The Boring PartsFederalLocal · USLocal · Canada
Westfield, MA

Westfield public meetings in 2024

491 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Tue Dec 24, 2024

Conservation Commission

December 24 Conservation Commission meeting cancelled

The Conservation Commission meeting scheduled for December 24, 2024, has been cancelled. The next scheduled meeting will be held on January 14, 2025.

conservationmeeting-cancellationwestfield
Fri Dec 20, 2024

Retirement Board

Retirement board to review investments, contracts, and routine approvals

The Westfield Retirement Board will hold a regular meeting to review monthly investment performance, consider any recommended changes, and approve bills, minutes, and retirement applications. The board will also discuss an office contract renewal and conduct annual review calls with five investment firms.

retirementinvestmentsboardpensioncontractreviewfinance
✓ Decided: Retirement Board approves investment changes and FY25 appropriation

The Westfield Contributory Retirement Board approved several financial and administrative actions, including redeeming $4 million from an S&P 500 index fund and reallocating midcap funds to create a combo portfolio. They also approved the final FY25 appropriation bill, new member enrollments, refunds/transfers, and a one-year contract renewal for Ray Depelteau.

Thu Dec 19, 2024

City Council

Council to consider $600,000 for Broad Street design and South Maple/Mill Street improvements

The Westfield City Council will vote on several appropriations from Free Cash, including $600,000 for Broad Street design and $599,929 for a new fire apparatus to replace Engine 2, plus $295,865 for a loader at the transfer station. The council will also hold public hearings for a limo license and junk dealer licenses, and consider a resolution opposing a lithium battery storage facility, a police staffing increase, and various ordinance amendments.

budgetfire-departmentinfrastructurepublic-safetyfree-cashzoninglithium-battery
✓ Decided: Council adopts resolution opposing battery storage facility over aquifer

The Westfield City Council adopted a resolution urging the Massachusetts Department of Public Utilities to reject a proposed lithium battery storage facility on Medeiros Way, citing risks to the aquifer and environmental justice concerns. The council also approved a $50,000 appropriation for the Broad Street redesign, accepted the ValleyBike bike share memorandum of understanding, and increased police staffing from 66 to 70 sworn officers. Several other items were referred to committees or removed without action.

Thu Dec 19, 2024

City Council

City Council to hold public hearing on limousine license application

The Westfield City Council will hold a public hearing to consider a limo license application. The meeting has been moved to a Zoom format.

licensingtransportationpublic-hearing
Thu Dec 19, 2024

City Council License Committee

License committee to review junk dealer license for Elm Art and Antiques

The License Committee will consider a junk dealer and collector license application for Elm Art and Antiques LLC at 30 Elm Street. The meeting will be held via Zoom due to the City Hall elevator being out of service. This is the only substantive item on the agenda.

licensesjunk-dealerbusiness-licenseselm-streetwestfieldcity-councilcommittee-meeting
Thu Dec 19, 2024

City Council Governmental Relations Committee

Governmental Relations Committee meeting canceled

The City Council Governmental Relations Committee meeting scheduled for December 19, 2024, has been canceled.

city-councilgovernment
Wed Dec 18, 2024

Traffic Commission

Westfield Traffic Commission meeting canceled

The Westfield Traffic Commission meeting scheduled for December 18, 2024, has been canceled. No items were discussed or decided.

meeting-cancelledtraffic-commission
Wed Dec 18, 2024

City Council Legislative and Ordinance Committee

Committee reviews police staffing increase and lithium battery facility opposition

The Legislative and Ordinance Committee is discussing a range of city ordinances, street acceptances, and inter-municipal agreements. Key items include a proposal to increase police staffing and a potential resolution opposing a lithium battery storage facility.

policezoningpublic-safetyinfrastructureordinancestransportation
✓ Decided: Committee recommends police staffing increase from 66 to 70 officers

The Legislative and Ordinance Committee voted 2-0 to send a letter of intent to increase Police Department staffing from 66 to 70 sworn officers to the City Council with a positive recommendation. The committee also recommended several other items, including street acceptances for Caitlin Way, Pheasant Drive, and Scenic Road, and a preservation restriction for Central Baptist Church. The ValleyBike share program MOU with Northampton was sent forward with a negative recommendation.

Tue Dec 17, 2024

Commission for Citizens with Disabilities

Commission to elect officers, discuss elevator and traffic signal

The Commission for Citizens with Disabilities will meet to approve minutes from November 19, review a Fine and Forfeits account update, and discuss old business including accessibility impacts of the Town Hall elevator and a traffic signal update. New business includes election of officers for Chair, Vice Chair, and Secretary.

disabilitiesaccessibilitytown-hall-elevatortraffic-signalelection-of-officerscommission-meetingwestfield
✓ Decided: Commission elects 2025 officers, reviews accessibility projects

The Commission for Citizens with Disabilities elected officers for 2025, approved prior minutes, and reviewed updates on accessibility projects. No new funding was approved; the commission discussed a potential $3,855 contribution for additional crosswalk signals but deferred a decision. The elevator at City Hall is scheduled for maintenance outages.

Tue Dec 17, 2024

City Council Finance Committee

Finance Committee to consider $50,000 for Broad Street redesign

The City Council Finance Committee will consider a $50,000 appropriation from Free Cash for the redesign and resurveying of Broad Street. The meeting includes public participation and routine procedural items.

financebudgetinfrastructurestreetswestfield
✓ Decided: Council approves $50K for Broad Street redesign with parking

The Finance Committee approved a $50,000 appropriation from Free Cash to fund the redesign and resurveying of Broad Street, which will add street parking and adjust the bike lane layout. The redesign reduces parking from 42 to 31 spaces and moves the curb inward about 4 feet. The motion passed 3-0.

Tue Dec 17, 2024

Westfield Cultural Council

Westfield Cultural Council meeting cancelled

The meeting scheduled for December 17, 2024, has been cancelled. The next meeting is scheduled for January 21, 2025.

proceduralcancellation
Tue Dec 17, 2024

City Council Personnel Action Committee

Committee to consider reappointment of Joseph Muto to Community Preservation Committee

The Personnel Action Committee will discuss and vote on the reappointment of Joseph Muto to the Community Preservation Committee for a term expiring in July 2027. No other substantive items are on the agenda.

city-councilpersonnelappointmentscommunity-preservation
✓ Decided: Committee recommends reappointing Joseph Muto to Community Preservation Committee

The Personnel Action Committee voted 2-0 to recommend the reappointment of Joseph Muto to the Community Preservation Committee for a term expiring in July 2027. The committee also approved the meeting minutes and adjourned. No other substantive decisions were made.

Tue Dec 17, 2024

Planning Board

Planning Board to review warehouse and residential lot permits

The Planning Board will hold public hearings on several special permit applications for residential lots and a large warehouse. The board will also discuss battery storage facility comments and draft state ADU regulations.

zoningindustrial-developmenthousingspecial-permitsadu
✓ Decided: Planning Board approves special permits for new homes on Roosevelt Ave and Russellville Rd

The Westfield Planning Board approved two special permits: one for a new single-family home at 49 Roosevelt Ave with lot size averaging and a reduced side yard, and another for a flag lot at 222 Russellville Rd. Both approvals were unanimous (5-0). The board also continued a hearing for a warehouse project and discussed state ADU regulations.

Mon Dec 16, 2024

Westfield Airport Commission

Airport commission to interview firm for office lease, possible vote

The Westfield Airport Commission will hold a special meeting to interview Savvy Source of East Windsor, CT regarding RFQ 25-011 for leasing office space in Terminal Building Room #115. A vote on the lease may follow.

airportleasecommissionwestfield
✓ Decided: Airport Commission approves new lease for Savvy Source in Terminal Room 115

The Westfield Airport Commission voted unanimously to approve a new lease with Savvy Source for office space in Terminal Building Room 115, conditional on approval by the City of Westfield legal department. The company, which processes paperwork for various businesses, plans to use the office at least one day a week and aims to eventually serve aviation clients. No public comments were made during the meeting.

Mon Dec 16, 2024

School Committee Subcommittee

Proposed changes to graduation requirements for Westfield High and Technical Academy

The Instruction & Curriculum Subcommittee will discuss proposed changes to graduation requirements for Westfield High School and Westfield Technical Academy, along with graduation data and a physical education exemption. An update on the Comprehensive Health and Physical Education curriculum frameworks is also scheduled.

educationgraduation-requirementscurriculumphysical-educationhealth-educationschool-committeewestfield
✓ Decided: School subcommittee reviews graduation requirement increases for Westfield High and Tech Academy

The Instruction & Curriculum Subcommittee met and reviewed proposed increases to graduation requirements for Westfield High School and Westfield Technical Academy, including additional math, health, electives, computer science, world language, and science credits. They also discussed a proposed elimination of the physical education sports exemption at Westfield High School and reviewed the CHPE curriculum frameworks update. No formal votes were taken; the items were only discussed and received.

Mon Dec 16, 2024

Parks and Recreation Commission

Commission to consider memorial bench at Cross Street Playground

The Parks and Recreation Commission will discuss a request to approve a memorial bench at the Cross Street Playground ballfield area in memory of Jeff Piper, a volunteer coach. The board will also hear from the Law Department on commissioner duties, review renewal permits for 2025 events (Babe Ruth, Veterans, church events), and consider the schedule of bills and staff reports.

parksrecreationmemorial-benchpermitslegal-adviserwestfield
✓ Decided: Commission approves memorial bench at Cross Street playground

The Parks and Recreation Commission voted unanimously to approve a request from Joyce Piper-McClean to place a black bench with a plaque in memory of her son, Jeff Piper, at Cross Street playground. The commission also received legal guidance on volunteer work and donations, emphasizing that private groups cannot perform unlicensed work on city property and must follow procurement and ADA rules. No other substantive decisions were made.

Mon Dec 16, 2024

School Committee

School Committee to vote on Custodian Association contract and teacher agreement

The Westfield School Committee will meet to consider several labor agreements and school facility updates. The body is deciding on a Custodian Association contract and a Memorandum of Agreement with the Westfield Education Association Unit A.

labor-contractsschool-facilitieseducation-administrationbudget
✓ Decided: School Committee approves custodian contract, tables teachers MOA

The Westfield School Committee approved the Custodian Association contract for July 1, 2022 to June 30, 2025, and tabled a Memorandum of Agreement with the Westfield Education Association Unit A (teachers) to the February 3, 2024 meeting. The committee also approved several routine items, including meeting minutes, home school applications, school trips, and special revenue accounts.

Mon Dec 16, 2024

Historical Commission

Historical Commission to review Atwater Mansion certificate, plan ghost tours

The Westfield Historical Commission is holding a special meeting to discuss a Certificate of Historic Review for Atwater Mansion, an update on the Wyben Schoolhouse, and scheduling of 2025 lecture dates. They will also prepare for upcoming ghost tours on January 30 and 31. New business and setting the next agenda are also on the docket.

historical-commissionhistoric-reviewatwater-mansionwyben-schoolhouseghost-tourslectures
✓ Decided: Historical Commission accepts minutes, advances schoolhouse and mansion projects

The Westfield Historical Commission met on December 16, 2024, and approved the November meeting minutes. No substantive decisions were made; the meeting focused on updates and planning for ongoing projects, including the Atwater Mansion certificate, One Room Schoolhouse restoration, and 250th anniversary planning.

Mon Dec 16, 2024

School Committee

School Committee to discuss custodian and teacher union contracts in executive session

The Westfield School Committee will hold an executive session to discuss collective bargaining strategy with the Westfield Custodian Association and the Westfield Education Association/Unit A (teachers). The committee will also approve minutes from a prior executive session. No open session will follow this closed meeting.

school-committeeexecutive-sessioncollective-bargainingteachers-unioncustodians-unionwestfield-public-schools
Thu Dec 12, 2024

Westfield Airport Commission

Airport Commission to vote on Gary Hoover lease assignment, review FY2025 budget

The Westfield Airport Commission will consider a possible vote on the Gary Hoover lease assignment and review the FY2025 budget. Updates will be provided on the AVGAS self-service fuel facility project and the Vector aircraft landing fee program. The commission will also discuss the noise program, including soundproofing mitigation and land re-use plan, and note an upcoming electric aircraft charging station ribbon cutting.

airportleasesbudgetfuellanding-feesnoiseelectric-vehiclespublic-meetings
✓ Decided: Airport Commission approves hangar lease assignment to new tenants

The Westfield Airport Commission approved assigning the Gary Hoover hangar lease to Steve Hayden and Steve Mello, following Hoover's passing. The commission also reviewed updates on the AVGAS fuel project, landing fee collections, and the FY2025 budget, but took no other formal votes.

