicopee Zoning Committee will hold a public meeting to review four special permit applications, covering a restaurant with alcohol service, a dumpster and storage revision, a multifamily housing renewal, and a four-unit residential project. The committee will also consider minutes from two prior meetings before adjourning.

zoningspecial-permitalcoholhousingparkingcommercial
✓ Decided: Zoning Committee approves special permits for dining and residential projects

The Zoning Committee approved special permits for a liquor license transfer at 420-424 Front Street, a multifamily development renewal at 0 Oak Street, and residential compliance at 1682 Memorial Drive. A request for a storage container at 7 Rivermills Drive was postponed to September 27, 2023, due to fire code concerns.

Wed Jul 26, 2023

Retirement Board

Chicopee Retirement Board holds regular meeting with executive session

The Chicopee Contributory Retirement System will hold a regular meeting on July 26, 2023. The agenda includes the approval of June minutes and monthly expense warrants, as well as discussions regarding retirement applications, disability, and actuarial valuations.

retirementpensiongovernment-financechicopee
✓ Decided: Retirement Board maintains funding schedule at 7.25%

The Board voted to keep the funding schedule rate at 7.25% following a review of actuarial valuation scenarios. The Board also approved several superannuation retirements, membership applications, and refund requests.

Thu Jul 20, 2023

City Council - Water Resource Committee

Water Resource Committee to discuss water meters, rates, and Fairview water tower

The Chicopee City Council's Water Resource Committee is meeting to discuss water meters and water rates, as well as the water tower in Fairview. The agenda also includes approval of minutes from May 25, 2021, and adjournment. No votes or decisions are listed; the items are discussion topics.

waterwater-rateswater-towerfairviewcity-council
Thu Jul 20, 2023

License Commission

Chicopee License Commission to review 10 license applications and hearings

The Chicopee License Commission is meeting to decide on multiple license applications, including changes of manager and stock interest, new and renewed mobile food vendor licenses, a common victualer license, and special event permits. The commission will also hold hearings for the Eagles and the Dugout Café, and review police reports and ABCC approvals.

licensesalcoholfood-truckspublic-hearingspecial-events
✓ Decided: License Commission clears Dugout Café of all violations

The Commission found three counts against the Dugout Café to be unfounded. Several new and renewal food and liquor licenses were approved, and a special permit was granted for a religious festival.

Wed Jul 19, 2023

Conservation Commission

Chicopee Conservation Commission to hear backfill plan for Grove Street redevelopment

The Chicopee Conservation Commission will hold a public hearing to discuss several items, including requests for Certificates of Compliance for two properties and a Notice of Intent for backfilling a portion of the Chicopee Falls Local Protection Project Easement to facilitate future redevelopment. The commission will also review minutes, sign bills, and discuss an enforcement order at 129 Dejordy Lane.

conservation-commissionwetlandscertificate-of-compliancenotice-of-intentenforcement-orderredevelopment
✓ Decided: Conservation Commission denies compliance request for 55 Main St.

The Commission denied a Certificate of Compliance for 55 Main St. due to improper rain garden maintenance and issued a full Certificate of Compliance for 70 Britton St. A proposal to backfill land for future redevelopment at Grove and West Main Streets was tabled.

Tue Jul 18, 2023

Board of Registrars

Board of Registrars to certify nomination papers and review passport facility

The Chicopee Board of Registrars of Voters is meeting to approve minutes, review correspondence from the City Clerk, and discuss new business including certifying nomination papers, passport facility operations, and the 2023 Street List Book. The agenda is largely procedural, with no major policy decisions or financial items.

electionsvoter-registrationpassportcity-clerkmeeting-minutes
Thu Jul 13, 2023

Planning Board

Chicopee Planning Board to weigh zoning changes and Boys & Girls Club expansion

The Chicopee Planning Board will hold a public hearing on three proposed ordinance amendments, a site plan for the Boys and Girls Club, and a frontage waiver. The board will also consider approvals not required (ANRs), approve minutes, and discuss new business.

zoningordinance-amendmentsite-planfrontage-waiverboys-and-girls-clubpublic-hearing
✓ Decided: Planning Board approves site improvements for Chicopee Boys and Girls Club

The Board approved definitive site plans for the Chicopee Boys and Girls Club, including new basketball courts and parking reconstruction. Several ordinance amendments and the Citywide Comprehensive Plan were tabled for future meetings. An ANR for 753 Montgomery St. was also approved.

🏢 Registered nonprofit at this address: Boys & Girls Club Of Chicopee Inc
Thu Jul 13, 2023

Planning Board

Planning Board to vote on adopting citywide Comprehensive Plan

The Chicopee Planning Board will hold a public hearing on July 13, 2023, to consider several ordinance amendments, site plans, and a frontage waiver. The most consequential item is the adoption of the final draft of the Chicopee Comprehensive Plan, which will be presented for public comment and a vote. Other items include amendments to zoning ordinances regarding Burnett Road, signs, and motor vehicle repair, as well as a site plan for the Boys and Girls Club and a frontage waiver for a new lot on Whitin Ave.

planning-boardcomprehensive-planzoningordinance-amendmentsite-planfrontage-waiver
✓ Decided: Planning Board approves site plans for Chicopee Boys and Girls Club

The Board approved definitive site plans for improvements at 580 Meadow St., including basketball courts and parking. Several ordinance amendments and the Citywide Comprehensive Plan were tabled for future meetings. An Act Now Request for 753 Montgomery St. was also approved.

Wed Jul 12, 2023

City Council - Rules Committee

Chicopee City Council Rules Committee to review charter report and amend meeting rules

The Rules Committee will consider several orders, including establishing a social media page for agendas and meetings, accepting the Charter Review Committee's final report for review, and amending the Council's meeting rules to change the start time from 7:15 PM to 6:30 PM. The committee will also discuss a rule change for appointments to boards and commissions, and consider a citation for Jean Fitzgerald.

city-councilrules-committeemeeting-rulescharter-reviewsocial-mediaappointmentscitation
✓ Decided: Rules Committee approves new board appointment process and social media review

The Rules Committee approved a change to the appointment process for boards and commissions. They also referred a proposal for a City Council social media page to the Law Department and Mayor's office. A request to issue a citation to Jean Fitzgerald was placed on file.

Wed Jul 12, 2023

Zoning Board of Appeals

ZBA to vote on Whitin Ave. lot split variance

The Chicopee Zoning Board of Appeals will hold a public hearing on a variance request to reduce frontage requirements and create a new building lot at 35 Whitin Ave. The board will also approve minutes from the previous meeting and discuss other business.

zoningvariancepublic-hearinglot-split
✓ Decided: Zoning Board denies frontage variance for 35 Whitin Ave

The Zoning Board of Appeals denied a request to reduce frontage requirements to create a new single-family lot at 35 Whitin Ave. The board cited concerns that the variance would set a precedent and increase neighborhood congestion. The board also approved the minutes from the June 14, 2023 meeting.

Tue Jul 11, 2023

ARPA Committee

ARPA Committee reviews nonprofit and lunch program proposals

The Chicopee ARPA Advisory Committee is meeting to receive a mayor's update, approve minutes, and review administrative updates and project status reports. They will consider proposals from the Willimansett Heights Improvement League and the River Mills Center lunch program, and receive an update on the prior Bellamy House proposal.

arpacommitteenonprofitcommunity-programs
✓ Decided: ARPA Committee awards funding for senior meals and nonprofit flooring

The committee approved funding for the River Mills Lunch program and the Willimansett Heights Improvement League. It also authorized returning unspent funds from a completed firefighter gear project to the available balance.

Tue Jul 11, 2023

City Council - Ordinance Committee

Ordinance Committee sets salaries for city departments

The Ordinance Committee will vote on salary adjustments for multiple city departments, including Law, City Council, Mayor's Office, Auditing, Treasurer, Human Resources, Planning, and others, effective July 1, 2023. They will also consider a new ordinance regulating parking in municipal parks with escalating fines.

salariesordinanceparkinghuman-resourceslaw-departmentplanningcity-council
✓ Decided: Ordinance Committee approves salary updates for multiple city departments

The committee approved several amendments to Chapter 7 of the city ordinances to update salaries effective July 1, 2023. These changes include standard 2% raises and the establishment of two new positions in Human Resources. Public input was also heard regarding environmental and noise concerns related to Marion Excavating.

Thu Jul 6, 2023

City Council - Mayor's Briefing

City Council to consider $6.9M state grant for nitrogen reduction

The Chicopee City Council will hold a Mayor's Briefing on July 6, 2023, at 6:30 PM in the City Hall Auditorium and via Zoom. The Mayor will brief the Council on several mayoral orders to be considered at the regular meeting later that evening, including a $6.9 million grant for wastewater nitrogen reduction, appropriations, and donations. The agenda also includes general city updates.

grantsenvironmentbudgetdonationslibrarypolicecity-council
✓ Decided: City Council accepts $6.9M grant for nitrogen reduction

The City Council approved a grant from the Massachusetts Department of Environmental Protection for effluent nitrogen reduction. The Council also approved two mayoral appropriations for salaries and accepted donations for the public library and police department.

Thu Jul 6, 2023

City Council

✓ Decided: City Council approves zone change for prospective Tesla dealership

The City Council approved a zone change for property on Burnett Road to eliminate a split zone. The council also accepted a $6.9M grant for nitrogen reduction and approved several small appropriations and donations.

Wed Jun 28, 2023

City Council - Zoning Committee

Zoning Committee to weigh special permit for 4 units at 1682 Memorial Dr.

The Chicopee Zoning Committee will consider two applications: a special permit for four residential units at 1682 Memorial Dr., and a zone change for property on Burnett Road to eliminate a split zone. The committee will also review minutes and adjourn.

zoningspecial-permitzone-changehousingindustrial
✓ Decided: Zoning Committee approves zone change for Burnett Road property

The committee approved a request to change 2.58 acres at Burnett Road from Industrial Garden Planned Unit Development Type 1 to Industrial to eliminate a split zone. A special permit application for residential units at 1682 Memorial Drive was postponed pending fire department inspections. The committee also approved the May 31, 2023, meeting minutes.