Thu Dec 12, 2024

Westfield Technical Academy

WTA Aviation Board discusses new FAA airframe & powerplant certification

The Westfield Technical Academy Aviation Advisory Board will review the program's recent FAA certification as an Airframe and Powerplant High School, obtained on October 10, 2024, and discuss a new hangar feasibility study, student internships, and grant updates. The board will also consider a designated mechanic examiner application and plans for adult A&P education starting this winter.

aviationeducationfaaairframe-and-powerplanthangarinternshipsgrantswestfield
Wed Dec 11, 2024

Board of Health

Westfield Board of Health December 11 meeting cancelled

The regular Board of Health meeting scheduled for December 11, 2024, has been cancelled. The next regular meeting is set for January 22, 2025, at 6:00 p.m.

healthmeeting-cancellation
Wed Dec 11, 2024

Community Development

Community listening sessions on 2025-2029 HUD plan

Westfield's Office of Community Development is holding two listening sessions on Dec 11, 2024, to gather public input on community needs and affordable housing initiatives. The input will inform the 2025-2029 Consolidated Plan for federal Community Development Block Grant (CDBG) and HOME Investment Partnerships Program funds. Applications for CDBG funding will become available starting Dec 30, 2024.

community-developmenthousingcdbghomeconsolidated-planpublic-hearing
Tue Dec 10, 2024

Westfield Housing Authority

Public hearing on Annual Plan; low bid approvals for Dolan Chimney Roofs and Windows

The Westfield Housing Authority will hold a public hearing on its Annual Plan, then consider approval of the plan and low bids for work at Dolan properties. Committee reports, quarterly operating statements, and bill payments will also be reviewed. Old business includes modernization updates, an audit report, and an M&T Bank update.

housingpublic-hearingannual-planlow-bidsmodernizationwestfield
✓ Decided: Westfield Housing Authority approves $180K in Dolan building repairs

The Westfield Housing Authority approved its Annual Plan for submission to EOHLC, accepted low bids for roof/chimney repairs ($70,500) and window replacement ($109,750) at the Dolan building, and hired a search firm for a new executive director. All votes were unanimous (4-0).

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
to accept the Low Bid of $109,750.00 to Larochelle Construction, Inc, Unanimous vote 4 to 0. Ayes: Murphy, Mulligan, Murray, Carmichael. 5. Executive Director — All voting done under Old Business…
3 yea
Murphy yea · Mulligan yea · Murray yea
Tue Dec 10, 2024

Franklin Avenue Project School Building Committee Meeting

School Building Committee to hear updates on Franklin Avenue Project

The Westfield School Building Committee will meet to receive updates from the Owner Project Manager and architect on the Franklin Avenue Project. The committee will also consider approving minutes from September 10, 2024, and discuss future meeting schedules. Public participation is allowed for up to 15 minutes.

school-buildingfranklin-avenue-projectwestfieldpublic-schoolscommittee-meeting
Tue Dec 10, 2024

Conservation Commission

Conservation Commission to hold hearing on new warehouse at 0 Ampad Road

The Commission will hold a public hearing regarding a proposed warehouse and railroad spur. The body will also address four enforcement orders for wetlands and floodplain violations.

wetlandszoningenvironmentwarehouseenforcement
✓ Decided: Conservation Commission approves warehouse with rail spur at 0 Ampad Road

The Commission closed the public hearing and issued an Order of Conditions approving the proposed warehouse and railroad spur at 0 Ampad Road, with special conditions and a $35,000 bond. It also amended an enforcement order for 233 Union Street, requiring removal of fill and hiring an environmental consultant. The 300 Union Street enforcement case was continued to January 28, 2025, and the 265 Union Street case was continued to January 14, 2025.

Tue Dec 10, 2024

Board of Assessors

Board of Assessors to review tax abatements and Chapter 61 recertification

The Board of Assessors will meet to approve monthly abatement and commitment reports. The board will also consider a 10-year Chapter 61 recertification for a property. An executive session is scheduled to discuss abatement and exemption applications.

taxesassessmentschapter-61abatements
✓ Decided: Board accepts November abatement reports, signs Chapter 61 recertification

The Board of Assessors met and approved the minutes from the November 13, 2024 meeting. They also accepted the November monthly abatement/commitment reports and signed a Chapter 61 recertification for 1376 Southampton Rd. No public participation or old business was reported, and the board entered executive session.

Mon Dec 9, 2024

Police Commission

December 9 Police Commission meeting canceled

The Westfield Police Commission meeting scheduled for December 9, 2024, has been canceled. No items were discussed or decided.

police-commissionmeeting-cancelledwestfield-ma
Mon Dec 9, 2024

License Commission

Commission to approve 2025 licenses and hear two liquor store transfers

The License Commission will consider several applications for amendments and transfers of liquor licenses, including two public hearings to transfer package store licenses. They will also hold informational hearings on overdue tax obligations and a police incident report, and vote on the 2025 seasonal population increase and the approval of all liquor, common victualler, entertainment, and coin-operated licenses for the coming year.

liquor-licenseslicense-transferspublic-hearings2025-licenseselks-clubpolice-incidenttax-obligations
✓ Decided: License Commission approves multiple liquor license transfers and amendments

The Westfield License Commission unanimously approved several liquor license transfers and amendments, including transfers for Minas Wine and Spirits and Westfield Liquors, and amendments for Pleasant Street Market. It also approved 2025 license renewals for numerous businesses, with conditions for some pending certificates of good standing or tax forms. The commission filed several police incident reports and discussed auto dealership inspections.

Mon Dec 9, 2024

City Council

Council to consider zoning amendments to allow accessory dwelling units and increase housing capacity

The City Council will hold a public hearing on zoning amendments to permit accessory dwelling units and boost housing capacity, and consider a separate continued hearing for a rezoning at 1295 Southampton Road. Other actions include accepting grant funds for airport obstruction removal, appropriating over $289,000 from free cash for opioid settlement purposes, and authorizing an increase in police staffing from 66 to 70 sworn officers. The council will also take final votes on street layout orders for Jeanne Marie Drive and Camelot Lane, and an ordinance banning engine brakes with a $300 fine.

zoninghousingpolicebudgetgrantsairportpublic-safetyinfrastructure
✓ Decided: Council funds airport runway safety, opioid programs, dam design

The City Council accepted grants for airport runway obstruction removal and easements, appropriated funds for opioid settlement programs and Powdermill Brook Dam design, and passed several street layout orders. A zoning amendment for duplexes on Southampton Road was withdrawn without prejudice, and a resolution opposing a battery storage facility over the aquifer was referred to committee.

Mon Dec 9, 2024

City Council

Public hearing on junk dealer license for Elm Art and Antiques

The City Council will hold a public hearing to discuss and decide on a junk dealer and junk collector license application for Elm Art and Antiques, LLC, located at 30 Elm Street, submitted by John Hanley.

public-hearingbusiness-licensingjunk-dealerwestfield
Mon Dec 9, 2024

City Council Governmental Relations Committee

Governmental Relations Committee meeting cancelled

The meeting scheduled for December 9, 2024, was cancelled. It has been rescheduled for December 19, 2024, at 6:30 PM.

governmentbudgetsalaries
Thu Dec 5, 2024

City Council

Westfield City Council reschedules Dec 5 meeting to Dec 9

The City Council's regularly scheduled meeting on December 5, 2024 has been rescheduled to Monday, December 9, 2024 at 7:00 PM. This agenda contains only this date-change notice; no substantive items are listed for discussion or action.

city-councilschedule-changewestfield
Wed Dec 4, 2024

City Council Legislative and Ordinance Committee

Council committee to consider parking ban on Sibley Avenue and Falley Drive

The Legislative and Ordinance Committee will meet December 4 to discuss several items including a parking prohibition on Sibley Avenue and Falley Drive, street acceptance petitions for Jeanne Marie Drive and Janelle Drive, and a resolution for a Gateway Pocket Park. They will also consider approval of speed limits on Western Avenue and ordinance amendments affecting Facilities Management and Purchasing Departments.

streetsparkingtransportationordinancesparksfacilities-managementpurchasing
✓ Decided: Committee recommends accepting Jeanne Marie and Janelle Drives

The Legislative and Ordinance Committee voted to send a positive recommendation to the City Council for accepting Jeanne Marie Drive and Janelle Drive as public streets. It also recommended approval of a speed regulation for Western Avenue and parking restrictions on Sibley Avenue and Falley Drive. The Gateway Pocket Park agreement was kept in committee, and the Facilities Management ordinance amendments were removed without action.

Wed Dec 4, 2024

Municipal Light Board

Light Board to discuss General Manager compensation study and receive quarterly reports

The Municipal Light Board will hold a regular meeting on December 4, 2024, addressing action items including a commercial account presentation, a public power month drawing, a fleet inventory report, and an energy stabilization funds quarterly report. New business includes a verbal discussion on a General Manager compensation study requested by Commissioner Roman. The meeting also covers informational utility updates and customer communications.

municipal-light-boardemployee-compensationfleet-managementenergy-stabilization-fundsutility-reportspublic-powerwestfield
Wed Dec 4, 2024

Off-Street Parking Commission

Parking Commission to vote on reduced December enforcement and Santa photo permit

The Off-Street Parking Commission will hold a special meeting to discuss and possibly vote on reducing parking enforcement in December. They will also consider a permit for Mr. Peter Colo to take Santa photos on the Elm Street Plaza for charity. The agenda includes approval of monthly bills.

parkingenforcementpermitseventswestfieldmassachusetts
Wed Dec 4, 2024

Council On Aging

Westfield Council on Aging Strategic Plan Sub-Committee meeting

The Strategic Plan Sub-Committee is meeting to organize the group and discuss the strategic plan. The discussion will focus on reviewing the mission, vision, and core values.

strategic-planningseniorsgovernment-administration
Tue Dec 3, 2024

City Council Finance Committee

Finance Committee to review funding for Broad Street and Powdermill Brook Dam

The City Council Finance Committee will discuss several appropriations from Free Cash and the Stabilization Account. The meeting includes reviews of funding for infrastructure projects and the acceptance of an aviation grant.

budgetinfrastructureaviationpublic-safetyroads
Tue Dec 3, 2024

Planning Board

Planning board to discuss battery storage facility zoning exemption and street acceptance

The Westfield Planning Board will hold a regular meeting with no public hearings. They will discuss a street acceptance petition for Big Wood Drive and a notice from the Mass. Dept. of Public Utilities regarding a proposed battery energy storage facility at Medeiros Way that seeks a zoning exemption. Additionally, the board will conduct a workshop to review master plan action items, the open space plan update, possible zoning amendments including accessory dwelling units, and updates to subdivision regulations.

planning-boardzoninghousingaccessory-dwelling-unitsenergy-storagemaster-planopen-spacesubdivision-regulations
Tue Dec 3, 2024

Board of Public Works

Board to discuss and vote on development at 0 Lockhouse Road

The Board of Public Works commissioners will hold a meeting on December 3, 2024, to discuss and vote on a development proposal at 0 Lockhouse Road by TV Realty & Development. They will also revote on accepting Edward Street and Gifford Avenue as public ways. The agenda includes a monthly DPW report, approval of bills, and public participation opportunities.

public-worksroadsdevelopmentland-usewestfield
Tue Dec 3, 2024

Animal Control

Dangerous dog hearing for German Shepherd involved in multiple incidents

The Westfield Animal Control is holding a public hearing to determine whether 'Puppy', a Sable German Shepherd, should be classified as a dangerous dog following incidents on Jefferson Street, Hampden Street, Fowler Street, and an unspecified location.

animal-controldangerous-dogpublic-hearing
Mon Dec 2, 2024

School Committee Subcommittee

Subcommittee to discuss MSBA Statement of Interest for Westfield schools

The Facilities/Capital Planning Subcommittee will meet to discuss a Massachusetts School Building Authority Statement of Interest covering Westfield Technical Academy and Westfield High School. This is the only substantive item on the agenda, following public participation.

educationschool-facilitiescapital-planningmsbawestfieldschool-committee
Mon Dec 2, 2024

School Committee

School Committee to take second reading of non-discrimination and Title IX policies

The Westfield School Committee will hold a regular meeting on December 2, 2024, at 7:00 pm in City Council Chambers. They will recognize Coach Moose Matthews, receive presentations on Westfield High School and MCAS/Accountability data, and consider second readings of several policies, including non-discrimination and Title IX procedures. The agenda also includes approval of two high school trips, budget transfers, and updates from the superintendent and mayor.

school-committeepoliciesnon-discriminationtitle-ixbudgetmcasfield-tripsrecognition
Tue Nov 26, 2024

City Council

Council to consider $1M appropriation from free cash to reduce FY25 tax rate

The City Council will act on a mayoral request to appropriate $1,000.000.00 from Free Cash to the Fund Balance Reserve for Expenditures Account to lower the FY25 tax rate. A vote on the final Fiscal Year 2025 tax rate is also on the agenda as unfinished business.

budgettaxesfinanceappropriationsfree-cashtax-rate
Tue Nov 26, 2024

Conservation Commission

Conservation Commission to review warehouse proposal and multiple enforcement orders

The Commission will hold public hearings on a new warehouse facility and a permit amendment. The body will also address seven separate enforcement orders regarding wetland and floodplain violations. Additionally, the Commission will discuss ordinance revisions and drone flyover observations.

wetlandszoningenvironmentwarehouseenforcement
Mon Nov 25, 2024

Historical Commission

Westfield Historical Commission to review Atwater Mansion certificate

The Historical Commission will meet to discuss several ongoing preservation projects and updates. The body is reviewing a Certificate of Historic Review for the Atwater Mansion and discussing progress on the National Historic Registry.

historic-preservationlandmarkscity-planningcommunity-events
Thu Nov 21, 2024

City Council

City Council to hold public hearing on Fiscal Year 2025 tax levy percentages

The City Council is holding a special meeting for a single public hearing. The body will discuss the determination of local tax levy percentages for different classes of real and personal property for Fiscal Year 2025.

taxesbudgetpublic-hearingfiscal-year-2025
Thu Nov 21, 2024

City Council

Public hearing on zoning change at 1295 Southampton Rd.

The City Council will hold a public hearing to consider a petition from Plumrose Development LLC to rezone 1295 Southampton Rd. from Rural Residential to Residential B.

zoningpublic-hearingdevelopment
Thu Nov 21, 2024

City Council

Westfield City Council to vote on Fiscal Year 2025 Tax Rate

The City Council will vote on the FY2025 tax rate and hold a public hearing regarding a zoning amendment for 1295 Southampton Road. The body will also consider several grant acceptances and appropriations for infrastructure and public safety projects.

tax-ratezoninginfrastructuregrantspublic-safety
Thu Nov 21, 2024

City Council Finance Committee

Finance Committee to accept $150,000 grant for drinking water improvements

The Finance Committee will consider accepting a $150,000 grant from the Massachusetts Department of Environmental Protection for the Drinking Water State Revolving Fund, appropriating $150,000 from Community Preservation accounts for restoration of the Westfield Woman’s Club building, and transferring $13,429.41 from Engineering Construction funds to pay a prior year bill from Gomes Construction. The committee will also vote on minutes from previous meetings and hold public participation.

financegrantsdrinking-waterhistoric-preservationcommunity-preservationappropriationspublic-works
Wed Nov 20, 2024

City Council Legislative and Ordinance Committee

Council to consider $200k federal grant for Vision Zero safety plan

The Legislative and Ordinance Committee will discuss a resolution to accept a $200,000 Safe Streets for All grant from the Federal Highway Administration to support the Vision Zero strategy. Other items include a proposed $300 fine for engine brake violations, street acceptance for Camelot Lane and Jeanne Marie Drive, and a host community agreement with Cannabis Connection, Inc. The committee will also consider a 20-year lease for a billboard at Main and Mechanic Streets and amendments to chapters governing Facilities Management and Purchasing.

policetrafficgrantscannabiszoningparkingbudget
Wed Nov 20, 2024

Off-Street Parking Commission

Commission to vote on food truck license, holiday event applications for Elm Street Plaza

The Off-Street Parking Commission will hold its monthly meeting, receiving updates on the Elm Street Plaza, maintenance, and the FY25 budget from Community Development Director Peter Miller. The commission will consider and vote on three applications: the Mayor's Office request for the Annual Tree Lighting Ceremony (Nov 30), the Annual Community Menorah Lighting (Dec 29), and a food truck license for Danis Slivka DBA OMG Coffee to operate at Elm Street Plaza and Riverfront Lot. The meeting also includes approval of December's meeting date, minutes from October 16, and monthly bills.

parking-commissionwestfieldelm-street-plazafood-truck-licenseholiday-eventscommunity-developmentbudgets
Tue Nov 19, 2024

Commission for Citizens with Disabilities

Commission to discuss emergency preparedness, approve minutes

This meeting of the Westfield Commission for Citizens with Disabilities includes routine items: approval of prior meeting minutes, an account update on fines and forfeits, and discussion of ongoing projects (zine project and NAMI). The new business item on emergency preparedness may be of interest to residents. The agenda is largely procedural with no specific proposals or votes listed.

disabilitiesemergency-preparednesszine-projectminutesprocedural
Tue Nov 19, 2024

Planning Board

Planning Board to consider zoning map amendment for 1295 Southampton Rd.

The Westfield Planning Board will hold a regular meeting with multiple public hearings and possible decisions. Key items include a petition to rezone 1295 Southampton Rd. from Rural Res. to Res. B, special permits for a flag lot, lot size averaging for two-family dwellings, an aviation fuel facility at the airport, and a warehouse exceeding 100,000 square feet. The board will also review plans not requiring subdivision approval and approve previous meeting minutes.

zoningplanning-boardpublic-hearingspecial-permitdevelopmentairportwarehousesubdivision
Tue Nov 19, 2024

Westfield Cultural Council

Westfield Cultural Council to vote on grants

The Westfield Cultural Council will meet to conduct voting for grants. The body will also review and approve the treasurer's report and the minutes from the October 21 meeting.

grantsarts-and-culturewestfield
Tue Nov 19, 2024

Retirement Board

Retirement Board to review investments and approve routine items

This is a regular meeting of the Westfield Retirement Board with a standard agenda. The board will conduct annual review calls with investment managers Wasatch, IR+M, and PIMCO, review monthly performance, and consider any recommended changes. Other routine business includes approving bills, minutes, retirement applications, disability applications, and the third of three FY25 appropriation bills.

retirementpensioninvestmentsboardadministrativewestfield
Tue Nov 19, 2024

Board of Registars

Board to count late-arriving federal write-in absentee ballots from Nov. 5 election

The Board of Registrars will meet to count Federal Write-In Absentee Ballots (FWAB) from the November 5, 2024 State Election that were postmarked internationally by November 5 and received by November 15. The board will also introduce new member Maureen M. Peterson and authorize use of Board of Registrar stamps for 2025. The meeting is largely procedural, focused on election administration tasks.

electionsvotingabsentee-ballotsboard-of-registrarswestfieldcity-government
Mon Nov 18, 2024

License Commission

License Commission to consider manager changes for three liquor license holders

The Westfield License Commission will hold a regular meeting to approve minutes, hear applications for liquor license amendments, and review auto dealership licenses. Key actions include proposed manager changes for Pleasant Street Market, Walmart #2174, and the Elks Lodge, as well as a previously approved one-day liquor license for the Westfield Woman's Club. The commission will also discuss requirements for dealer inspections and review police incident reports.

liquor-licensesauto-dealershipspublic-hearinglicense-commissionwestfield
Mon Nov 18, 2024

Parks and Recreation Commission

Commission to vote on $2,925 in skatepark donations; pickleball court updates

The Parks and Recreation Commission will vote to accept four skatepark donations totaling $2,925 from individuals and Skyline Beer Co. They will also hear updates on municipal pickleball court stone work, approved permits for school events at Bullens and Jachym fields, and a December legal training session for board members. The meeting includes public participation, approval of October minutes, and scheduling of bills.

parksrecreationskateparkdonationspickleballpermitslegalschool-events
Mon Nov 18, 2024

School Committee

School Committee to discuss custodians' collective bargaining in executive session

The Westfield School Committee will hold an executive session on November 18, 2024, to approve prior meeting minutes and discuss strategy regarding collective bargaining or litigation with the Westfield Custodian Association. The meeting will not reconvene in open session. This is a procedural executive session with no public discussion.

school-committeeexecutive-sessioncollective-bargainingwestfield-custodian-associationminutes-approval
Mon Nov 18, 2024

School Committee

School Committee to vote on private school approvals, policy changes

The Westfield School Committee will consider approving three private schools for the 2024-2025 school year and take final action on a non-discrimination policy. Also on the agenda are presentations from Westfield Technical Academy and an update on Fort Meadow Early Childhood Center, along with multiple policy readings and grant acceptances.

school-committeeeducationprivate-schoolspolicynon-discriminationfield-tripsgrantswestfield
Mon Nov 18, 2024

Council On Aging

Council on Aging to consider shifting senior center hours to 8am-4pm

The Westfield Council on Aging will discuss and possibly decide on changing senior center hours to 8am-4pm effective January during its November 18, 2024 meeting. Other items include a strategic plan update, nutrition policy review, staffing vacancy updates, and a transportation grant update. The public may participate for up to 15 minutes.

senior-centercouncil-on-aginghoursstaffingstrategic-plannutritiontransportation
Thu Nov 14, 2024

Westfield Airport Commission

Westfield Airport Commission to vote on MassDOT grants and lease agreements

The Commission will consider votes on three MassDOT Aeronautics Division state grants and two lease agreements. The meeting includes updates on the AVGAS self-service fuel facility and the ANG Final Environmental Impact Statement.

aviationgrantsleasesnoise-mitigationinfrastructure
Thu Nov 14, 2024

Westfield Technical Academy

Westfield Technical Academy auto advisory committee to review ASE accreditation

The Automotive Technology Advisory Committee at Westfield Technical Academy is meeting to discuss standard operational topics, including student enrollment, co-op and internship opportunities, budget, tools and equipment, and the upcoming ASE accreditation and five-year review. No specific decisions or dollar amounts are on the agenda; the meeting is primarily for information sharing and discussion.

educationvocationalautomotiveadvisoryaccreditationbudgetinternships
Thu Nov 14, 2024

Westfield Technical Academy

Culinary Arts Program Advisory Committee discusses pricing and equipment

The committee is meeting to review program updates, including student certifications and inspection results. Members will discuss potential price increases or portion reductions for Tiger’s Pride and catering events.

educationculinary-artspublic-healthgrantsvocational-training
Wed Nov 13, 2024

Board of Assessors

Board to approve October abatement and commitment reports

The Board of Assessors will consider approving the October monthly abatement and commitment reports, receive an update from the City Assessor on office matters and classification review, and hold an executive session to discuss abatement and exemption applications.

board-of-assessorsproperty-assessmentsabatementsclassificationexecutive-session
Wed Nov 13, 2024

Board of Health

Board of Health to discuss landfill billboard lease and tobacco fines

The Board of Health will review a proposal to enter a new lease for billboards at the landfill. The meeting also includes a presentation on the Naloxone Education Initiative and a discussion on tobacco fines and renewals.

public-healthlandfilltobacco-regulationsubstance-use
Wed Nov 13, 2024

City Council Personnel Action Committee

Personnel committee to vote on Porter reappointment to Community Preservation Committee

The Personnel Action Committee will consider and vote on reappointing William Porter to the Community Preservation Committee for a term expiring July 2026. The meeting consists of a single substantive item beyond procedural calls to order and adjournment.

appointmentscommunity-preservationpersonnelwestfield
Tue Nov 12, 2024

Police Commission

Police Commission to discuss raising hiring age limit from 31 to 39

The Police Commission is holding a special meeting to consider two policy changes: raising the maximum age for new police hires from 31 to 39, and establishing a payment policy for special police officers and traffic control attendants called to work during emergencies or special events. They will also approve minutes from October 30 and present a plaque to retired Chief Lawrence Valliere.

policehiringage-eligibilitycompensationspecial-eventswestfieldpublic-safety
Tue Nov 12, 2024

Board of Registars

Board to count late-arriving mail ballots from Nov. 5 election

The Board of Registrars will meet to count qualified mail ballots from the November 5, 2024 State Election that were received after Election Day but by November 8, 2024, as long as they were postmarked by November 5. This is a routine post-election process required by state law.

electionballot-countingboard-of-registrarswestfield
Tue Nov 12, 2024

Conservation Commission

Commission to hear proposal for new warehouse and railroad spur at 0 Ampad Road

The Westfield Conservation Commission will hold public hearings on wetland-related proposals, including a new warehouse and railroad spur at 0 Ampad Road and an amendment for a driveway at 104 Russellville Road. The commission will also address multiple enforcement orders for violations such as unauthorized fill, tree clearing, and construction within buffer zones. Additionally, they will discuss an extension request for a trailer park at 858 Southampton Road and open a public comment period on ordinance revisions starting November 15.

conservationwetlandspublic-hearingenforcementzoningwestfieldwarehousebuffer-zone
Mon Nov 11, 2024

Police Commission

Westfield Police Commission meeting rescheduled to November 12

The meeting originally scheduled for Monday, November 11, 2024, has been rescheduled. It will now take place on Tuesday, November 12, 2024, at 4:30 pm in the City Hall Council Chambers.

policescheduling
Fri Nov 8, 2024

Retirement Board

Retirement Board shifts $20M in portfolio, adding small-cap and mid-cap funds

The Westfield Retirement Board is holding an emergency meeting to discuss and approve a series of portfolio reallocations totaling $20 million. The proposed changes involve reducing positions in SSGA TIPS, SSGA EAFE, S&P 500, and Russell 1000, while adding to SSGA Russell 2000 Value Index, SSGA Russell 2000 Index, Wasatch Small Cap Value, S&P MidCap 400, and S&P Equal Weighted.