Wed Jun 28, 2023

Retirement Board

Chicopee Retirement Board to hold regular meeting and executive session

The Chicopee Contributory Retirement System will hold a regular meeting on June 28, 2023. The agenda includes approving May minutes, monthly expense warrants, and discussing items such as disability, retirement applications, and the 2023 actuarial valuation.

retirementpensiongovernment-financechicopee
✓ Decided: Retirement Board approves disability and superannuation retirement requests

The Board approved several superannuation retirements and processed disability applications for police, fire, and water department employees. It also approved 13 new system memberships and 10 refund requests.

Tue Jun 27, 2023

Parks Commission

Parks Commission to weigh futsal league, gun policy, and splash pad project

The Chicopee Parks and Recreation Commission will review requests for field use, including a youth futsal league at Ike Alpert Park and a basketball tournament, and discuss new business items such as a splash pad project at Sarah Jane Park, a park gun policy, and emergency notification procedures. The agenda also includes routine approvals of minutes and bills, and updates on ongoing projects like the Bemis Pond Dam Removal and pool improvements.

parksrecreationfield-usesplash-padgun-policypublic-safetymaintenance
✓ Decided: Parks Commission approves several park use requests and facility warrants

The Commission approved warrants for June 9 and June 23, 2023, and granted several requests for the use of city parks for sports and programs. The board also discussed updates to codes of conduct and police notification policies.

Tue Jun 27, 2023

City Council

Chicopee City Council to approve FY2024 budget and salary ordinance changes

The Chicopee City Council is holding a special meeting to reconcile and approve the Fiscal 2024 budget, including a $7,989.15 appropriation from free cash. The council will also vote on 16 mayoral orders amending Chapter 7 of the city ordinances to update salaries for various departments, effective July 1, 2023.

budgetsalariesordinancefinancecity-council
✓ Decided: City Council approves FY2024 budget despite HR insurance concerns

The City Council approved the Fiscal Year 2024 budget following a debate regarding health insurance payments within the HR department. Additionally, the council approved a small appropriation for salary accounts and referred several salary ordinance amendments to the Ordinance Committee.

Thu Jun 22, 2023

City Council - Public Safety Committee

Chicopee Public Safety Committee to hold hearings on dirt bikes, Dairy Queen, and safety issues

The Public Safety Committee is meeting to hold public hearings on dirt bikes, Dairy Queen at 1535 Memorial Drive (traffic, snow removal, sanitary conditions), and to discuss ordinance enforcement and safety issues in the Litwin School neighborhood. The agenda also includes approval of minutes from March 23, 2023, and adjournment.

public-safetydirt-bikesdairy-queenordinance-enforcementschool-safety
✓ Decided: Public Safety Committee places dirt bike issue on file

The committee held a public hearing regarding dirt bike enforcement and a separate hearing concerning traffic and sanitation issues at the Dairy Queen on Memorial Drive. The dirt bike matter was officially placed on file. No final decision was recorded regarding the Dairy Queen complaints.

Wed Jun 21, 2023

Conservation Commission

Conservation Commission to hear sand/gravel pit expansion, enforcement order

The Chicopee Conservation Commission will hold a public hearing on June 21, 2023, to discuss a request to continue and expand sand and gravel pit operations at 749 New Ludlow Rd., and to ratify an enforcement order for unauthorized clearing and excavation at 129 Dejordy Lane. The agenda also includes routine items like approving minutes and signing bills, plus a discussion of the CEL Hydro Electric Project on the Chicopee River.

conservationwetlandsminingenforcementhydroelectric
✓ Decided: Commission approves storage yard and gravel pit operations at 749 New Ludlow Rd.

The Commission approved a request for storage, recycling, and sand and gravel operations with specific conditions regarding wetland buffers. An enforcement order for a property on Dejordy Lane was ratified, and April meeting minutes were approved.

Tue Jun 20, 2023

City Council

Council to vote on $20M+ transfers to stabilization funds

The Chicopee City Council will consider multiple appropriation orders, including transferring over $10.9 million to a school stabilization fund and $9 million to the general stabilization fund. The agenda also includes zoning changes, home occupation licenses, and several ordinance amendments.

budgetzoninghome-occupationparkingordinance
✓ Decided: City Council approves several million-dollar fiscal year-end appropriations

The City Council approved multiple mayoral appropriations to close out the fiscal year, including over $10.9 million for educational stabilization and $9 million for the general stabilization fund. The council also granted two home occupation licenses and referred a Burnett Road development moratorium to the Ordinance Committee.

Tue Jun 20, 2023

City Council - Mayor's Briefing

Chicopee City Council holds Mayor's Briefing on June 20, 2023

This is a notice for the City Council/Mayor's Briefing meeting on June 20, 2023, at 6:30 PM. The agenda itself is not included in the notice, so the specific items to be discussed are unknown. The meeting will be held in the Auditorium at City Hall and via Zoom.

city-councilmayor-briefingmeeting-notice
✓ Decided: City Council approves over $19.9M in appropriations for schools and stabilization

The City Council approved several mayoral appropriations, including over $10.9M for educational stabilization and $9M for the general stabilization fund. The council also approved smaller funds for city hall maintenance, golf course water, and DPW equipment. Additionally, the council accepted $5,961 in donations for senior meals.

Thu Jun 15, 2023

License Commission

Chicopee License Commission to review liquor license changes and new pizza license

The Chicopee License Commission is meeting to consider several license-related items, including a change of stockholders and officers for the Blue Room Cafe Inc, a new Common Victualer license for Paradise Pizza at 140 Exchange St, and an ABCC approval for a change of officers for 99 Restaurants. The commission will also review police reports and filing fees, and note that the J & W Banquet Hall hearing has been rescheduled to August 10, 2023.

licensesalcoholfood-servicepublic-hearingpolice-reports
✓ Decided: License Commission approves ownership changes for Blue Room Cafe and Paradise Pizza

The Commission approved a change of stockholders and management for the Blue Room Cafe and granted a Common Victualer license to Paradise Pizza. A hearing regarding the Dugout Café was scheduled for the next meeting.

Wed Jun 14, 2023

Zoning Board of Appeals

Chicopee ZBA to hear three variance requests for new building lots

The Chicopee Zoning Board of Appeals will hold a public hearing on three variance requests to create new single-family building lots, each requiring reductions in frontage, area, or depth standards. The board will also review minutes from the previous meeting and discuss old/new business.

zoningvariancepublic-hearingbuilding-lotschicopee
✓ Decided: Zoning Board denies variance for new lot at 363 Montcalm St.

The Board denied a variance request to create a new single-family building lot at 363 Montcalm St. due to a lack of hardship. One variance request was withdrawn, and another was tabled until July 12, 2023.

Tue Jun 13, 2023

City Council - Ordinance Committee

Parking bans on Alvord Ave and Meetinghouse Rd; tag sale policy review

The Ordinance Committee will discuss and possibly vote on three proposed traffic regulations: a parking prohibition on the south side of Alvord Avenue from Broadway to 85 feet east, a parking prohibition on the odd side of Meetinghouse Road from Chicopee Street to Stefanik School driveway, and a no-stopping/standing restriction on the odd side of Meetinghouse Road from Meadow intersection to the same driveway. The committee will also review the current tag sale policy and consider approving minutes from May 23, 2023.

parkingtrafficordinancepublic-safetytag-sales
✓ Decided: Ordinance Committee approves parking and stopping restrictions on Alvord Ave and Meetinghouse Rd

The committee approved amended ordinances to prohibit parking on Alvord Avenue and prohibit stopping or standing on a section of Meetinghouse Road. A proposal to review the city's tag sale policy was placed on file.

Tue Jun 13, 2023

Historical Commission

✓ Decided: Commission approves letter of support for Belcher School redevelopment

The Historical Commission approved a letter of support for the Valley Opportunity Council to redevelop the former Belcher School into 20-25 apartments. The board also approved the May 9, 2023 meeting minutes. Other items included discussions on the closing of Holy Name of Jesus Parish and the condition of the Edward Bellamy House.

Mon Jun 12, 2023

City Council - Rules Committee

Chicopee Council rules committee to consider meeting time change and public input rules

The Rules Committee is meeting to discuss and potentially amend the City Council's Rules and Orders. Items include changing the start time of regular meetings from 7:15 PM to 6:30 PM, revising public input rules to prohibit yielding time, and discussing training for councilors. The committee will also consider accepting a Charter Review Committee report and a rule change for board appointments.

city-councilrulesmeeting-timepublic-inputtrainingcharter-reviewappointments
✓ Decided: City Council Rules Committee moves meeting start time to 6:30 PM

The Rules Committee approved changes to the City Council's meeting start time and public input rules. The committee also established a process for new councilor training and scheduled a review of the Charter Review Committee's final report.

Thu Jun 8, 2023

City Council - Education Committee

Education Committee to discuss budget and traffic safety

The Education Committee will meet to discuss the budget and traffic and pedestrian safety. The meeting will also include approval of minutes from December 22, 2022.

educationbudgettraffic-safetypedestrian-safety
✓ Decided: Education Committee approves December 2022 meeting minutes

The committee discussed school budget updates and pedestrian safety concerns, including crosswalk painting and school bus routing. No policy changes were made regarding traffic, and the committee voted to place the discussion on file.

Wed Jun 7, 2023

City Council - Zoning Committee

Zoning Committee to vote on home occupation rules and three applications

The Zoning Committee will hold public hearings on three home occupation applications (microgreens, dog grooming, bakery) and consider an ordinance amendment that would replace current home occupation regulations with a new licensing system. The committee will also discuss a one-year moratorium on commercial development on Burnett Road.

zoninghome-occupationlicensingmoratoriumpublic-hearing
✓ Decided: Zoning Committee approves two home occupation licenses and rejects Burnett Road moratorium

The committee approved home occupation licenses for a microgreens business and a dog grooming service, both subject to departmental inspections. A proposed ordinance to extend a development moratorium on Burnett Road was defeated. One home bakery application was withdrawn.