retirement-boardinvestmentspension-fundportfolio-rebalancingwestfield
Thu Nov 7, 2024

City Council

Council to consider $225K elevator repair, cannabis host agreement, and no-right-turn-on-red ordinance

The City Council will vote on several appropriations and resolutions, including $225,000 from free cash for City Hall elevator repairs, a $150,000 state grant for drinking water, and $150,000 in Community Preservation Act funds for the Westfield Woman's Club building restoration. Other items include a host agreement with Cannabis Connection Inc., a 20-year billboard lease at Main and Mechanic Streets, a $300 fine for engine brake infractions, acceptance of a $200,000 Safe Streets for All grant, and a second reading of a No Right Turn on Red ordinance.

budgetpublic-workshistoric-preservationcannabistransportationtraffic-safetygrants
Thu Nov 7, 2024

City Council Personnel Action Committee

Committee to vote on Mark Dargie for Youth Commission seat

The Personnel Action Committee is meeting to consider the appointment of Mark Dargie to the Youth Commission, replacing Diana McLean, for a term expiring in December 2025. No other substantive business is on the agenda.

personnelappointmentsyouth-commissionwestfield
Thu Nov 7, 2024

Westfield Redevelopment Authority

WRA to vote on grant for Riverfront District pre-development assistance

The Westfield Redevelopment Authority will discuss and possibly vote on accepting a Community One-Stop for Growth Real Estate Technical Services Grant for pre-development work in the Riverfront District, and on authorizing an expenditure for a CoStar real estate data subscription. The meeting also includes approval of previous minutes and a financial summary.

redevelopmentgrantsriverfront-districtreal-estatewestfieldmassachusetts
Wed Nov 6, 2024

Emergency Planning Committee

Westfield emergency planning committee to discuss drill, grants, event rules

The Westfield Local Emergency Planning Committee will meet on November 6, 2024 at 9:00 a.m. at WFD Station 2 (366 Little River Road). The agenda includes updates from various departments, discussion of grant funds, and creating a standardized process for city events. A notable item is a discussion of an emergency drill with WG&E.

emergency-planningpublic-safetycity-eventsgrantsemergency-drillwg-epolicefire
Wed Nov 6, 2024

City Council Legislative and Ordinance Committee

Committee reviews $300 engine brake fine and $200,000 federal grant

The Legislative and Ordinance Committee is reviewing a proposed fine for engine brake infractions and a resolution to accept a federal grant for the Vision Zero Strategy. The body will also discuss ordinance amendments regarding the Purchasing and Facilities Management Departments.

traffic-safetygrantsordinancespolicecity-management
Wed Nov 6, 2024

Municipal Light Board

Board to discuss strategic plan and budget in executive session

The Municipal Light Board will review quarterly executive session minutes, financial projections, and rate comparisons, and consider accepting $64,407.32 in state grants for EV charging. New business includes a possible presentation on a commercial account seminar and discussion of a DPU notice of probable violation. The board will then enter executive session to discuss trade secrets related to the 2025-2034 strategic plan and budget.

light-boardmunicipal-utilityelectricgrantsbudgetstrategic-planev-chargingrates
Wed Nov 6, 2024

Zoning Board of Appeals

Board to hear variance request for rooming farm help dwelling at 948 Granville Rd.

The Westfield Zoning Board of Appeals will hold a public hearing on a request for a variance, special permit, and site plan approval to construct a new dwelling for rooming farm help at 948 Granville Road. The board will also discuss a request for extension of previously granted variances for 20 Broad Street. Other agenda items include review of new applications and approval of meeting minutes.

zoningboard-of-appealspublic-hearingvariancespecial-permitsite-planwestfield
Mon Nov 4, 2024

School Committee Subcommittee

W. Mass. school subcommittee to weigh MSBA statement of interest for two schools

The Facilities/Capital Planning Subcommittee of the Westfield School Committee will meet to discuss a Massachusetts School Building Authority Statement of Interest for Westfield Technical Academy and Westfield High School, and to consider the Parkside Academy (formerly St. Casimir Church). The agenda also includes public participation, excluding personnel matters.

school-committeefacilitiescapital-planningmsbawestfield-technical-academywestfield-high-schoolparkside-academy
Mon Nov 4, 2024

Board of Public Works

Board of Public Works to vote on 0 Lockhouse Road development

The Board of Public Works will discuss and vote on a development project at 0 Lockhouse Road and the installation of artwork at Women’s Temperance Park. The meeting also includes reports from the Department of Public Works and the City Engineering Department.

developmentpublic-worksparkscity-engineering
Mon Nov 4, 2024

School Committee Subcommittee

School subcommittee reviews non-discrimination and Title IX policies

The Human Resources & Policy Subcommittee will meet to review and discuss several school committee policies, including ones on funding proposals, non-discrimination, and grievance procedures. No votes or decisions are listed; the agenda consists of policy review items and public participation.

school-committeepolicy-reviewnon-discriminationtitle-ixharassmentgrievance-procedure
Mon Nov 4, 2024

School Committee

School Committee to discuss and possibly vote on eliminating MCAS as graduation requirement

The Westfield School Committee will hold a regular meeting with multiple business items. Key actions include a discussion and possible vote on a resolution to eliminate MCAS as a high school graduation requirement, declaring surplus property at 12 West Silver Street, and a first reading of a non-discrimination policy. The committee will also hear presentations from Westfield Middle School and Fort Meadow Early Childhood Center, accept a foreign exchange student, and approve a school trip to the Connecticut Science Center.

educationschool-committeemcasgraduation-requirementssurplus-propertynon-discrimination-policyforeign-exchangefield-trips
Fri Nov 1, 2024

Board of Registars

Board to appoint temporary registrar to fill vacancy

The Board of Registrars will consider appointing Rebecca Lynn Blackburn as a temporary registrar, filling the vacancy left by Daniel Smith, under Massachusetts General Law Chapter 51, Section 20. No other business is scheduled.

electionsappointmentsregistrarswestfield
Wed Oct 30, 2024

Police Commission

Police Commission to interview two police candidates

The Westfield Police Commission will hold a special meeting to interview police candidates Jonathan Abrams and Elizabeth Arruda. The meeting also includes approval of minutes from September 9 and September 16, 2024, and an open participation period for public comment.

police-commissionhiringpersonnelwestfield
Mon Oct 28, 2024

Westfield Technical Academy

Westfield Technical Academy Advisory Committee to elect new vice-chair

The committee will meet to elect a new vice-chair and review the status of a co-op survey. Members will also discuss shop progress and equipment.

educationvocational-trainingschool-administration
Mon Oct 28, 2024

Historical Commission

Historical Commission to review Atwater Mansion and discuss City Hall fence removal

The Historical Commission will review a Certificate of Historic Review for the Atwater Mansion. The body will also discuss the removal of a fence at City Hall and plan for upcoming ghost tours. Other items include updates on the Wyben Schoolhouse and the National Historic Registry.

historic-preservationcity-halllandmarkspublic-events
Mon Oct 28, 2024

Board of Assessors

Board of Assessors to hold special meeting for abatement and exemption reviews

The Board of Assessors will meet for an executive session to discuss and potentially vote on abatement and exemption applications. The board does not intend to return to a regular public session following this meeting.

taxesabatementsexemptionsassessors
Thu Oct 24, 2024

Retirement Board

Westfield Retirement Board to review investment performance and retirement applications

The Retirement Board will conduct a monthly performance review of investments and consider recommended changes. The body will also review retirement and disability applications and process bills and warrants.

retirementinvestmentspensionsveterans
Thu Oct 24, 2024

Hampden Charter School of Science

Charter school board to vote on FY24 financial audit, discuss surplus

The Hampden Charter School of Science board will vote on the FY24 financial audit report for its East and West campuses. They will continue a discussion on surplus calculation. The board will also receive the CEO report and review 2023-24 MCAS disaggregated data and the school accountability report card.

charter-schoolfinancial-auditmcass-dataschool-accountabilitysurplusboard-meeting
Wed Oct 23, 2024

Health Plan Trust

Health Plan Trust to renew retiree insurance coverage

The Westfield Health Plan Trust will meet to renew retiree insurance policies. The board will also approve minutes from the previous meeting. No specific dollar amounts or policy changes are detailed in the agenda.

health-insuranceretiree-benefitsmunicipal-financewestfield
Wed Oct 23, 2024

City Council Personnel Action Committee

Personnel Action Committee to review three municipal appointments

The City Council Personnel Action Committee is meeting to consider the appointment or reappointment of three individuals to city commissions and inspector roles.

appointmentscity-councilyouth-commissionplanning-board
Tue Oct 22, 2024

Community Preservation Committee

Committee to review $300,000 application for Westfield Woman’s Club

The Community Preservation Committee will hold a special meeting to review a pending historic application. The body will also approve minutes from the October 10, 2024 meeting.

historic-preservationgrantswestfield-womans-club
Tue Oct 22, 2024

Conservation Commission

Conservation Commission to hold public hearing on sediment removal at Upper Lagoon

The Conservation Commission will hold a public hearing on a proposal by the Springfield Water and Sewer Commission to remove sediment from the Upper Lagoon at 1515 Granville Road. The commission will also discuss a certificate of compliance for a parking lot addition at 930 Southampton Road, an enforcement order for 140 Russellville Road, and a request for extension at 22 Woodland Avenue. Routine items include Q&A on regulations and ordinance revisions, and approval of prior meeting minutes.

conservation-commissionwetlandspublic-hearingenforcementsediment-removalordinance-revisions
Mon Oct 21, 2024

Police Commission

Police Commission meeting for Oct 21 cancelled

The Westfield Police Commission meeting scheduled for October 21, 2024, has been cancelled. No business was conducted or items discussed.

police-commissionmeeting-cancelledwestfield
Mon Oct 21, 2024

Council On Aging

COA Board to discuss goals, nutrition policy, and staffing vacancy

The Westfield Council on Aging Board will vote on minutes, hold public comment, and discuss several operational items including board goals, the nutrition policy, a Program Director vacancy, potential changes to Senior Center hours, and updates on online registration and a transportation grant.

council-on-agingsenior-centerstaffingnutritiontransportation-grantpublic-hearing
Mon Oct 21, 2024

School Committee Subcommittee

Instruction & Curriculum Subcommittee to review MCAS and fall assessment data

The Instruction & Curriculum Subcommittee will review MCAS results and student subgroup data. The body will also discuss initial fall assessment data and its link to 2024-2025 instructional priorities.

educationmcasstudent-assessmentcurriculum
Mon Oct 21, 2024

Parks and Recreation Commission

Little League dugout plans, VVA monument, and commissioner communication policy

The Parks and Recreation Commission will hear presentations from Westfield Little League on dugout design plans for Sadie Knox Playground and from Vietnam Veterans of America on an Agent Orange monument base at Parker Park, banner pole security, and tree placement. They will also discuss a policy change barring commissioners from directly contacting city hall or other departments, review permit forms, and receive staff reports on restroom closures and a new light pole at Papermill Playground.

parksplaygroundlittle-leagueveteranspolicy-changepark-maintenancelightingrestrooms
Mon Oct 21, 2024

School Committee

School Committee to hear Fort Meadow Early Childhood Center presentation

The Westfield School Committee will hold a regular meeting on October 21, 2024. Agenda items include a presentation on the Fort Meadow Early Childhood Center, approval of several school field trips and home school applications, and reports from the superintendent and subcommittees.

school-committeeeducationearly-childhoodfield-tripshomeschoolwestfieldmassachusetts
Mon Oct 21, 2024

School Committee

School Committee to receive update on Fort Meadow Early Childhood Center

The Westfield School Committee will hold a special meeting to discuss the Fort Meadow Early Childhood Center. The agenda also includes a period for public participation.

educationearly-childhoodschool-facilities
Thu Oct 17, 2024

City Council Finance Committee

Finance Committee to consider $250K MassDOT grant for Southwick Road improvements

The Finance Committee is considering accepting a $250,000 grant from the Massachusetts Department of Transportation for improvements on Southwick Road from the Cowles Bridges Project to Dug Road. The meeting also includes public participation and roll call.

financegrantstransportationroadsinfrastructurewestfield
Thu Oct 17, 2024

School Committee Subcommittee

School Committee Subcommittee to review non-discrimination and harassment policies

The Human Resources & Policy Subcommittee is meeting to discuss several School Committee policies. The focus is on non-discrimination, sexual harassment, and grievance procedures.

school-committeepolicynon-discriminationtitle-ixhuman-resources
Thu Oct 17, 2024

City Council

Zone change for duplexes at 1295 Southampton Road and $250k road grant

The City Council will consider a zone change petition for 1295 Southampton Road from Rural Residential to Residential B to allow two-family homes on two additional lots. Other items include a $250,000 state grant for Southwick Road improvements, a $200,000 federal Safe Streets grant, and ordinance amendments restricting parking on Mill Street and prohibiting right turns on red at Main and Free Streets.

zoninghousingroadsgrantstrafficpublic-safetyplanning
Wed Oct 16, 2024

Westfield Cultural Council

Westfield Cultural Council to coordinate Pumpkinfest staffing

The Westfield Cultural Council is meeting to approve previous minutes and the treasurer's report. Members are coordinating staffing shifts for Pumpkinfest and discussing the schedule for the November meeting.

cultural-councilpumpkinfestcommunity-eventswestfield
Wed Oct 16, 2024

Board of Health

9 tobacco violation hearings and a condemnation order on the agenda

The Board of Health will hold nine hearings for tobacco violations at local businesses and consider a condemnation order for a trailer at 868 Southampton Road. The board will also approve prior minutes, monthly bills, and receive a naloxone training update.

healthtobaccohearingscondemnationnaloxoneenforcementpublic-health
Wed Oct 16, 2024

City Council Legislative and Ordinance Committee

Committee reviews $200,000 federal grant for Vision Zero strategy

The Legislative and Ordinance Committee is meeting to discuss a federal grant for street safety and several local traffic ordinances. The body will also consider a preservation restriction for a building on Broad Street.

trafficgrantsparkinghistoric-preservationpublic-safety
Wed Oct 16, 2024

Health Plan Trust

Health Plan Trust to discuss retiree insurance renewals

The Health Plan Trust is meeting to review the trust balance and establish a balance goal for FY’25. The body will also address the renewal of retiree insurances.

health-insuranceretireesbudgettrust-fund
Wed Oct 16, 2024

Off-Street Parking Commission

Off-Street Parking Commission to review snow emergency plan, budget

The Off-Street Parking Commission will discuss the 2024-2025 Snow Emergency & Plowing Plan, an update on summer and fall maintenance, and the FY25 budget. Commissioners will also consider marketing strategies for municipal parking lots. The agenda includes approval of minutes and monthly bills.

parkingsnowbudgetmaintenancemarketingwestfield
Tue Oct 15, 2024

Commission for Citizens with Disabilities

Commission to discuss emergency preparedness for people with disabilities

The Westfield Commission for Citizens with Disabilities will review minutes from September, receive an update on the fines and forfeits account, and discuss ongoing projects including the Westfield Whip Manufacturing Museum, Elder Fair, Zine project, and NAMI. New business includes a discussion on emergency preparedness and scheduling the next meeting for November 19th.

disabilitiescommissionwestfieldemergency-preparednesscommunity-eventsmuseumnami
Tue Oct 15, 2024

Planning Board

Planning Board to review special permits for residential and business sites

The Westfield Planning Board will hold public hearings to decide on special permits for three properties. The board will also review plans for 266 Hillside Rd./St. Mary that do not require approval under Subdivision Control Law.

zoningspecial-permitsland-usepublic-hearings
Thu Oct 10, 2024

Community Preservation Committee

CPC to review $300K historic grant for Westfield Woman’s Club

The Community Preservation Committee will review a pending $300,000 application from the Westfield Woman’s Club for historic preservation. They will also discuss progress and a potential additional funding request for the Westfield Legion Post #124 building. The meeting includes approval of prior minutes and review of current fund balances.

community-preservationhistoric-preservationfundingwestfield-womans-clublegion-post-124public-hearing
Thu Oct 10, 2024

Westfield Airport Commission

Westfield Airport Commission to consider $33,528 state grant for airfield marking

The Commission will consider accepting a state grant for airfield marking and a lease amendment for an electric aircraft charging station. Members will also receive updates on hangar development and fuel facility projects. An executive session is scheduled to discuss the lease of the Old Five Star Premises.

airportgrantsleasingaviationinfrastructure
Wed Oct 9, 2024

Board of Health

Westfield Board of Health October 9 meeting postponed to October 16

The Westfield Board of Health meeting scheduled for October 9, 2024, has been postponed. The next regularly scheduled meeting will be held on Wednesday, October 16, 2024, at 6:00 p.m. in the City Council Chambers. No other business was noted.

healthboard-of-healthwestfieldmeeting-postponed
Wed Oct 9, 2024

Board of Assessors

Board of Assessors to review land application for 0 Montgomery Rd

The Board of Assessors will meet to approve September abatement and commitment reports. The board will also consider a Chapter Land Application for 0 Montgomery Rd. An executive session is scheduled to discuss abatement and exemption applications.

assessorsland-applicationabatementstax-exemptions
Tue Oct 8, 2024

Westfield Housing Authority

Westfield Housing Authority to discuss annual plan, modernization, and bank sweep account

The Westfield Housing Authority will hold a regular meeting to discuss routine business including bill payments, incoming communications from the Executive Office of Housing and Livable Communities, and committee reports. Old business covers modernization updates and an audit. New business includes setting meeting times, the annual plan, an M&T Bank sweep account, and a change order for JFK Soffits.

housing-authorityannual-planmodernizationauditbill-paymentsaffordable-homes-actbankingwestfield
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] ADJOURNMENT Upon the motion of Commissioner Mulligan and seconded by Commissioner Murray it was VOTED: to adjourn at 5:22 pm
3 yea
Murphy yea · Mulligan yea · Murray yea
Tue Oct 8, 2024

Conservation Commission

Conservation Commission to hold hearings on landscaping and vegetation projects

The Conservation Commission will review proposals for landscaping and vegetation management at two properties. The body will also consider certificates of compliance for completed projects and address enforcement orders regarding land violations.

conservationwetlandsland-useenvironment
Mon Oct 7, 2024

License Commission

License Commission to review entertainment license for Bonte at 18 School Street

The License Commission will consider approving an entertainment license for Bonte at 18 School Street, along with several one-day alcohol licenses for events including Westfield State University homecoming and a St. Mary's High School bingo. The meeting also includes approval of prior minutes and setting future meeting dates.

licensesentertainmentalcoholone-day-licenseswestfield-state-universitypolice-reports
Mon Oct 7, 2024

School Committee

School Committee to vote on teachers union MOA, approve Costa Rica trip

The Westfield School Committee will consider a Memorandum of Agreement with the Westfield Education Association Unit A (teachers) and approve several routine items, including homeschool applications, field trips, and meeting minutes. A presentation from Westfield Intermediate School and an update on Fort Meadow Early Childhood Center are also scheduled.

school-committeeteachers-contractfield-tripshomeschoolwestfield-public-schools
Thu Oct 3, 2024

City Council

City Council considers $600,000 transfer for new ambulance apparatus

The City Council will review requests for three grants totaling over $473,000 for airport and road improvements. The body will also consider a fund transfer for emergency vehicle replacement and the order for the November 5, 2024, state election.

grantspublic-safetyroadsairportelectionsbudget
Thu Oct 3, 2024

City Council Finance Committee

Finance Committee to vote on $600k transfer for new ambulance apparatus

The Finance Committee will consider transferring $600,000 from the Ambulance Fund Balance to purchase a new apparatus to replace Engine 5. Public participation is allowed for 15 minutes total, with 3 minutes per person. The meeting also includes call to order, roll call, and adjournment.

financebudgetambulanceequipmentpublic-safetywestfield
Wed Oct 2, 2024

Emergency Planning Committee

Emergency Planning Committee to discuss standardizing city event processes

The Westfield Local Emergency Planning Committee meets to discuss routine updates from emergency management, grant funds, and departmental reports. New business includes creating a standardized process for city events. The committee will also hear updates from various departments including fire, police, and health.

emergency-managementeventsgrantsdepartmentswestfield
Wed Oct 2, 2024

Municipal Light Board

Municipal Light Board to review abatement request and real property strategy

The Municipal Light Board will review several quarterly and monthly operational reports. The board is scheduled to discuss an abatement request for 99 Medeiros Way and enter an executive session regarding real property negotiations.

utilitiesabatementreal-estatefinance
Wed Oct 2, 2024

Zoning Board of Appeals

ZBA to consider special permit for garage setback at 36 Gladwin Dr.

The Westfield Zoning Board of Appeals will meet to review new applications and approve previous minutes. The board will hold a public hearing to decide on a special permit regarding a detached garage setback.

zoningpublic-hearingspecial-permit
Tue Oct 1, 2024

Board of Public Works

Board to vote on accepting Camelot Lane as public roadway

The Board of Public Works will discuss and vote on the acceptance of Camelot Lane as a public roadway. The board will also hear monthly reports from the Department of Public Works and updates from the City Engineering Department on ongoing projects. Other agenda items include approval of previous meeting minutes and signing of bills payable.

board-of-public-worksroadspublic-workscamelot-lanewestfieldengineeringminutes
Tue Oct 1, 2024

Planning Board

Planning Board to continue public hearing on 15-unit residential conversion at 70 Court St.

The Westfield Planning Board will hold public hearings on several continued applications, including a 15-unit residential conversion and duplex at 70 Court Street, a self-storage facility off Norton Street, a flag lot at 222 Russellville Road, and an expansion of a motor vehicle repair business at 918 Southampton Road. The board will also discuss a possible zoning amendment to accommodate accessory dwelling units (ADUs) and review other business items.

planning-boardzoningpublic-hearinghousingself-storageflag-lotmotor-vehicle-repairadu
Fri Sep 27, 2024

Retirement Board

Westfield Retirement Board to adjust investment portfolio allocations

The Retirement Board is holding an emergency meeting to discuss specific additions and reductions to its investment portfolio indices.

investmentsretirement-boardfinance
✓ Decided: Retirement board rebalances portfolio, cuts US equities

The Westfield Contributory Retirement Board approved a set of investment trades to reduce holdings in domestic large-cap equity funds and add international index funds. The motion passed unanimously in a roll call vote, with one member absent. The board also voted to adjourn the meeting.

Tue Sep 24, 2024

Conservation Commission

Conservation Commission to hear violations, wetland projects, and beaver dam emergency

The commission will hold public hearings on four projects affecting wetlands, including a storage facility on Lockhouse Road and a single-family home on Bayberry Lane. It will consider certificates of compliance for past projects, such as the Cumberland Farms on Southampton Road and a 2001 subdivision. Multiple enforcement orders are on the agenda, including Liberty Manor operating under an expired order since 2017, and an emergency certification for a beaver dam breach at Camp Shepard. The commission will also discuss proposed amendments to an order of conditions and other administrative items.

conservationwetlandspublic-hearingsenforcementcertificate-of-compliancebeaver-damwestfield
Tue Sep 24, 2024

Westfield Technical Academy

Westfield Technical Academy to select paid off-campus construction projects

The Joint Carpentry and Cabinetmaking Construction Technology Program Advisory Meeting will review applications for paid off-campus projects for the 2024-2025 school year. The body will also discuss student internships and the next Westfield Technical Academy Foundation Student Build.

educationvocational-trainingconstructioninternships
Mon Sep 23, 2024

Health Plan Trust

Westfield Health Plan Trust meeting postponed

The Health Plan Trust meeting scheduled for September 23, 2024, has been postponed. The agenda included items regarding trust balances and retiree insurance renewals.

health-plan-trustretiree-insurancebudget
Mon Sep 23, 2024

Historical Commission

Historical Commission to hold hearing on demolition at 6 Union Street

The Westfield Historical Commission will hold a public hearing to discuss an application for the demolition of the property at 6 Union Street. No other items are on the agenda.

historical-commissiondemolitionpublic-hearingproperty
Mon Sep 23, 2024

Historical Commission

Historical Commission holds public hearing on demolition at 6 Union Street

The Historical Commission will hold a public hearing on the proposed demolition of 6 Union Street. Commissioners will also review edits to the Demolition Ordinance (Ordinance 1352) and receive updates on the Wyben Schoolhouse, National Historic Registry progress, and upcoming public events.

historical-commissiondemolitionhistoric-preservationordinancepublic-hearingwestfield
Thu Sep 19, 2024

Retirement Board

Retirement Board to interview International Large Cap Equity firms

The Westfield Retirement Board will conduct RFP interviews for International Large Cap Equity and review monthly performance. The board will also process retirement and disability applications and discuss FY25 appropriations.

retirementinvestmentsbudgetpensions
Thu Sep 19, 2024

City Council

City Council to vote on $600K ambulance purchase, police age limit resolution

The Westfield City Council will consider a $600,000 transfer from the Ambulance Fund to buy a new apparatus replacing Engine 5. Other items include a resolution to petition the state for a police officer age limit, a grant acceptance for emergency communications, and a second reading of a pet licensing ordinance. The council will also take up a tabled special permit for a contractor's yard on North Road.

budgetpublic-safetypolicezoninganimalsgrantsordinance
Thu Sep 19, 2024

Hampden Charter School of Science

Hampden Charter School of Science to continue surplus calculation discussion

The board will meet to receive a CEO report and continue a discussion regarding surplus calculations. The meeting also includes standard procedural items and a period for public comment.