Tue Jun 6, 2023

City Council

✓ Decided: City Council approves salary increases for council and school committee

The City Council approved an ordinance increasing salaries for the Council President, Councilors, and School Committee members effective January 1, 2024. The council also approved several funding appropriations for DPW and school custodians and enacted new parking prohibitions on Perrault, John, and Leslie Streets.

Tue Jun 6, 2023

City Council - Mayor's Briefing

Mayor to brief council on orders and city updates

The Mayor will brief the City Council on attached Mayoral Orders to be considered at the regular meeting later that evening, and provide general city updates. The agenda is largely procedural, with no specific items detailed in the notice.

city-councilmayor-briefingprocedural
✓ Decided: City Council reviews Mayor's appropriations for DPW, schools, and HR

The City Council held a Mayor's Briefing to review several fund appropriations for city departments and a new appointment to the Housing Authority. The meeting concluded with updates on neighborhood meetings and upcoming city events.

Mon Jun 5, 2023

Library

Library trustees to review plaza improvement proposal

The Chicopee Public Library Board of Trustees is meeting to review a proposal for plaza improvements, along with updates on staffing, building maintenance, and the FY23 and FY24 budgets. The agenda includes routine items such as minutes, financial reports, and the director's report on library statistics.

librarybudgetfacilitiesmaintenancepublic-hearing
✓ Decided: Library Trustees approve $16,500 for plaza improvements

The Trustees approved funding for the "Chicopee Public Library Plaza Improvements" project. The board also accepted the May meeting minutes, the June 2 financial report, and the Director's report.

Thu Jun 1, 2023

Planning Board

Planning Board to revisit Walmart expansion, review Dunkin' Donuts site plan

The Chicopee Planning Board will hold a public hearing on June 1, 2023, to consider a tabled definitive site plan for a Walmart expansion, a preliminary site plan for a new Dunkin' Donuts, and a frontage waiver for a single-family house. The board will also discuss ANRs, approve minutes, and handle new business.

planning-boardsite-plan-reviewwalmartdunkin-donutsfrontage-waiverpublic-hearingchicopee
✓ Decided: Planning Board approves Walmart expansion and Dunkin Donuts site plan

The Board approved a site plan for a Walmart expansion and a preliminary plan for a new Dunkin Donuts. A request for a frontage waiver for a single-family home on Hamel Street was denied. Several Assessor's Plan (ANR) filings were also approved.

Wed May 31, 2023

City Council - Zoning Committee

Chicopee Zoning Committee to review six special permits and zone changes

The Chicopee Zoning Committee will hold a public meeting to review six applications, including special permits for eating/drinking establishments, residential units, and zone changes. The committee will also approve minutes from previous meetings and adjourn.

zoningspecial-permitzone-changealcoholresidentialmill-conversion
✓ Decided: Zoning Committee approves alcohol permit and housing renewals

The Committee approved a special permit for a food truck court with alcohol service and renewed special permits for two multi-family housing developments. A request for four residential units at 1682 Memorial Dr. was discussed but not decided.

Tue May 30, 2023

Parks Commission

Parks Commission to review field use requests and summer programs

The Chicopee Parks and Recreation Commission is meeting to review field use requests for the upcoming summer and fall seasons, including requests from the Chicopee Braves, CHS Boys Soccer, Celtic United Soccer Club, Springfield Thunderbirds, Sean Mackin, and Wanda Torres. The commission will also hear maintenance and recreation reports, discuss old business such as the PARC Grant pool startup and Bemis Pond Dam removal, and consider new business including a Ranger/Site Monitor position and summer construction projects.

parksrecreationfield-usemaintenancebudgetconstruction
✓ Decided: Parks Commission approves field use requests and budget transfers

The Commission approved several summer field and park use requests for soccer teams, a youth camp, and a community event. It also approved a revised job description for a Ranger/Site Monitor and budget transfers for equipment and materials, pending City Council approval.

Tue May 23, 2023

City Council - Ordinance Committee

Ordinance Committee to hold public hearing on truck ban on Old Lyman Road

The Ordinance Committee will hold a public hearing on a proposed 'No Through Trucks' restriction on Old Lyman Road from Britton Street northward, to be reviewed by DPW. The committee will also discuss several parking prohibition orders on Perrault, John, Leslie, McCarthy, Kennedy, and Alvord streets, and a stop sign at Manning Street and Dorothy Avenue. The meeting includes approval of prior minutes and adjournment.

ordinancepublic-hearingtrafficparkingtrucksstop-sign
✓ Decided: Ordinance Committee approves pay increases for City Council and School Committee

The committee approved amended pay rates for the City Council and School Committee effective January 1, 2024. Several parking prohibitions were established on various city streets, and the Front Street portion of the City Hall Parking Plan was approved. Requests for truck exclusions and a new stop sign were defeated or withdrawn.

Mon May 22, 2023

Retirement Board

Chicopee Retirement Board to review actuarial valuation and GASB reports

The Chicopee Contributory Retirement Board is holding its regular monthly meeting. The agenda includes routine approvals of minutes and expense warrants, updates on investments, and review of the 2023 actuarial valuation and GASB 67/68 reports. It will also consider membership, retirement, refund, transfer, and medical evaluation applications.

retirementpensionactuarialfinancemeeting
✓ Decided: Retirement Board approves memberships, pensions, and refunds

The Board approved 13 new memberships, four retirement applications, and 11 member refunds. It also accepted the GASB 67 & 68 Report and approved two yearly pension calculations, while tabling a vote on the discount rate.

Thu May 18, 2023

License Commission

Chicopee License Commission to weigh permits for Pride event, farmers market, food trucks

The Chicopee License Commission is meeting to consider several license applications and permits, including a special one-day beer/wine permit for the Chicopee Pride event, a special event permit for the Center Fresh Farmers Market, and multiple mobile food vendor licenses. The agenda also includes hearings for Eagles and The J & W Banquet Hall, a review of police reports, and updates on correspondence.

licensespermitsfood-trucksfarmers-marketpride-eventpublic-hearing
✓ Decided: License Commission approves several event and food vendor permits

The Commission approved special permits for the Chicopee Pride Event and Center Fresh Farmers Market. It also issued a warning to Eagles for failing to submit required officer change paperwork. Multiple mobile and common victualer licenses were granted.

Thu May 18, 2023

City Council

City Council to vote on Anna Barry School Building Commission members

The Chicopee City Council is holding a special meeting to consider approval of members for the Anna Barry School Building Commission. The agenda contains only this single item, along with meeting logistics.

schoolcommissionappointment
✓ Decided: City Council approves five appointments to Anna E. Barry Elementary School Building Commission

The City Council approved five individual appointments to the Anna E. Barry Elementary School Building Commission. Earlier motions to approve the group as a whole or separate the candidates were defeated.

Tue May 16, 2023

City Council

Council to vote on $390K snow removal, $248K sludge, and other appropriations

The Chicopee City Council is meeting to consider a series of mayoral appropriations and orders, including funding for snow and ice removal, sludge disposal, and water system improvements. The council will also vote on accepting donations, taking easements by eminent domain for sewer work, and several license applications and appointments.

budgetappropriationspublic-workslicenseseminent-domaindonations
✓ Decided: City Council approves multiple fund appropriations and traffic safety review

The City Council approved several mayoral appropriations for snow removal, wastewater, and water services. The council also directed the DPW and Engineering to review the installation of a four-way traffic light at Chicopee Street and McKinstry Avenue.

Tue May 16, 2023

ARPA Committee

ARPA Committee to weigh $3.19M in water, park, library, school requests

The Chicopee ARPA Advisory Committee is meeting to review a mayor's update, approve minutes, and hear administrative updates and a project status report. The main business is considering four funding requests totaling about $3.19 million, including a water project increase, a park, library improvements, and a school project loan. The committee will also receive updates on prior proposals and discuss the Bellamy House.

arpawaterparkslibraryschoolsfunding
✓ Decided: ARPA Committee approves over $5M for South Fairview water and sewer projects

The committee approved additional funding for two South Fairview infrastructure projects and a loan for the Southwick St School Redevelopment. One project was tabled and another was shifted to the CDBG program. The Mayor noted federal concerns regarding potential early claw backs of ARPA funds.

Tue May 16, 2023

Board of Registrars

Board of Registrars to certify nomination papers and review census

The Chicopee Board of Registrars of Voters is meeting to approve prior minutes, review correspondence, and handle new business including certifying nomination papers, confirming census notices, and reviewing school department spreadsheets. The agenda is largely administrative and procedural.

electionsregistrarscensusschoolstraining
Tue May 16, 2023

City Council - Claims and Accounts Committee

Committee to review 18 damage claims seeking restitution

The Claims & Accounts Committee will review 18 claims from residents seeking restitution for property damage, including vehicle, fence, mailbox, and other damages. The claims range from $30.41 to $300.00, with most seeking the maximum $300.00. The committee will also approve minutes from a previous meeting and adjourn. One claim (22-10) is recommended for auto-deny and referral to Palmer Paving.

claimsrestitutionproperty-damagevehiclesmailboxes
Tue May 16, 2023

City Council - Mayor's Briefing

Mayor to brief council on orders before regular meeting

The City Council is holding a Mayor's Briefing at 6:30 PM on May 16, 2023, where the Mayor will discuss attached Mayoral Orders that the Council will consider at its 7:15 PM meeting that same evening. The Mayor will also provide general city updates. The agenda contains no other substantive items beyond this briefing.

city-councilmayorbriefingmayoral-orders
✓ Decided: City Council approves multiple appropriations and sewer easement takings

The City Council approved several fund transfers for snow removal, wastewater, and police equipment. The Council also authorized the use of eminent domain for sewer and drain line easements and accepted various donations for the Food Bank and Public Library.

Wed May 10, 2023

Zoning Board of Appeals

ZBA to hear variance for buildable lot on Old Lyman Rd.