educationbudgetcharter-school
Thu Sep 19, 2024

City Council Finance Committee

Committee to consider accepting $19,081 state 911 grant for regional communications center

The Finance Committee will consider accepting a $19,081 grant from the Massachusetts 911 Department for the Westfield Regional Public Communications Center through the TERT program. They will also vote on transferring $14,473 from FY25 to FY24 school special education legal accounts to pay a prior year bill. The meeting includes public participation and approval of previous meeting minutes.

financegrantspublic-safetyschoolsbudgetwestfield
Wed Sep 18, 2024

Traffic Commission

Traffic Commission to discuss crash intersections, parking restrictions, and bus stops

The Westfield Traffic Commission will review old business including speed limit on Holyoke Rd and a proposed $300 fine for engine braking on Elm, Franklin, and Lockhouse streets. New business includes crash analysis at Main & Elm and Montgomery/Prospect/New Corner, potential no-parking zones on Sibley Ave and at 102 Falley Drive, and adding a handicap parking spot on Holland Ave. The commission will also review existing and proposed PVTA bus stops.

trafficparkingsafetybus-stopsordinances
Wed Sep 18, 2024

Board of Health

Board of Health to discuss opioid settlement listening sessions, Choke Saver regs

The Board of Health will consider approving minutes from July and August meetings and signing monthly bills. The Substance Use Outreach Coordinator will discuss Opioid Settlement Fund listening sessions. Inspectional Services will address clarification of FDA-registered Choke Saver devices and the need for local regulations, along with an update on 9 Zepher Drive. A community health promotion update is also on the agenda.

healthopioidspublic-safetyregulationscommunity-health
Wed Sep 18, 2024

Community Development

City reviews draft annual report on federal housing grants

The Westfield Office of Community Development will review the draft Consolidated Annual Performance and Evaluation Report (CAPER) for federal Community Development Block Grant (CDBG) and HOME programs for the year ending June 30, 2024. A public hearing is scheduled for September 18, 2024, at 5:00 PM in City Hall Room 315.

housingfederal-grantscommunity-developmentpublic-hearingannual-report
Wed Sep 18, 2024

Off-Street Parking Commission

Parking Commission to discuss fiber installation, approve monthly bills

The Off-Street Parking Commission will hold its monthly meeting to approve minutes and bills, and receive updates from the Community Development Director on summer maintenance and the Elm Street Plaza event. A discussion on Westfield Gas & Electric fiber installation is also scheduled. The agenda is largely routine and procedural.

parkingcommissionmeetingmaintenancebillsfiber-installation
Wed Sep 18, 2024

City Council Legislative and Ordinance Committee

Committee to consider new rental property ordinance and police age limit resolution

The Legislative and Ordinance Committee will discuss three items: creating or reviewing a city ordinance for rental properties, submitting a resolution to petition the state to allow an age limit for police officer appointments, and amending chapters related to Facilities Management and Purchasing Department operations. No votes are taken at committee; recommendations may be forwarded to the full council.

rental-propertypoliceage-limitordinancepurchasingfacilities-managementpublic-safetyhousing
Tue Sep 17, 2024

Commission for Citizens with Disabilities

Commission to approve minutes, discuss fine account

This meeting of the Commission for Citizens with Disabilities is largely procedural, including approval of prior minutes and an update on the fine and forfeits account. No new ordinances, rezonings, or budget items are on the agenda. The next meeting is scheduled for October 15.

citizens-with-disabilitiescommissionproceduralmeetingwestfield
Tue Sep 17, 2024

Planning Board

Planning Board continues hearings on self-storage, flag lots, 15-unit conversion, and ADU amendment

The Westfield Planning Board will hold a regular meeting with public hearings on several continued applications, including a self-storage facility at Norton St./0 Lockhouse Rd, flag lots at 68 Northwest Rd and 222 Russellville Rd, a 15-unit residential conversion at 70 Court St, an auto repair expansion at 918 Southampton Rd, and an electronic sign at 1134 Southampton Rd. The board will also discuss possible zoning amendments for accessory dwelling units (ADUs) and review plans not requiring subdivision approval for 457 E Main St.

planning-boardpublic-hearingszoningresidential-conversionself-storageaccessory-dwelling-unitssite-plan-review
Tue Sep 17, 2024

Westfield Cultural Council

Cultural Council to discuss grant meeting results and Pumpkinfest schedule

The Westfield Cultural Council will meet to approve previous minutes and hear a treasurer's report. Under new business, members will discuss outcomes from a recent grant meeting and schedule appearance slots for Pumpkinfest.

cultural-councilgrantspumpkinfestcommunity-eventsmeeting
Mon Sep 16, 2024

School Committee

School Committee to discuss secondary school cellphone plan, approve new labor agreements

The Westfield School Committee will discuss a new cellphone plan for secondary schools and consider approving memoranda of agreement with the Westfield Education Association for teachers and paraprofessionals. Other agenda items include approval of the Technical Academy admissions policy, a student trip to Washington D.C., and the bullying prevention plan for 2024-2026.

educationschoolscellphone-policylabor-agreementsschool-committeewestfield-mabullying-preventionstudent-trips
✓ Decided: School Committee approves new secondary cellphone policy

The Westfield School Committee approved a revised cellphone plan for secondary schools, a memorandum of agreement with teachers, and several other routine items. The cellphone policy restricts device use during school hours, with escalating consequences for violations. All votes were unanimous except where noted.

Mon Sep 16, 2024

School Committee

School Committee to discuss teacher and paraprofessional contract negotiations in closed session

The Westfield School Committee will hold an executive session to discuss strategy related to collective bargaining with the Westfield Education Association for Unit A (teachers) and Unit D (paraprofessionals), and to approve prior executive session minutes. The public is not permitted to attend.

school-committeeexecutive-sessioncollective-bargainingteachersparaprofessionalswestfield-public-schools
Mon Sep 16, 2024

Police Commission

Police commission to interview candidates and appoint special officer

The Westfield Police Commission will hold interviews for six police candidates, including one via Zoom. The commission will also consider appointing Domenico Cerasani as a Special Police Officer. This special meeting addresses personnel matters for the police department.

police-commissionhiringpersonnelwestfield-massachusetts
✓ Decided: Police Commission nominates five candidates for officer positions

The Westfield Police Commission interviewed five police candidates and voted unanimously to nominate all of them: Ian DeLuca, Tatiana Sirbu, Spencer Lusignan, Benjamin Emerson, and Jenna Hurlburt. The commission also unanimously appointed Domenico Cerasani as a Special Police Officer. Start dates were announced for the new officers.

Thu Sep 12, 2024

Westfield Airport Commission

Westfield Airport Commission to consider lease and land use agreements

The Commission will meet to discuss and potentially vote on a lease amendment for Exit 3 Aviation and a land use agreement for an F-15C static display. Members will also receive updates on the Taxiway B South project and soundproofing mitigation. An executive session is scheduled to discuss the lease of the Old Five Star Premises.

airportleasingaviationinfrastructurenoise-mitigation
✓ Decided: Airport Commission approves lease amendment and F-15 display MOU

The Westfield Airport Commission approved a lease amendment for Exit 3 Aviation allowing Fly Lugu as a subtenant, and approved a Memorandum of Understanding with the 104th Fighter Wing for an F-15C static display near the new gate. Both votes were unanimous (3-0). The commission also received updates on the Taxiway B South project, noting Taxiway E was completed and work resumes in March 2025, and discussed noise mitigation and land re-use plans.

Wed Sep 11, 2024

City Council

Council to consider $671K FAA grant for airport noise mitigation

The City Council is holding a special meeting to immediately consider a grant request from the mayor. The grant, totaling $671,096.00 from the U.S. Department of Transportation FAA Airport Improvement Program, would fund a noise mitigation sound insulation pilot program and a Land Re-Use Plan for properties previously acquired for noise mitigation at Westfield-Barnes Airport.

airportgrantnoise-mitigationfederal-fundingwestfield-barnes-airportland-reuse
✓ Decided: Council accepts $671K FAA grant for airport noise mitigation

The Westfield City Council held a special meeting and voted to accept a $671,096 grant from the U.S. Department of Transportation FAA for the Westfield-Barnes Airport. The funds will start a pilot noise mitigation sound insulation program and a Land Re-Use Plan for about 30 properties previously acquired for noise mitigation. The vote was 8-0 with five councilors absent. The meeting adjourned immediately after the vote.

Wed Sep 11, 2024

Westfield Airport Commission

Airport Commission to vote on $671K FAA noise mitigation grant

The Westfield Airport Commission will consider accepting a Federal Aviation Administration grant of $671,096 for a pilot program addressing noise mitigation, sound insulation, and a land re-use plan for previously acquired properties. A possible vote on the grant acceptance is scheduled.

airportgrantsnoise-mitigationfaawestfield
Wed Sep 11, 2024

Board of Assessors

Board to consider forestry plan renewals and new Chapter 61B application on three parcels

The Board of Assessors will vote on approving August abatement/commitment reports, two forestry plan renewals for parcels on Southampton Road (Chapter 70R-30 and 70R-14), and a new Chapter 61B application for 69 acres at 307 North West Road. The board also plans to enter executive session to discuss abatement and exemption applications without returning to open session.

assessorsproperty-taxesabatementsforestrychapter-landstax-exemptionswestfield
✓ Decided: Board accepts reports, signs forestry renewals, raises abutter list fee

The Board of Assessors accepted the June 2024 minutes and the June, July, and August monthly abatement/commitment reports. They signed Chapter Land applications and Forestry Plan Renewals for three parcels, authorized the City Assessor to sign contracts, and approved a fee increase for Abutters Lists effective October 1, 2024. No public participation or old business was reported.

Wed Sep 11, 2024

City Council Personnel Action Committee

Personnel panel to consider reappointing Jane Magarian to Planning Board

The Personnel Action Committee will vote on the reappointment of Jane Magarian to the Planning Board for a term through February 2029. The meeting also includes standard procedural items.

personnelappointmentsplanning-boardwestfield
✓ Decided: Planning Board reappointment recommended by committee

The Personnel Action Committee voted 2-0 to recommend the reappointment of Jane Magarian to the Planning Board for a term expiring February 2029. The recommendation will go to the full City Council for final approval.

Wed Sep 11, 2024

Board of Health

Westfield Board of Health meeting postponed

The Board of Health meeting scheduled for September 11, 2024, has been postponed. The next meeting is scheduled for September 18, 2024, at 6:00 p.m.

public-healthmeeting-notice
Tue Sep 10, 2024

Board of Public Works

Board of Public Works to vote on accepting Camelot Lane as a public roadway

The Board of Public Works will meet to discuss and vote on the public acceptance of Camelot Lane. The board will also review a stormwater management permit plan for Lockhouse Road and receive reports from the Department of Public Works and City Engineering Department.

roadsstormwaterpublic-worksinfrastructure
✓ Decided: Camelot Lane road acceptance tabled to October 1

The Board of Public Works tabled the vote on accepting Camelot Lane as a public roadway until the October 1 meeting. No other substantive decisions were made; the meeting included public comments, project updates, and discussion of a stormwater permit issue.

Tue Sep 10, 2024

Franklin Avenue Project School Building Committee Meeting

School Building Committee to receive updates on Franklin Avenue Project

The School Building Committee is meeting to receive updates from the Owner Project Manager and architect on the Franklin Avenue Project. The committee will also approve minutes from a previous meeting and allow public participation. No votes on contracts or ordinances are scheduled.

school-building-committeefranklin-avenue-projectpublic-schoolsconstructionwestfield
Tue Sep 10, 2024

Conservation Commission

Westfield Conservation Commission meeting cancelled

The Conservation Commission meeting scheduled for September 10, 2024, was cancelled due to a lack of quorum. The next meeting is scheduled for September 24, 2024.

conservation-commissionmeeting-cancellation
Mon Sep 9, 2024

License Commission

License Commission to hold hearing on incident at The Whip

The License Commission will conduct an informational hearing regarding a police incident report at The Whip. The body will also review a Common Victualler license application and several one-day event licenses.

liquor-licensespublic-safetybusiness-permitsevents
✓ Decided: License Commission approves licenses, files police reports

The Westfield License Commission approved a Common Victualler license for Bonte contingent on Board of Health permits, approved five one-day liquor licenses for various events, and filed police incident reports, including one from The Whip. The meeting was routine with no public participation.

Mon Sep 9, 2024

Parks and Recreation Commission

Parks and Recreation Commission to discuss park security and facility permits

The Commission is meeting to review permit requests for municipal pickleball courts and discuss park maintenance. The body will also address the installation of cameras to prevent vandalism in parks.

parksrecreationpublic-safetypermitsmaintenance
✓ Decided: Commission approves pickleball permits and Little League dugout project

The Parks and Recreation Commission approved three permits: a school pickleball event for Westfield Technical Academy, a pickleball tournament with a revised rain date, and a dugout upgrade at Sadie Knox Playground by Westfield Little League. All votes were unanimous. The commission also discussed park cameras, field usage, and maintenance issues.

Mon Sep 9, 2024

Police Commission

Police Commission to appoint traffic control officer, approve contract forms

The Westfield Police Commission will meet to approve minutes from June 10, 2024, and take up new business items including contract signature authorization forms, the appointment of Joel Christophori as a traffic control officer, and a September awards ceremony. The meeting is largely procedural with one personnel action.

policepersonneltraffic-controlawardsmeeting
Mon Sep 9, 2024

Council On Aging

Council on Aging to discuss strategic plan and nutrition policy

The Westfield Council on Aging will hold a regular board meeting on September 9, 2024. Agenda items include discussion of strategic plan next steps, a vacant board position for HVES, and defining the target age group for services. New business covers registration process questions and a nutrition policy, while the director reports on texting communication and a senior wallet program for advance deposits.

council-on-agingsenior-servicesstrategic-plannutritionregistrationboard-positions
Thu Sep 5, 2024

City Council License Committee

License Committee to consider junk dealer/collector license for Sushis Thrift LLC

The License Committee will hold a public hearing and vote on an application for Junk Dealer and Junk Collector licenses from Sushis Thrift LLC at 54 Washington Street (also known as 56 Washington Street), owned by Kseniya Covileac. The committee will also approve minutes from the April 23, 2024 meeting. A 15-minute public participation period is scheduled.

licensesjunk-dealerscity-councilwestfieldmassachusettscommittee-meeting
Thu Sep 5, 2024

City Council

City Council to accept $1M EPA grant for new Operations Building at water recovery facility

The City Council will vote on multiple grants, including a $1,000,000 EPA grant for a new Operations Building at the water recovery facility, and a $19,081 state 911 grant. Other items include a $300 fine for engine brake infractions, a $35,000 gift to Animal Control, and an Agricultural Preservation Restriction for Yellow Stonehouse Farm. Several reappointments and ordinance amendments are also on the agenda.

grantspublic-safetypoliceagricultureanimal-controlinfrastructurebudgetzoning
Thu Sep 5, 2024

City Council Finance Committee

Finance Committee to consider $1M EPA grant for new operations building

The Finance Committee will consider accepting several grants, including a $1,000,000 EPA grant for a new Operations Building at the water recovery facility. Other grants include $34,500 for cybersecurity planning and smaller grants for senior programs. Also on the agenda is a $7,051 transfer from police overtime accounts to cover 2023 Air Show overtime.

financegrantspublic-workscybersecuritypolicesenior-serviceswater-recovery
✓ Decided: Finance Committee accepts $1M EPA grant for wastewater operations building

The Finance Committee approved acceptance of a $1,000,000 EPA grant for a new Operations Building at the water recovery facility, noting construction had already started and the grant would cover electrical and HVAC costs. It also accepted three other grants, approved a police overtime transfer, and approved prior meeting minutes. All votes were 2-0.

Wed Sep 4, 2024

Emergency Planning Committee

Westfield Emergency Planning Committee to discuss standardizing city event process

The Westfield Local Emergency Planning Committee will discuss creating a standardized process for city events as new business. The agenda also includes updates on past events (fireworks, VIP visits, Ironman), grant funds from Community Development Director Peter Miller, an update from Emergency Management, Tier 2 updates, departmental reports from multiple agencies, and a discussion of an emergency drill with WG&E.

emergency-managementeventsplanninggrantspublic-safetycity-operations
✓ Decided: Committee accepts June minutes, discusses grants and event planning

The Westfield Local Emergency Planning Committee met on September 4, 2024, and unanimously accepted the June 5, 2024 meeting minutes. Members discussed grant-funded equipment (dive suits, AED), upcoming events, and post-event debriefings, with suggestions for improved communication templates. No formal votes were taken on substantive policy decisions.

Wed Sep 4, 2024

Municipal Light Board

Board to review 2023 audit, capital projects, and property matters

The Municipal Light Board will discuss and take action on several financial and operational reports, including the 2023 annual consolidated financial audit, bi-annual capital gas and electric projects, and the energy stabilization funds quarterly report. The board will also consider a verbal update on a MassEVIP public access charging grant and a new business item regarding Materials Management LLC. An executive session is scheduled for property discussion.

auditcapital-projectselectricgaspublic-access-chargingexecutive-sessionpropertyfinancial-reports
✓ Decided: Board approves 2023 audit, DPU report; enters executive session

The Municipal Light Board accepted the July 10, 2024 meeting minutes, approved the 2023 Annual Consolidated Financial Audit results with a clean opinion, and approved the 2023 Annual DPU Report. The board also entered executive session to discuss real property, where it was announced the department had executed a purchase and sale agreement for 99 Medeiros Way. No other substantive decisions were made during the regular session.

Wed Sep 4, 2024

City Council Legislative and Ordinance Committee

Committee reviews animal shelter gift and farm preservation

The Legislative and Ordinance Committee is considering a $35,000 donation for animal shelter improvements and a preservation restriction for a local farm. The body will also review amendments to three Host Community Agreements and city ordinances regarding pet licensing and department operations.

animal-controlagricultureordinanceshost-community-agreementscity-management
✓ Decided: Committee accepts $35K animal shelter gift, advances farm, cannabis, dog license items

The Legislative and Ordinance Committee voted 2-0 to accept a $35,000 estate gift for the animal shelter, submit resolutions on an agricultural preservation restriction and three host community agreement amendments, and submit a dog/cat licensing ordinance amendment. It also voted to keep ordinance changes for Facilities Management and Purchasing in committee for further review. All votes were unanimous with Councilors Onyski and Burns present.

Tue Sep 3, 2024

Board of Public Works

Westfield Board of Public Works meeting cancelled

The regularly scheduled Board of Public Works Commissioner's Meeting for September 3, 2024, has been cancelled. No business was conducted or discussed.

cancellationpublic-workswestfield
Tue Sep 3, 2024

Municipal Light Board

Finance subcommittee to review 2023 financial audit

The Municipal Light Board Finance Sub-Committee will meet to discuss and take action on the 2023 financial audit. No other substantive items are on the agenda.

municipal-lightfinanceauditsubcommittee
Thu Aug 29, 2024

Westfield Housing Authority

Westfield Housing Authority to review FY2025 budget guidelines, fossil fuel replacement

The Westfield Housing Authority will hold a special meeting to discuss committee reports, quarterly statements, and bill payments. They will review incoming communications from the Executive Office of Housing and Livable Communities regarding fossil fuel replacement, cybersecurity, and Fiscal Year 2025 budget guidelines. Old business includes modernization updates, audit, and performance management review, while new business covers meeting times/dates and a change order for JFK Soffits.

housingauthoritybudgetfossil-fuelcybersecuritymodernizationaudit
✓ Decided: Westfield Housing Authority approves JFK soffit completion, $87K payment

The Westfield Housing Authority held a special meeting on August 29, 2024, and unanimously approved several items. Key actions included approving the substantial/final completion of the JFK soffit repair project with an $87,000 payment to FRG Contractor Corp., and a $1,200 credit change order. The board also authorized a one-year management agreement with the Southwick Housing Authority, revised Section 8 payment standards to 110% of Fair Market Rent, and approved routine bills and reports.

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
To authorize Chairperson to sign Management Agreement with the Southwick Housing Authority for one (1) year commencing July 1, 2024. Unanimous vote 4 to 0. Ayes: Murphy, Mulligan, Murray, Carmichael…
3 yea
Murphy yea · Mulligan yea · Murray yea
Wed Aug 28, 2024

Zoning Board of Appeals

ZBA to consider residential conversion and duplexes at 70 Court St

The Westfield Zoning Board of Appeals will hold a public hearing to discuss a special permit amendment. The board will review a proposal to convert a non-conforming office building and construct duplexes for a total of 15 units.

zoninghousingresidential-conversionpublic-hearing
✓ Decided: ZBA approves 15-unit residential conversion at 70 Court St

The Westfield Zoning Board of Appeals approved an amendment to a special permit allowing the conversion of a non-conforming office building plus duplex construction totaling 15 units at 70 Court St. The approval includes conditions limiting rentals to non-undergraduates and a maximum of 15 units. The board also scheduled a public hearing for October 2 on a dimensional special permit for a garage at 36 Gladwin Dr.

Tue Aug 27, 2024

Conservation Commission

Conservation Commission to hear wetland boundary confirmation, multiple enforcement orders

The Westfield Conservation Commission will hold public hearings on a wetland boundary delineation at Timberswamp and Ampad Roads and a landscaping project at 114 Northridge Street. The commission will also consider certificates of compliance for two projects and address six enforcement orders involving violations such as debris placement in floodplains, fill in no-disturb zones, and incomplete restoration. Additionally, the commission will discuss revisions to regulations and conservation restrictions.

conservationwetlandsenforcementpublic-hearingwetlands-protectionwestfield
Tue Aug 27, 2024

City Council Zoning, Planning and Development Committee

Committee to review permit applications for contractor's yard at 0 North Road

The Zoning, Planning and Development Committee will meet to discuss permit applications submitted by RYMC, LLC. The body will consider a special permit, site plan approval, and stormwater permit for a contractor's yard and site improvements.

zoningpermitsland-usesite-plan
✓ Decided: Committee approves contractor's yard at 0 North Road with conditions

The Zoning, Planning and Development Committee voted 3-0 to approve a Special Permit, Site Plan, and Stormwater Permit for a contractor's yard at 0 North Road, submitted by RYMC, LLC. The approval includes 12 conditions, such as restricting tenants to specific trades, prohibiting heavy truck repair, and encouraging heavy commercial vehicles to avoid North Road between Root Road and Southampton Road. The decision now goes to the full City Council for final approval.

Mon Aug 26, 2024

School Committee

Subcommittee to consider rescinding virtual school and BYOD policies

The Human Resources & Policy Subcommittee of the Westfield School Committee will meet to discuss and potentially vote on rescinding two existing policies: the Virtual School policy (File IG) and the Bring Your Own Device policy (File IJN). The meeting includes a public participation period, excluding personnel matters.

school-committeepoliciesrescindvirtual-schoolbring-your-own-devicepublic-participation
✓ Decided: Subcommittee votes to rescind virtual school and BYOD policies

The Human Resources & Policy Subcommittee voted unanimously (3-0) to recommend rescinding two School Committee policies: the Westfield Virtual School policy (File: IG) and the Bring Your Own Device policy (File: IJN). Both recommendations will be brought to the full committee for a final vote. No other substantive decisions were made.

Mon Aug 26, 2024

School Committee

School Committee to vote on secondary schools cellphone plan

The Westfield School Committee will consider and vote on a cellphone plan for secondary schools, approve multiple 2024-2025 handbooks from early childhood through high school, and act on a retainer agreement with Dupere Law Offices. The agenda also includes acceptance of bus driver and monitor lists, 62 home school applications, and a foreign exchange student placement.

educationschoolscellphoneshandbookspoliciesteachers-unionlegal-services
Mon Aug 26, 2024

City Council

City Council considers $509,040 grant for Westfield-Barnes Regional Airport

The City Council is meeting to consider a request from the Mayor regarding a federal grant. The funds would be used to remove obstructions for Runway 15 at the Westfield-Barnes Regional Airport.

aviationgrantsinfrastructureairport
Mon Aug 26, 2024

Historical Commission

Historical Commission to review demolition delay, deed restriction on Legion property

The Westfield Historical Commission will discuss updates on the Wyben Schoolhouse, progress on the National Historic Registry, and review the deed restriction on the American Legion property. They will also review the 180-day demolition delay process and the commission's mission and purpose.

historical-commissionpreservationdemolition-delaywyben-schoolhouseamerican-legionnational-historic-registry
✓ Decided: Historical Commission accepts American Legion building plans

The Westfield Historical Commission accepted a presentation from Albert Masciadrelli of American Legion Post 124 on current plans and progress for the American Legion building, designed to preserve its historical look while adding safety updates. The commission also tabled the American Revolution Anniversary Plans until the next meeting and postponed several new business items to September. No other substantive decisions were made; most items were updates or planning discussions.

Mon Aug 26, 2024

Westfield Airport Commission

Airport Commission considers $509,040 FAA grant for obstruction removal

The Westfield Airport Commission is holding a special meeting to discuss a federal grant. The body may vote to accept funds for a specific runway project.

airportgrantsinfrastructureaviation
✓ Decided: Airport Commission accepts $509,040 FAA grant for tree removal

The Westfield Airport Commission voted unanimously to accept an FAA AIP grant of $509,040 for the Obstruction Removal Runway 15/33 Phase II project, which involves tree clearing near the end of runway 15. The total project cost is $669,300, with the FAA covering 76%. The meeting adjourned shortly after, with no other business discussed.