The Chicopee Zoning Board of Appeals will hold a public hearing on a variance request to create a buildable lot on Old Lyman Rd. The applicant seeks relief from frontage, garage setback, and porch setback requirements. The board will also review minutes from the previous meeting and discuss old/new business.

zoningvariancepublic-hearingproperty
✓ Decided: Zoning Board approves variances for new lot on Old Lyman Road

The Board approved a variance request to create a buildable lot on Old Lyman Road by adjusting frontage and setback requirements. The Board also approved the meeting minutes from April 12, 2023.

Tue May 9, 2023

Historical Commission

Historic Main Library rehab project to be presented at public hearing

The Chicopee Historical Commission will hold a public hearing to discuss the rehabilitation and accessibility upgrade of the historic former Main Library, presented by Lee Pouliot. The commission will also discuss the future of the Holy Name of Jesus Parish building, update its webpage information, and review meeting minutes.

historic-preservationpublic-hearinglibraryparish-closingwebpage
✓ Decided: Commission approves support letter for historic library rehabilitation

The Historical Commission approved a support letter for a $5.5 million rehabilitation and accessibility project for the former library. The board also discussed the potential future of the Holy Name Parish complex and the City Hall rehab project.

Tue May 9, 2023

City Council - Human Resources Committee

Council to vote on board appointments and HR system updates

The Human Resources Committee will consider mayoral appointments to the Zoning Board of Appeals and Water and Sewer Commission, nominations for the Anna E. Barry School Building Commission, and a request for monthly HRIS system updates. The committee will also discuss an Open Meeting Law complaint and approve prior meeting minutes.

appointmentsboards-and-commissionshrisopen-meeting-lawschool-building
✓ Decided: Committee nominates six members for Anna E. Barry School Building Commission

The Human Resources Committee nominated six individuals for the Anna E. Barry School Building Commission and approved a mayoral appointment to the Water and Sewer Commission. The committee also authorized the Law Department to respond to an Open Meeting Law complaint.

Mon May 8, 2023

City Council - License Committee

Walmart called before council to discuss license compliance and potential penalties

The Chicopee City Council License Committee is meeting to hear from Walmart at 591 Memorial Drive regarding its current licenses. The discussion focuses on compliance with restrictions, citing excessive trash, public safety issues, and expansion concerns. The Council has the authority to modify, suspend, fine, or revoke any licenses held by the store.

licensingretailpublic-safetyzoning
✓ Decided: Walmart hearing postponed; must answer questions on trash, security, bags

The License Committee held a public hearing on Walmart's licenses due to complaints about trash, public safety, and expansion. After extensive discussion, the committee voted to postpone the item to the call of the chair, requiring Walmart to provide answers by June 8, 2023, on using paper bags, a security plan, additional fencing, tree trimming, a contact list, and a cart virtual fence.

Thu May 4, 2023

Planning Board

Walmart expansion site plan, frontage waiver on agenda

The Chicopee Planning Board will hold a public hearing on a definitive site plan for a Walmart expansion, a frontage waiver for a two-family house, and other routine items. The board will also review minutes and discuss new business.

planning-boardsite-planwalmartfrontage-waiverpublic-hearing
✓ Decided: Walmart expansion hearing tabled to June 1

The Planning Board voted 5-0 to table the Walmart expansion project hearing to June 1, 2023, at the applicant's request to address landscaping and storage trailer issues. The board also voted 5-0 to accept withdrawal of a frontage waiver application for 25-27 State St. Minutes from April 6 were approved 5-0. No other substantive decisions were made.

Thu May 4, 2023

City Council - License Committee

Council to review licenses for Royal Coach Sales, ice cream vendor, and auto shops

The Chicopee License Committee is meeting to consider several license applications and one license review. The committee will hear applications for a hawkers and peddlers license to sell ice cream, a cab driver license, an auto repair license, and an auto body license. They will also discuss licenses held by Royal Coach Sales, LLC, including a proposed address change, and may modify, suspend, fine, or revoke any of its licenses.

licensesauto-repairauto-bodyhawkers-peddlerscab-driver
✓ Decided: License Committee approves auto repair and body licenses with restrictions

The License Committee approved an auto repair license for Kins Auto Repair II and an auto body license for Chuck's Auto Body, Inc., both with specific restrictions. Two other applications were postponed, and a cab driver license was approved.

Wed May 3, 2023

Parks Commission

✓ Decided: Szot Park master plan architect selection advanced

The Commission supported Superintendent Strepka's rankings of four architect firms for the Szot Park Master Plan and advanced a recommendation to the selection committee to choose Ray Dunetz Landscape Architecture (RDLA) and Tighe & Bond (T&B) over SLR and GZA. A request from Chicopee High School to use Szot Park on June 1 for graduation ceremonies (rain date June 3) was approved. No public input was received.

Tue May 2, 2023

City Council

✓ Decided: City Council grants special permit for Burnett Road development

The City Council approved a special permit for a commercial or industrial development on Burnett Road with restrictions. The council also accepted several grants and donations and confirmed multiple mayoral appointments to city boards and commissions.

Tue May 2, 2023

City Council - Mayor's Briefing

Council to consider pay raises, donations, and appointments at briefing

The Mayor will brief the City Council on mayoral orders to be considered at the regular meeting later that evening, including accepting donations, a state award, a federal grant, and a proposed ordinance amending Chapter 7 to increase salaries for elected officials effective January 1, 2024. The Mayor will also provide general city updates.

city-councilmayor-briefingsalariesdonationsgrantsappointments
✓ Decided: City Council approves pay increases for Council and School Committee members

The City Council approved ordinance revisions to increase stipends for the Council President, Councilors, and School Committee members effective January 1, 2024. The council also approved several funding transfers for City Hall renovations and police signing bonuses.

Wed Apr 26, 2023

Parks Commission

Parks Commission to review Szot Park master plan and pool badge fees

The Chicopee Parks and Recreation Commission is holding its regular monthly meeting. They will approve bills, hear public input, and discuss maintenance and recreation reports. New business includes reviewing the Szot Park Master Plan and setting pool badge fees, while old business covers ongoing projects like the PARC Grant pool startup, Bemis Pond Dam removal, and the Lincoln Grove Inclusive Playground.

parksrecreationpool-feesmaster-planmaintenancepublic-input
✓ Decided: Parks Commission eliminates family pool badge option

The Commission approved a proposal to remove family pool badges and maintain only individual badge rates. The board also approved a field day request for the Springdale Education Center and denied a request for snack sales at city parks.

Wed Apr 26, 2023

City Council - Zoning Committee

Zoning Committee to weigh special permits, zone changes for residential and commercial projects

The Chicopee Zoning Committee will consider five applications: two special permits for a business development on Burnett Rd. and a Verizon wireless facility, plus two zone changes to allow residential development on East Street and Burnett Road. A third special permit for four residential units at 1682 Memorial Dr. has a continuance request pending. The committee will also approve prior meeting minutes.

zoningspecial-permitzone-changeresidential-developmentcommercial-developmentwireless-facilitieschicopee
✓ Decided: Zoning Committee approves business development and wireless facility

The committee approved a special permit for a commercial development on Burnett Road and a wireless facility installation. A residential project at 1682 Memorial Dr. was postponed, and a zone change for 105 East Street was discussed.

Wed Apr 26, 2023

Retirement Board

Chicopee Retirement Board to hold regular meeting and executive session

The Chicopee Contributory Retirement System will conduct a regular meeting on April 26, 2023. The agenda includes approving March minutes, reviewing monthly expense warrants, and processing various retirement-related applications.

retirementpensiongovernment-administrationchicopee
✓ Decided: Ana Gomes appointed Executive Director of Chicopee Retirement Board

The Board approved several retirement applications, membership enrollments, and pension calculations. It also appointed a new Executive Director and processed various member refunds and transfers.

Tue Apr 25, 2023

City Council - Human Resources Committee

Committee to vote on 9 mayoral appointments to boards and commissions

The Human Resources Committee will consider nine mayoral appointments to various city boards and commissions, including the Mobile Home Rent Control Board, Water and Sewer Commission, Zoning Board of Appeals, Board of Registrars, and Commission on Disability. The committee will also vote on approving minutes from two prior meetings.

appointmentsboards-and-commissionshuman-resourceszoningwater-and-sewer
✓ Decided: Human Resources Committee approves several mayoral board appointments

The committee approved multiple mayoral appointments to the Water and Sewer Commission, the Board of Registrars, and the Commission on Disability. Two appointments were postponed to the next meeting because the nominees were not present. The committee also approved minutes from March 20 and March 28, 2023.

Thu Apr 20, 2023

License Commission

✓ Decided: License Commission finds all alleged violations at The Rumbleseat unfounded

The Commission cleared The Rumbleseat of multiple alleged violations regarding intoxicated persons and occupancy limits. Several food and alcohol permits were approved, and the board agreed to allow outdoor dining for the year.

Wed Apr 19, 2023

City Council - Zoning Committee

Special permit for commercial development on Burnett Rd.

The Zoning Committee will hold a public hearing on a special permit application for a business, commercial, or industrial development on Burnett Rd. (Parcel ID Map 294, Lot 6 & Lot 7), submitted by Scannell Properties #705, LLC. The committee will also vote on approving the minutes from the March 22, 2023 meeting.

zoningspecial-permitcommercial-developmentpublic-hearing
✓ Decided: Zoning Committee reviews Tesla service center proposal for Burnett Road

The committee held a public hearing regarding a special permit application for a Tesla service facility. The applicant presented a revised site plan with a smaller building and fewer parking spaces to address traffic and size concerns. No final vote on the permit was recorded in the provided text.

Tue Apr 18, 2023

City Council

Council to vote on $10M stabilization fund transfer and other appropriations

The Chicopee City Council will consider multiple appropriations from free cash, including $10 million to the Stabilization Fund, $3 million to reduce the FY2024 tax levy, and other transfers for OPEB, capital budgeting, and departmental needs. The agenda also includes appointments to boards and commissions, several public hearing referrals, and a special permit application for a restaurant with alcohol at 181 Center Street.

budgetappropriationszoningappointmentspublic-hearingtrafficalcohol
✓ Decided: City Council approves multiple fund transfers and appropriations from free cash

The City Council approved several mayoral appropriations using Undesignated Fund Balance 'Free Cash' for stabilization, tax levy reduction, and public safety. The Council also voted to keep nominations open for the Anna E. Barry School Building Commission until May 2, 2023, requiring resumes for candidates.

Wed Apr 12, 2023

Zoning Board of Appeals

ZBA to hear appeal of denied permit for oversized garage at 501 East Main St.

The Chicopee Zoning Board of Appeals will hold a public hearing on April 12, 2023, to consider an appeal of a denied building permit, two variance requests, and other business. The board will also elect its officers for the year. The meeting is open to the public.

zoningvariancebuilding-permitparkinghousing
✓ Decided: Zoning Board approves variances for parking lot and residential lots

The Board approved two variance requests for a parking lot reconstruction and the creation of two single-family building lots. One appeal for an oversized garage was withdrawn by the applicant. The Board also voted to maintain current officer positions.

Tue Apr 11, 2023

Historical Commission

Historical Commission to hear Belcher School redevelopment, plaque, church closing

The Chicopee Historical Commission will hold a public hearing to discuss several items, including a request from Valley Opportunity Council for a new letter of support for redeveloping the former Belcher School into 20-25 apartments. The commission will also hear a presentation on a commemorative plaque for J. Stevens & Co. and discuss the closing of Holy Name of Jesus Parish and the future of its building. The agenda includes routine items like approving minutes from January 10, 2023, and new business.

historical-commissionpublic-hearingredevelopmentbelcher-schoolplaquechurch-closingholy-name-of-jesus
✓ Decided: Historical Commission approves support for Belcher School redevelopment

The Commission approved a letter of support for the Valley Opportunity Council to redevelop the former Belcher School into 20-25 apartments. Members discussed the potential demolition of the Holy Name of Jesus Parish and agreed to gather more information. The Commission also approved the minutes from the January 10, 2023 meeting.

Thu Apr 6, 2023

Dental Trust Committee

✓ Decided: Dental Trust approves 2023 rates and reconciliation report

The Dental Trust Committee voted to maintain dental rates for Fiscal Year 2023. The committee also approved the Reconciliation Report provided by HUB International.

Thu Apr 6, 2023

Planning Board

Chicopee Planning Board to weigh zone change on Burnett Rd.

The Chicopee Planning Board will hold a public hearing on April 6, 2023, to consider a zone change, ordinance amendments, a site plan waiver, and a frontage waiver. The board will also elect a new chair and review minutes from prior meetings.

zoningordinanceplanning-boardpublic-hearingsite-planwaiver
✓ Decided: Planning Board recommends several zoning and ordinance changes to City Council

The Planning Board recommended approval for a zone change on Burnett Rd and two ordinance amendments regarding permit extensions and home occupation licenses. The Board recommended denial of an ordinance amendment to extend a temporary development restriction on Burnett Rd. Additionally, the Board approved definitive site plans for outdoor storage at 301 Griffith Rd.

Wed Apr 5, 2023

Conservation Commission

Conservation Commission to decide compliance certificate for Britton St. house

The Chicopee Conservation Commission will hold a public hearing to consider a Certificate of Compliance for a single-family house at 70 Britton Street, and to discuss a field change to a stormwater detention area for the Food Bank of Western Mass. The agenda also includes routine items like approving minutes and signing bills.

conservationwetlandspermitsstormwaterpublic-hearing
✓ Decided: Commission grants partial certificate of compliance for 70 Britton Street

The Conservation Commission issued a partial certificate of compliance for a single-family house at 70 Britton Street, requiring further vegetative cover before full approval. The commission also approved the minutes from the March 1, 2023 meeting.

Tue Apr 4, 2023

City Council

✓ Decided: Chicopee City Council adopts new flag policy and commercial vehicle bans

The City Council approved a new ordinance governing the display of flags at City Hall and banned commercial vehicles from Hampshire Street, Britton Street, and New Ludlow Road. The council also approved several mayoral appropriations for water system repairs, police equipment, and city hall maintenance.

Wed Mar 29, 2023

City Council - Zoning Committee

Zoning Committee to hear three special permit applications

The Chicopee Zoning Committee will hold a public hearing on three special permit applications. Items include a digital sign at 704 Memorial Drive, a parking facility and sign at 147 and 0 Grape Street for Elms College, and a business/commercial/industrial development on Burnett Road.

zoningspecial-permitsignsparkingdevelopment
✓ Decided: Zoning Committee approves signs and parking for Elms College, postpones Tesla project

The committee approved a digital sign for 704 Memorial Drive and parking and signage improvements for Elms College. A proposal for a Tesla electric vehicle dealership and service center on Burnett Road was postponed to April 19, 2023, pending further information.

Tue Mar 28, 2023

City Council - Human Resources Committee

Council committee to review Planning Board appointment

The Human Resources Committee is meeting to consider the mayoral appointment of Cynthia Labrie to the Planning Board for a term expiring March 1, 2028. This is the sole item on the agenda, and the committee will likely vote on whether to recommend the appointment to the full City Council.

appointmentplanning-boardhuman-resources
✓ Decided: Human Resources Committee approves Cynthia Labrie to Planning Board

The Human Resources Committee approved the mayoral appointment of Cynthia Labrie to the Planning Board. Her term in this office expires on March 1, 2028.

Tue Mar 28, 2023

Parks Commission

Parks Commission to review field use requests and park projects

The Chicopee Parks and Recreation Commission is meeting to approve bills, hear public input, and discuss communications including requests for park use. They will also review maintenance and recreation reports, and address old business such as the PARC grant, Bemis Pond Dam removal, and pool improvements, along with new business on firework bids and pickleball courts.

parksrecreationpermitsmaintenanceconstruction
✓ Decided: Parks Commission approves Central Maine Pyro for 2023 fireworks

The Commission approved several requests for park use by schools, sports leagues, and community organizations. It also accepted a bid for the city's fireworks display and reviewed ongoing park maintenance and recreation programs.

Tue Mar 28, 2023

City Council - Ordinance Committee

Committee to vote on flag display rules, bulky waste, and ballot question

The Ordinance Committee is discussing and voting on several items: a new ordinance regulating which flags the City may display on its flagpoles, an amendment to the bulky waste pickup program, a ballot question for November 2023 on snow/ice removal from private ways, and three commercial vehicle exclusion orders for Hampshire Street, Britton Street, and New Ludlow Road. The committee will also approve minutes from February 15, 2023.

ordinanceflagsbulky-wasteballot-questionsnow-removalcommercial-vehiclestraffic
✓ Decided: City Council Ordinance Committee approves new flag display guidelines

The committee approved an ordinance establishing that City Hall flagpoles are for official government speech rather than a public forum. It also approved updated language for the residential curbside bulk pickup program and three commercial vehicle exclusions for specific streets.

Thu Mar 23, 2023

City Council - Public Safety Committee

Council to discuss one-way street, disaster preparedness, pedestrian safety

The Public Safety Committee will meet to discuss three items: a recommendation on making Old Lyman Road one-way, a review of disaster preparedness and city inventory with the Emergency Management Director, Fire Chief, and Police Chief, and a pedestrian safety plan from the DPW Superintendent. The meeting is scheduled for March 23, 2023, at 6:30 PM in Council Chambers and via Zoom.

public safetytrafficdisaster preparednesspedestrian safety
✓ Decided: Public Safety Committee requests cost analysis to widen Old Lyman Road

The committee voted to request a full cost analysis from the DPW to determine the expense of widening Old Lyman Road to allow for two-way traffic. The road currently remains a one-way street due to safety concerns regarding its narrow width. The committee also discussed disaster preparedness and pedestrian safety on Chicopee Street.

Wed Mar 22, 2023

City Council - Zoning Committee

Chicopee Zoning Committee to weigh home bakery license, two zone changes

The Chicopee Zoning Committee will meet to consider a home occupation license for a baking business and two zone change applications for residential developments. Both zone change applicants have requested continuances, which the committee will consider. The committee will also review minutes from its February 22, 2023 meeting.

zoninghome-occupationoverlay-districtresidential-developmentpublic-hearing
✓ Decided: Zoning Committee approves home baking license and continues two development requests

The committee approved a home occupation license for a baking business at 82 9th Avenue. Two applications for Mill Conversion and Commercial Center Overlay Districts were continued to April 26, 2023. The committee also approved the February 22, 2023, meeting minutes.

Wed Mar 22, 2023

Retirement Board

Chicopee Contributory Retirement Board monthly meeting

The Board will conduct its regular monthly meeting to review administrative and membership items. The agenda includes the approval of previous meeting minutes and monthly expense warrants.

retirementgovernment-administrationfinance
✓ Decided: Retirement Board approves new memberships, retirements, and fund transfers

The Board approved membership for 12 individuals and processed retirement applications for four employees. It also authorized several fund transfers to other retirement systems and approved staff attendance at the 2023 Spring MACRS Conference.

Wed Mar 22, 2023

Retirement Board

Chicopee Retirement Board discusses cost of living increase

The Chicopee Contributory Retirement Board is holding a special meeting to discuss the cost of living increase for fiscal year 2024. The meeting is scheduled for March 22, 2023, at City Hall.

retirementfinancegovernment-operations
✓ Decided: Retirement Board approves 3% cost of living adjustment for July 2023

The Retirement Board met to address a cost of living adjustment based on PERAC Memo #4/2023. The board voted to increase the Cost of Living Adjustment to 3% effective July 1, 2023.

Tue Mar 21, 2023

City Council

Chicopee Council to vote on veteran, senior property tax breaks

The Chicopee City Council will consider several property tax relief measures for veterans and seniors, including increasing exemptions and reducing interest on deferred taxes. The council will also vote on a $640,043.82 state grant for the East Main Street resurfacing project, appointments, and various ordinances and license matters.

budgettaxesveteransseniorspublic-workslicensesappointments
✓ Decided: City Council approves veteran tax relief and $640K road grant

The City Council approved several property tax exemptions for seniors and veterans and accepted a $640,043.82 MassDOT grant for East Main Street resurfacing. The council also confirmed multiple board appointments and referred a license review for Walmart to the License Committee due to trash and safety concerns.

Mon Mar 20, 2023

City Council - Human Resources Committee

Committee to vote on 5 mayoral appointments to boards and commissions

The Human Resources Committee will consider five mayoral appointments to various city boards and commissions, including the Mobile Home Rent Control Board, Electric Light Commission, Veterans Advisory Board, Commission on Disability, and Zoning Board of Appeals. The committee will also vote on approving the minutes from its February 15, 2023 meeting.

appointmentsboards-and-commissionshuman-resourcescity-council
✓ Decided: Human Resources Committee approves five mayoral board appointments

The committee approved five mayoral appointments to various city boards and commissions. The committee also approved the minutes from the February 15, 2023 meeting.

Thu Mar 16, 2023

License Commission

License Commission to review liquor permits, food licenses, and renewals

The Chicopee License Commission is meeting to consider several license applications, including a name change for AMF bowling, new common victualer licenses for Sazon Latino and Popeye's, and new mobile food vendor licenses. They will also review special one-day beer/wine permits for events hosted by the Friends of the Chicopee Senior Citizens, and annual renewals for various establishments. The agenda includes public input, minutes, and routine administrative items.

licensesalcoholfoodrenewalspublic-hearing
✓ Decided: License Commission approves multiple food and beverage permits

The License Commission approved several new common victualer and mobile food licenses. The board also granted three special one-day beer and wine permits for senior citizen events and approved several 2023 license renewals.

Wed Mar 8, 2023

Zoning Board of Appeals

ZBA to hear appeal on Hastings St. four-family, State St. lot variances

The Chicopee Zoning Board of Appeals will hold a public hearing on March 8, 2023, to consider an appeal of a building commissioner's decision and two variance requests. The board will also review minutes from the previous meeting and discuss old/new business.

zoningvarianceappealhousingbuilding-code
✓ Decided: ZBA allows 11-13 Hastings St. to remain a four-family dwelling

The Zoning Board of Appeals approved an appeal to keep a property at 11-13 Hastings St. as a legally non-conforming four-family dwelling, provided it is brought up to current Building Code. The Board also accepted the withdrawal of two variance requests for properties on State Street and Empire Street.

Tue Mar 7, 2023

City Council

Council to vote on $438K police cruiser purchase and TIF for UFP Site Built

The Chicopee City Council will consider multiple appropriation orders, including $438,132.86 for police cruisers and other capital purchases, and will vote on a Tax Increment Financing (TIF) agreement for UFP Site Built, LLC at 304 Griffith Road. The council will also review zoning special permits, license applications, and committee reports.

budgetpolicezoningtax-increment-financinglicensespublic-works
✓ Decided: City Council approves TIF agreement for UFP Site Built, LLC

The City Council approved a Tax Increment Financing (TIF) agreement for UFP Site Built, LLC and Griffith Road Property Owner, LLC to create 60 jobs. The Council also denied the purchase of 350 Memorial Drive for school offices and rejected a garage special permit at 19 Dale Street.

🏢 Building at this address: 5 m tall
Mon Mar 6, 2023

City Council - Public Works Committee

Council committee to review East Main Street striping change

The Public Works Committee is meeting to review a proposed road line striping change for East Main Street. The agenda also includes approval of minutes from a prior meeting. No other substantive items are listed.

public-worksroadsstripingeast-main-street
✓ Decided: Public Works Committee approves road line striping changes for East Main Street

The committee approved a proposal to repave and reduce two lanes to one on a section of East Main Street from the American Legion Memorial Bridge to the Springfield city line. The decision includes a condition to extend the lane striping to accommodate a resident's driveway access. The committee also approved the November 14, 2022, meeting minutes.

Thu Mar 2, 2023

Dental Trust Committee

Dental Trust Committee to review FY2022 claims and finances

The Chicopee Dental Trust Committee is meeting to review prior meeting minutes, introduce a new Schools Human Resource Director, and discuss the FY 2022 claims history and financial results for the Dental Trust and the Health Reimbursement Account (MERP). The agenda is routine and contains no votes or public hearings.

dental-trusthealth-benefitsfinancemeeting-minutespersonnel
Thu Mar 2, 2023

Planning Board

Chicopee Planning Board to hear Walmart expansion, storage facility, and more

The Chicopee Planning Board will hold a public hearing on March 2, 2023, to consider several site plans and waivers. Items include a Walmart expansion, a new self-storage facility, a frontage waiver for a two-family house, and endorsement of an as-built subdivision plan. The meeting is open to the public in person and via Zoom.

planning-boardzoningsite-planwaiversubdivisionpublic-hearing
✓ Decided: Planning Board approves site plans for Walmart addition and new self-storage facility

The Board approved preliminary site plans for a Walmart addition and definitive site plans for a new self-storage facility on Shawinigan Dr. It also endorsed the As-Built Subdivision Plan for Stockbridge Estates and approved two Acts No Regulation (ANR) filings. A request to waive preliminary site plan requirements for Walmart was denied.

🏢 Building at this address: Friendly's · 4 m tall
Wed Mar 1, 2023

Conservation Commission

Conservation Commission to hear sewer project amendment

The Chicopee Conservation Commission will hold a public hearing to discuss an amended order for the South Fairview Sewer Separation and Water Replacement Project, which involves modifying about 250 linear feet of sanitary sewer alignment near 184 James St. The meeting also includes approval of previous minutes, signing bills, and discussion of upcoming projects.

conservationpublic-hearingsewerwetlandsconstruction
✓ Decided: Commission approves amended order for South Fairview sewer and water project

The Conservation Commission approved an Amended Order of Conditions for the South Fairview Sewer Separation and Water Replacement Project. The amendment allows for additional sanitary sewer alignment and alterations to the Terrace Escarpment Soils Buffer Zone. The commission also approved the minutes from the February 1, 2023 meeting.

Mon Feb 27, 2023

Retirement Board

Chicopee Retirement Board to review expense warrants and retirement calculations

The Chicopee Contributory Retirement Board will hold its regular monthly meeting on February 27, 2023. The board is scheduled to approve minutes from January, review expense and payroll warrants, and discuss retirement calculations and membership applications.

✓ Decided: Retirement Board approves memberships, retirements, and equipment purchase

The Board approved several new system memberships, retirement applications, and member refunds. It also authorized the purchase of a new paper folding machine and decided how to handle a billing discrepancy with MTRS.

Mon Feb 27, 2023

City Council - License Committee

License Committee reviews 7 license applications and 3 license reviews

The Chicopee License Committee is reviewing applications for auto repair, detailing, sales, and hawkers/peddlers licenses, and will also review existing licenses held by United Sons Auto Sales, Royal Coach Sales, and Wicked Cycles, with possible modification, suspension, fines, or revocation. The agenda is mostly routine license matters, with no major policy decisions.

licensesauto-repairauto-saleshawkers-peddlerslicense-review
✓ Decided: License Committee approves multiple auto business and vendor licenses

The License Committee approved several applications for auto repair, detailing, and sales licenses with specific operational restrictions. The committee also approved a hawker's license for ice cream sales and modified existing licenses for businesses at 576 East Street.

Thu Feb 23, 2023

City Council - Finance Committee

Council weighs buying 350 Memorial Drive for school offices

The Finance Committee is considering the School Committee's request to purchase property at 350 Memorial Drive for school administration offices. The committee will discuss the request and seek answers to questions about space needs, appraisal, retrofit costs, maintenance costs, and whether ESSER funds can be used. The item is also being sent to the Education Committee for separate discussion. The agenda also includes approval of minutes from the previous meeting.

schoolsproperty-purchasefinanceadministration
✓ Decided: Finance Committee denies support for purchase of 350 Memorial Drive

The Finance Committee voted to deny a motion supporting the School Committee's request to purchase 350 Memorial Drive for administrative offices. The committee also voted to place a separate request to send the matter to the Finance and Education Committees on file. Minutes from the February 1, 2023 meeting were approved.

Wed Feb 22, 2023

City Council - Zoning Committee

Zoning Committee to review three special permit requests

The Chicopee Zoning Committee will hold a public meeting to review three special permit applications: a garage as a principal structure, a single-family home conversion to a two-unit multifamily, and a new pole sign with requested waivers. The committee will also approve minutes from the previous meeting.

zoningspecial-permithousingsignagepublic-hearing
✓ Decided: Zoning Committee approves multifamily conversion and new pole sign

The committee approved a special permit to convert a single-family home into a two-unit multifamily home and granted waivers for a new pole sign. A request for a garage as a principal structure was denied due to the applicant's failure to provide plans and allow property inspections.

🏢 Building at this address: 5 m tall
Wed Feb 22, 2023

Parks Commission

Parks Commission to consider book bins, field use requests, and new parking rule

The Chicopee Parks and Recreation Commission is meeting to review requests for park and field use, including book bins, flag and tackle football, a 5K run, a soccer clinic, and spring field use. They will also discuss maintenance, recreation programs, old business like the PARC grant and Bemis Pond dam removal, and a proposed rule against overnight parking in park lots.

parksrecreationfield-useeventsparkingmaintenance
✓ Decided: Parks Commission bans overnight parking in park lots

The Commission approved a new rule prohibiting overnight parking in park lots to allow police enforcement. Several requests for park use by youth sports and community groups were approved, while a movie filming request was tabled.

Tue Feb 21, 2023

City Council

Council to vote on $285k in stabilization fund transfers and surplus land sales

The Chicopee City Council will consider eight mayoral appropriations totaling $285,224.71 from the Stabilization Fund for various accounts including golf equipment, police and fire indemnifications, vehicles, and fire overtime. The Council will also vote on declaring 13 parcels on Ames Avenue and Riverview Terrace as surplus or encroachments to be sold to abutters, and will hear reports on several appointments and ordinance changes.

budgetzoningordinancepublic-safetyappointmentssurplus-propertynoiseballot-question
✓ Decided: Chicopee City Council approves several funding appropriations and parking changes

The City Council approved multiple mayoral appropriations for golf course equipment, public safety overtime, and legal services. New ordinances were passed regarding noise levels for boom boxes, increased city code fines, and specific parking prohibitions on Beaudry Avenue and Bourbeau Street. Several zoning and permit applications were referred to committees for further review.

Thu Feb 16, 2023

License Commission

License Commission to hear nip bottle ban, manager change, and 2023 renewals

The Chicopee License Commission is meeting to discuss a City Council proposal to ban nip bottles, hold hearings for Lucky Strike and Gnow's Place, and consider a change of manager for Applebee's. The commission will also review 2023 license renewals for several businesses, including common victualer, lodging house, and innholder licenses, along with filing fees and hearing policies.

licensesalcoholrenewalsnip-bottlespublic-hearingsbusiness
✓ Decided: License Commission approves several business renewals and manager change

The Commission approved a change of manager for Applebee’s and an amusement license for Atlas Pub. Several common victualer, lodging house, and innholder renewals were approved. The board also discussed a proposed city-wide ban on nip bottles and updated its hearing and deliberation policies.

Wed Feb 15, 2023

City Council - Human Resources Committee

Council committee reviews four mayoral appointments to boards

The Human Resources Committee is reviewing four mayoral appointments to local boards and commissions, plus minutes from a prior meeting. The appointments are for the Mobile Home Rent Control Board, the Electric Light Commission, and the Zoning Board of Appeals. The committee will likely vote to recommend these appointments to the full City Council.

appointmentsboards-and-commissionsmobile-home-rent-controlelectric-lightzoning
✓ Decided: Human Resources Committee approves Lester Gagne to Rent Control Board

The committee approved the mayoral appointment of Lester Gagne to the Mobile Home Rent Control Board. Three other mayoral appointments were postponed to the call of the chair. The committee also approved the minutes from January 24, 2023.

Wed Feb 15, 2023

Planning Board

Planning Board to review Open Meeting Law complaints about Feb. 2 meeting

The Chicopee Planning Board is holding a special meeting to review and respond to two Open Meeting Law complaints filed about its February 2, 2023 meeting. The complaints were submitted by Councilor Derek Dobosz and resident Glenn LaPlante. No other business is on the agenda; the board will adjourn to its next regular meeting on March 2.

planning-boardopen-meeting-lawcomplaintspublic-meeting
✓ Decided: Planning Board authorizes response to Open Meeting Law complaints

The Board reviewed two Open Meeting Law complaints regarding a February 2, 2023 meeting. The Board decided that no further hearings were warranted and authorized the Associate City Solicitor to draft a response to the complainants and the Massachusetts Attorney General.

Wed Feb 15, 2023

City Council - Ordinance Committee

Chicopee committee to weigh intern positions, flag rules, noise limits

The Ordinance Committee will consider several proposed ordinance changes, including adding intern positions to multiple city departments, establishing rules for flag displays at City Hall, updating bulky waste pickup rules, and setting decibel limits for noise. The committee will also discuss placing a ballot question about snow and ice removal from private ways on the November 2023 ballot, review the tag sale policy, and act on several parking and traffic orders.

ordinanceinternsflagsnoisebulky-wasteparkingballot-question
✓ Decided: Ordinance Committee increases illegal dumping fines and updates noise rules

The committee approved higher fines for illegal dumping and updated decibel limits for unreasonable noise. Several items, including a proposed flag display ordinance and a ballot question regarding private road plowing, were postponed for further review.

Wed Feb 8, 2023

Zoning Board of Appeals

✓ Decided: ZBA tables appeal regarding four-family dwelling at 11-13 Hastings St.

The Zoning Board of Appeals tabled an appeal to retain a property as a four-family dwelling pending more information from the Building Commissioner and City Assessor’s Office. The board also approved the minutes from the January 11, 2023 meeting.

Tue Feb 7, 2023

City Council

Council to vote on $4.49M grant, $200K signal funds, and Uniroyal demolition

The Chicopee City Council will consider multiple appropriations from the Stabilization Fund, including $200,000 for signal maintenance, $150,000 for parks water, and $158,000 plus $70,000 for Uniroyal building remediation/demolition. They will also vote on accepting a $4.49 million state grant for nitrogen reduction, a $500,000 earmark for library improvements, and several smaller donations. The agenda includes zoning special permits, ordinance changes (e.g., alcohol bottle size, noise, bulky waste), and appointments to boards.

budgetzoningpublic-safetyinfrastructureordinancegrantsappointments
✓ Decided: City Council approves multiple DPW appropriations and zoning permits

The City Council approved several Mayor's appropriations for DPW maintenance, Uniroyal building remediation, and HR modernization. The board also granted special permits for outside storage at 301 Griffith Road and a digital sign at 603 New Ludlow Road, while accepting over $4.5 million in state and federal grants.

Thu Feb 2, 2023

Planning Board

Planning Board to weigh two zone changes for residential projects

The Chicopee Planning Board will hold a public hearing on two zone change requests to apply the Mill Conversion and Commercial Center Overlay District to properties on Burnett Rd. and East St. for residential development. The board will also review a tabled site plan for a carwash, a Walmart expansion, and other administrative items.

zoningplanning-boardresidential-developmentsite-planpublic-hearing
✓ Decided: Planning Board recommends two overlay district zone changes to City Council

The Planning Board recommended approval for two residential development overlay districts and approved a modified site plan for a carwash. Two property transfer requests were approved, while a Walmart expansion site plan was tabled.

🏢 Building at this address: 4 m tall
Wed Feb 1, 2023

Conservation Commission

✓ Decided: Commission approves East Main Street resurfacing project

The Conservation Commission issued determinations for the resurfacing of East Main Street from the Veteran’s Memorial Bridge to the Springfield city line. The project involves cold-planing, adjusting utility structures, and new pavement overlay. The Commission also approved the minutes from the January 18, 2023 meeting.

Wed Feb 1, 2023

City Council - Finance Committee

Council to approve $100K law expense transfer and discuss mobile home park finances

The Finance Committee will consider appropriating $100,000 from the stabilization fund to the law expense account for special services. The committee will also discuss financial issues related to Bluebird Acres Mobile Home Park and review minutes from two prior meetings.

budgetfinancemobile-home-parkappropriation
✓ Decided: Finance Committee approves $100,000 for Law Expense Account

The Finance Committee approved a $100,000 appropriation from the Stabilization Fund for special legal services. The committee also voted to place a discussion regarding Bluebird Acres Mobile Home Park on file and approved minutes from two 2022 meetings.

Thu Jan 26, 2023

Planning Board

Planning Board to respond to Open Meeting Law complaint

The Chicopee Planning Board is holding a special meeting to review and respond to an Open Meeting Law complaint filed by Councilor Derek Dobosz regarding the board's January 5, 2023 meeting. The agenda contains only this complaint review and adjournment, with the next regular meeting scheduled for February 2, 2023.

planning-boardopen-meeting-lawcomplaintpublic-hearing
✓ Decided: Planning Board finds no Open Meeting Law violation

The Planning Board reviewed a complaint from Councilor Derek Dobosz regarding a lack of public comment at a January 5 meeting. The Board determined no violation occurred and authorized the City Law Department to send a formal response.

Wed Jan 25, 2023

Mobile Home Rent Control Board

Mobile home rent control board to hear two rent increase requests

The Chicopee Mobile Home Rent Control Board is meeting to approve prior minutes and hold hearings on rent increase requests from Holiday Circle and Kon Tiki Village. The board will also address old and new business.

mobile-homerent-controlrent-increasepublic-hearing
✓ Decided: Board schedules hearing for Holiday and Kon Tike rent increase requests

The Board approved the minutes from three previous 2022 meetings. Members voted to schedule a hearing for January 25, 2023, to determine if rent increases for Holiday and Kon Tike should be approved.

Wed Jan 25, 2023

City Council - Zoning Committee

Zoning Committee to weigh 5 special permits, including signs, storage, garage, and cell tower

The Chicopee Zoning Committee will review five special permit requests, each with requested waivers from zoning rules. Items include a new digital sign, a pole sign, increased outdoor storage, a garage as a principal structure, and a small wireless facility. The committee will also approve minutes from a prior meeting.

zoningspecial-permitsignsstoragewireless
✓ Decided: Zoning Committee approves digital sign and industrial storage expansion

The committee approved a special permit for a digital sign at 603 New Ludlow Road and an increase in outside storage for a business at 301 Griffith Road. A request for a garage as a principal structure at 19 Dale Street was postponed, and a wireless facility application was withdrawn.

Wed Jan 25, 2023

Retirement Board

Chicopee Retirement Board to hold regular monthly meeting and executive session

The Chicopee Contributory Retirement Board is meeting for its regular monthly business, including approval of minutes, expense and payroll warrants, and an executive session. The board will also discuss accidental disability applications, a PERAC memo on COLA, retirement calculations, refunds, transfers, and other administrative items.

✓ Decided: Retirement Board approves disability application and schedules COLA vote

The Board approved an accidental disability retirement application for a Housing Authority manager and scheduled a special meeting for March 22, 2023, to vote on a 3.0% cost of living adjustment. Two other disability applications were tabled pending legal opinions. The Board also approved 20 new system memberships and several retirement calculations.

Wed Jan 25, 2023

Retirement Board

Retirement Board to vote on FY2023 cost of living increase

The Chicopee Contributory Retirement Board is holding a special meeting to discuss and decide on a cost of living increase for fiscal year 2023, retroactive to July 1, 2022. The agenda contains only this single substantive item.

retirementcost-of-livingpensionchicopee
✓ Decided: Retirement Board increases COLA for eligible retirees to 5%

The Board voted to increase the Cost of Living Adjustment (COLA) for all eligible retirees to 5% for Fiscal Year 2023. This action is retroactive to July 1, 2022, following the signing of Chapter 269 of the Acts of 2022. The increase will be processed in the February 2023 pension payroll.

Wed Jan 25, 2023

Mobile Home Rent Control Board

Mobile home rent board to hear two rent increase requests

The Chicopee Mobile Home Rent Control Board will meet to approve minutes from October 2022 and hold public hearings on rent increase requests from Holiday Circle and Kon Tiki Village. The meeting is open to the public in person and via Zoom.

mobile-homerent-controlpublic-hearingchicopee
✓ Decided: Board schedules hearing for Holiday and Kon Tike rent increases

The Board scheduled a hearing to determine if rent increases for Holiday and Kon Tike should be approved. The Board also approved minutes from three previous 2022 meetings.

Wed Jan 25, 2023

Mobile Home Rent Control Board

Mobile home rent board to hear two rent increase requests

The Chicopee Mobile Home Rent Control Board is meeting to approve prior minutes and hold public hearings on rent increase requests from Holiday Circle and Kon Tiki Village mobile home parks. The agenda also includes old and new business items. This is a regular meeting with substantive rent-related decisions on the table.

mobile-homesrent-controlpublic-hearinghousing
Tue Jan 24, 2023

City Council - Human Resources Committee

Council committee to vote on appointments to boards and commissions

The Human Resources Committee is meeting to consider appointments to several city boards and commissions. The agenda includes nominations to the Board of Health Commission, Zoning Board of Appeals, and Planning Board, plus approval of prior meeting minutes.

appointmentsboardscommissionszoningplanninghealth
✓ Decided: Human Resources Committee approves four board appointments

The committee approved the appointments of Ernest Mathieu and Janet Ely to the Board of Health Commission, Theresa Devlin to the Zoning Board of Appeals, and Nathan Moreau to the Planning Board. One appointment to the Zoning Board of Appeals was postponed.

Tue Jan 24, 2023

ARPA Committee

ARPA Committee reviews funding proposals and project updates

The Chicopee ARPA Advisory Committee is meeting to review administrative updates, project status reports, and new funding proposals, including DPW matching funds, a non-profit program for Harmony House, and ChicopeeWORKS. They will also receive updates on prior proposals such as Bellamy House, Economic Development/Business Assistance, and Delta Park Infrastructure. The agenda is largely procedural, with no specific dollar amounts or decisions listed.

arpafundingcommunity-developmentinfrastructurenon-profit
✓ Decided: ARPA Committee approves funding for Nitrogen Reduction and Harmony House

The committee approved matching funds for a Nitrogen Reduction project and a $25,000 award to Harmony House for capital improvements and operating costs. A funding request for ChicopeeWORKS was determined to be ineligible. The committee also reviewed the status of the Bellamy House rehab and economic development webinars.

Tue Jan 24, 2023

Parks Commission

Parks Commission to review event permits, pool projects, and budget transfers

The Chicopee Parks and Recreation Commission is meeting to discuss routine business, including approving minutes, hearing public input, and reviewing communications. They will consider requests for park use, including a motor vehicle awareness walk, a BSA picnic, and softball field use. The commission will also receive updates on maintenance, recreation programs, and old business items such as the PARC grant, Bemis Pond dam removal, and the Lincoln Grove playground project, as well as new business including fireworks and budget transfers.

parksrecreationpermitspoolfireworksmaintenance
✓ Decided: Parks Commission approves June 24 fireworks and budget transfers for water costs

The Commission approved several event requests for Szot Park and set the 2023 fireworks date. It also authorized budget transfers to cover increased water costs and updated the warrant signing process under the Municipal Modernization Act.

Thu Jan 19, 2023

License Commission

License Commission to weigh new eatery licenses and noise complaints

The Chicopee License Commission is meeting to discuss noise complaints, review hearing procedures, and consider applications for new and renewed licenses. New applications include a common victualer license for Hot Table and a mobile common victualer license for La Taqueria Del Pueblo, plus a change of D/B/A for Paddy's 733. The commission will also review 2023 renewals for numerous establishments and updates on previously approved applications.

licensesalcoholfood-servicenoiserenewalspublic-hearing
✓ Decided: License Commission approves multiple food and lodging license renewals

The Commission approved several new and renewal applications for common victualer, mobile victualer, and lodging licenses. Members discussed updating hearing procedures to allow cross-examination and reviewed the standard process for noise complaints.

Wed Jan 18, 2023

Conservation Commission

Chicopee Conservation Commission to hear car wash proposal near wetland

The Chicopee Conservation Commission will hold a public hearing on a request for a determination of applicability (RDA) for a 4,201-square-foot automatic car wash at Chicopee Crossing, 530 Memorial Dr. The project may involve site work within the buffer zone of a bordering vegetated wetland. The commission will also review prior meeting minutes and discuss upcoming projects.

conservationwetlandscar-washpublic-hearingchicopee
✓ Decided: Commission approves determinations for new automatic car wash at 530 Memorial Dr.

The Conservation Commission approved several determinations for the construction of a 4,201 SF automatic car wash at Chicopee Crossing. The project includes site work within a Buffer Zone to a Bordering Vegetated Wetland. The commission also approved the minutes from the December 21, 2022 meeting.

Tue Jan 17, 2023

City Council

Council to vote on $250K water chemical transfer and multiple appointments

The Chicopee City Council will consider several mayoral appropriations, including $250,000 for water chemicals, plus smaller transfers for wastewater, asset management, and a copier. The council will also vote on appointments to boards and confirm grants for fire education programs. Several license renewals and ordinance changes, including a home occupation ordinance rewrite, are on the agenda.

budgetappointmentsgrantslicenseszoningordinance
✓ Decided: City Council approves minimum wage increase to $15.00

The City Council ordained a minimum wage increase to $15.00 for several city employee groups. The council also approved multiple mayoral appropriations for water and purchasing accounts and confirmed the re-appointment of the Associate City Solicitor.

Wed Jan 11, 2023

Zoning Board of Appeals

ZBA to hear request to expand outdoor storage at 301 Griffith Rd

The Chicopee Zoning Board of Appeals will hold a public hearing on a variance request to increase outdoor storage at 301 Griffith Rd from 7,531+/- SF to 238,406+/- SF. The board will also review minutes from the November 9, 2022 meeting and discuss old/new business before adjourning.

zoningvariancepublic-hearingoutdoor-storage
✓ Decided: ZBA approves outdoor storage variance for 301 Griffith Rd

The Zoning Board of Appeals approved a variance to increase outdoor storage at 301 Griffith Rd for the manufacturing of roof trusses. This approval is contingent upon the City Council granting a required Special Permit. The board also approved the minutes from November 9, 2022.

Tue Jan 10, 2023

City Council - Ordinance Committee

Ordinance Committee to consider $15 minimum wage for city workers

The Ordinance Committee is meeting to discuss revisions to Chapter 7 of the city ordinances, specifically a minimum wage increase to $15.00 per hour effective January 1, 2023, for certain employee groups. The committee will also review minutes from previous meetings.

minimum-wagecity-employeesordinancewages
✓ Decided: Ordinance Committee approves minimum wage increase to $15.00

The committee approved revisions to Chapter 7 to increase the minimum wage to $15.00 effective January 1, 2023. This change affects several city groups, including the Council on Aging, Library, and Parks & Recreation. The committee also approved minutes from previous meetings.

Tue Jan 10, 2023

City Council - Human Resources Committee

Council committee to review two Planning Board appointments

The Human Resources Committee is meeting to consider two mayoral appointments to the Planning Board: Jay Paul and Nathan A. Moreau, both for terms expiring January 3, 2028. The committee will also review minutes from its December 13, 2022 meeting.

appointmentsplanning-boardcity-councilhuman-resources
✓ Decided: Human Resources Committee approves Jay Paul to the Planning Board

The committee approved the mayoral appointment of Jay Paul to the Planning Board. The appointment of Nathan A. Moreau was postponed, and the minutes from December 13, 2022, were approved.

Tue Jan 10, 2023

Historical Commission

Historical Commission to revisit cell tower support letter for 939 Chicopee Street

The Chicopee Historical Commission is holding a public hearing to consider a support letter for a proposed cellular monopole at 939 Chicopee Street, tabled from December 13, 2022. The City Council granted a Special Permit for the tower on September 8, 2022. The agenda also includes approval of prior meeting minutes and general discussion, with no other substantive items listed.

historical-commissioncell-towerpublic-hearingspecial-permitchicopee
✓ Decided: Historical Commission approves support letter for 939 Chicopee Street cell tower

The Historical Commission voted to issue a letter of support for a proposed 120-foot cellular monopole at 939 Chicopee Street. The commission also approved the minutes from the December 13, 2022 meeting.

Thu Jan 5, 2023

Planning Board

Planning Board to review Walmart expansion at 545 Memorial Dr.

The Chicopee Planning Board will hold a public hearing on a site plan with waiver for a 6,315 square foot addition to the existing Walmart building at 545 Memorial Dr., including restriping of merchandise pickup parking stalls. The agenda also includes approval of ANRs, minutes from December 1, 2022, and new business discussion.

planning-boardsite-planwalmartcommercial-developmentpublic-hearing
✓ Decided: Planning Board tables WalMart building addition hearing

The Planning Board voted to postpone a hearing regarding a proposed addition to a WalMart building. The board also approved the minutes from the December 1, 2022 meeting.

Tue Jan 3, 2023

City Council

Council to vote on fire grants, COLA increase, and planning board appointments

The Chicopee City Council will consider accepting state and in-kind donations, appropriating funds for fire equipment and ambulances, and approving a 5% COLA increase for the retirement system. It will also confirm two new Planning Board appointments and vote on several ordinance changes and license renewals.

grantsbudgetretirementappointmentsordinancelicenses
✓ Decided: City Council approves 5% COLA increase for retirees

The City Council approved a 5% cost of living adjustment for the Chicopee Retirement System for fiscal year 2023. The council also accepted fire department grants and appropriations for equipment and ambulances, and approved several business license renewals.