Thu Aug 22, 2024

Retirement Board

Retirement Board reviews investments and approves routine items

The Westfield Retirement Board is meeting to discuss investment performance and review an RFP. They will also approve bills, minutes, retirement applications, and disability applications. The meeting includes updates on retiree affidavits and military buybacks. The agenda consists of standard procedural items.

retirementboardinvestmentspensionsprocedural
Wed Aug 21, 2024

Off-Street Parking Commission

Commission to vote on food truck licenses and dinner event at Elm Street Plaza

The Off-Street Parking Commission will discuss and vote on three requests for use of Elm Street Plaza: two food truck license applications and a chamber of commerce dinner event. An update from Community Development Director Peter Miller covers summer maintenance and a plaza event summary. The commission will also approve monthly bills and previous meeting minutes.

parking-commissionelm-street-plazafood-truckseventscommunity-development
Tue Aug 20, 2024

Westfield Cultural Council

Council to discuss grant writing class and farmer's market survey

The Westfield Cultural Council will meet to approve July meeting minutes and hear the treasurer's report. New business includes reviewing results from a survey on farmer's market appearances and discussing a grant writing class scheduled for September 6th.

cultural-councilgrantsfarmer's-marketpublic-participationmeeting-minutes
Tue Aug 20, 2024

Planning Board

Planning Board to review special permits for residential conversions and flag lots

The Westfield Planning Board will hold public hearings on several special permit applications. The board will consider residential conversions, the creation of flag lots, and a site plan for a city playground.

zoningspecial-permitshousingland-usesubdivisions
✓ Decided: Planning Board approves lighting waiver for Paper Mill Rd playground

The Westfield Planning Board approved a lighting standards waiver for the playground at 148 Paper Mill Rd, allowing the city to install LED lights in the parking lot. The board also approved a special permit for a two-family conversion at 22 Woronoco Ave, and continued several hearings to September 17, 2024. A request to revoke a special permit for 121 Medeiros Way was discussed but not acted upon.

Tue Aug 20, 2024

Health Plan Trust

Trust to review retiree insurance renewal and plan balance

The Westfield Health Plan Trust will meet to approve minutes from March and April, review the Health Plan Trust Balance, and discuss a preliminary renewal of retiree insurances. No specific dollar amounts or decisions are yet recorded in the agenda.

healthinsuranceretireesbudgetwestfield
Tue Aug 20, 2024

City Council Personnel Action Committee

Committee to amend Planning Board term dates and consider reappointments

The Personnel Action Committee will discuss amendments to Planning Board member expiration dates to comply with city ordinance, consider reappointments to the Planning Board, Commission for Citizens with Disabilities, and Cultural Council, and review a change to the City Engineer job description.

personnelappointmentsplanning-boardcommissionscity-engineercultural-council
Tue Aug 20, 2024

Commission for Citizens with Disabilities

Westfield Commission for Citizens with Disabilities meets August 20

The commission will meet to review account updates for fines and forfeits. Members will also discuss website links and the commission pamphlet.

disability-servicespublic-outreachcity-administration
✓ Decided: Westfield disability commission approves July minutes, hears fines update

The Commission for Citizens with Disabilities approved its July 16, 2024 minutes unanimously (6-0). Members received an update on fines and forfeits showing a balance of $27,510 after expenditures, and discussed various old and new business items including a pamphlet, a NAMI subscription request, and new flashing lights on crosswalks. No substantive policy decisions were made beyond the minutes approval.

Thu Aug 15, 2024

City Council

Council to consider $1M EPA grant for new wastewater building

The City Council will consider accepting over $1.9 million in grants, including $1,000,000 from the EPA for a new Operations Building at the water recovery facility, and $366,030 for airport obstruction work. Other items include appointments, reappointments, ordinance amendments for animal licensing and facilities management, and resolutions amending host community agreements for three marijuana businesses. Public hearings are scheduled for a junk dealer license and a continued hearing for a contractor's yard on North Road.

grantsairportwastewaterpublic-safetyzoningmarijuanalicensing
✓ Decided: Council adopts Medeiros Way easement for battery storage project

The City Council voted to adopt a resolution authorizing the mayor to execute an easement for a portion of Medeiros Way, related to the Jupiter Powers Battery Storage Facility (Stream Field Energy Storage). The vote was 10-2, with Councilor Morganelli absent. A motion to table the item failed 4-8. The council also accepted several grants, including a $366,030 FAA airport grant and multiple state 911 grants.

Thu Aug 15, 2024

City Council

Public hearings on contractor's yard at 0 North Road and junk dealer licenses at 54 Washington Street

The Westfield City Council will hold public hearings on August 15, 2024, to consider two applications: a special permit, site plan approval, and stormwater permit for a contractor's yard at 0 North Road, and junk dealer and junk collector licenses at 54 Washington Street.

zoningpublic-hearinglicensescontractor-yardjunk-dealer
Thu Aug 15, 2024

City Council Finance Committee

Finance Committee to consider accepting $1.56M in state 911 grants for regional dispatch center

The Finance Committee will vote on recommending acceptance of four grants from the Massachusetts Executive Office of Public Safety and Security State 911 Department totaling $1,564,650.88. The funds are for the Westfield Regional Public Safety Communication Center to cover personnel, training, equipment, and transition costs, including serving the Town of Southwick's dispatching needs.

grantspublic-safety911dispatchfinancewestfield
Wed Aug 14, 2024

Board of Health

Westfield Board of Health meeting cancelled for August 14

The Westfield Board of Health meeting scheduled for August 14, 2024, has been cancelled. The next regularly scheduled meeting will be on September 11, 2024, at 6:00 p.m.

meeting-cancellationboard-of-health
Tue Aug 13, 2024

Conservation Commission

Wetland violations and boundary hearings on Conservation Commission agenda

The Westfield Conservation Commission will hold public hearings on wetland boundary delineations and a request for amendment at 149 Neck Road. The commission will also consider a certificate of compliance for a retail facility project at 192-196 East Main Street and enforcement orders for several properties involving unauthorized clearing, fill placement, and violations of prior orders. Discussion items include regulations and procedures with a guest from Mass Audubon.

conservationwetlandsenforcementpublic-hearingswestfieldwetlands-protection
✓ Decided: Commission issues enforcement order for unpermitted garage in buffer zone

The Westfield Conservation Commission issued an enforcement order against Serghei Marcu for constructing a garage structure within the 100ft Buffer Zone without a permit, and for debris piles in the same area. The Commission also approved an amended order for tree removal at 149 Neck Road, continued several hearings to August 27, 2024, and granted an extension for stormwater basin work at 575 North Road.

Mon Aug 12, 2024

License Commission

License Commission to review outdoor patio and entertainment licenses

The License Commission is meeting to review several business license amendments and transfers. The body will hold a public hearing regarding an outdoor service area and consider multiple one-day alcohol permits for upcoming events.

liquor-licensesbusiness-permitsoutdoor-diningentertainmentauto-licenses
✓ Decided: Westfield License Commission approves multiple licenses and transfers

The Westfield License Commission approved a pledge of stock for Tribeca Gastro Bar & Grille, an outdoor patio alteration for Great Awakening Brewing Company, a transfer of auto licenses for Railroad Auto Recycling, a conditional common victualler license and an entertainment license for Xtra Credit, and several one-day liquor licenses. All votes were unanimous.

Mon Aug 12, 2024

Parks and Recreation Commission

Parks and Recreation Commission meeting cancelled

The Parks and Recreation Commission meeting scheduled for August 12, 2024, has been cancelled. The next meeting is set for September 9, 2024.

meeting-cancellationparks-and-recreation
Mon Aug 12, 2024

Police Commission

August 12 Police Commission meeting cancelled

The Westfield Police Commission meeting scheduled for August 12, 2024 has been cancelled. No business will be conducted.

policemeeting-cancelledwestfield
Thu Aug 8, 2024

Board of Health

Board of Health to interview and vote on new Director of Health

The Board of Health is holding a special meeting to conduct interviews with three candidates for the Director of Health position. After the interviews, the board may discuss and vote on an appointment. This decision will determine the leadership of Westfield's public health department.

healthpublic-healthpersonnelhiringwestfield
✓ Decided: Westfield Board of Health appoints Debra Mulvenna as Public Health Director

The Board of Health interviewed three candidates for the Director of Health position and voted unanimously to appoint Debra Mulvenna, who had served as Acting Health Director for the past 13 months. The appointment was approved by a 3-0 vote. The meeting was otherwise limited to candidate interviews and discussion.

Thu Aug 8, 2024

Westfield Airport Commission

Westfield Airport Commission meeting cancelled

The August 8, 2024 meeting of the Westfield Airport Commission has been cancelled. No items will be discussed or decided.

airportcancelledwestfield
Wed Aug 7, 2024

Municipal Light Board

Municipal Light Board meeting for August 7, 2024, cancelled

The Municipal Light Board meeting scheduled for August 7, 2024, has been cancelled. The board will next meet on September 4, 2024.

municipal-light-boardmeeting-cancellation
Tue Aug 6, 2024

City Council Legislative and Ordinance Committee

Council committee to consider Medeiros Way easement and DPW ordinance revisions

The Legislative and Ordinance Committee will discuss a resolution authorizing the mayor to execute an easement for a portion of Medeiros Way, and proposed revisions to city ordinances covering the Department of Public Works (Chapter 18) and city departments, boards, and officers (Section 9). The meeting also includes public comment and approval of prior minutes.

easementpublic-worksordinance-revisioncity-councilwestfield
Mon Aug 5, 2024

Westfield Airport Commission

Commission considers $366,030 FAA grant for runway easement

The Westfield Airport Commission is holding a special meeting to discuss a federal grant. The body may vote to accept funds for acquiring avigation easements to address obstructions for Runway 15.

airportgrantsaviationinfrastructure
✓ Decided: Airport Commission accepts $366,030 FAA grant for easements

The Westfield Airport Commission voted unanimously to accept a Federal Aviation Administration Bipartisan Infrastructure Law grant of $366,030.00 for the acquisition of avigation easements on six properties near Runway 15. The meeting was a special session with no public participation and no other agenda items.

Wed Jul 31, 2024

Youth Commission

Youth Commission holds regular meeting with standard procedural items

The Westfield Youth Commission will convene for a regular meeting covering roll call, approval of minutes, member status updates, old business, new business, and public participation. No specific decisions or notable agenda items are listed.

youth-commissionproceduralwestfield
Thu Jul 25, 2024

Personnel Department

Board of Health Screening Committee to interview job applicants

The Screening Committee of the Westfield Board of Health is meeting to consider or interview applicants for employment. This meeting will be conducted entirely in executive session.

personnelboard-of-healthhiring
Sat Jul 20, 2024

Hampden Charter School of Science

Hampden Charter School of Science board to vote on bylaws and refinancing

The board will discuss and vote on the adoption of bylaws, refinancing, and a 401K plan merger. The meeting also includes a vote on the Student Opportunity Act Plan and an amendment to the Accountability Plan.

educationcharter-schoolgovernancefinanceretirement-plans
Fri Jul 19, 2024

Hampden Charter School of Science

Charter school board retreat with annual overview and self-evaluation

The Hampden Charter School of Science board is holding a three-day retreat. Friday includes an annual overview for 2023-24, Saturday features board meetings, and Sunday is a board self-evaluation. The agenda contains only general sessions with no specific decisions or proposals listed.

educationcharter-schoolboard-meetingretreatself-evaluation
Thu Jul 18, 2024

Retirement Board

Westfield Retirement Board to review investments and retirement applications

The Retirement Board will conduct investment performance reviews and provide an update on a Request for Proposals (RFP). The body will also process retirement and disability applications and handle bills payable.

retirementinvestmentspensionsfinance
✓ Decided: Retirement Board approves pensions, new members, and bills

The Westfield Contributory Retirement Board approved retirement applications and figures for several employees, accepted new members, and approved bills and warrants. The board also received an investment update and discussed disability applications and a hearing for a member who failed to file required paperwork.

Thu Jul 18, 2024

Conservation Commission

Conservation Commission to review enforcement orders and landscaping proposal

The Commission will hold a public hearing regarding landscaping at 114 Northridge Street and consider five enforcement orders for wetlands and buffer zone violations. The body will also discuss ordinance proposals and conservation restrictions with a DEP representative.

wetlandszoningenvironmentordinancepublic-hearing
✓ Decided: Conservation Commission continues enforcement cases, issues partial compliance certificate

The Westfield Conservation Commission continued multiple enforcement orders and Notice of Intent hearings to August 13, 2024, including the 114 Northridge Road violation case. The Commission issued a partial certificate of compliance for 4 Angelica Drive and closed the enforcement order at 456 North Road. All votes were unanimous (5-0) where recorded.

Thu Jul 18, 2024

Westfield Airport Commission

Possible vote on Air Methods lease extension, budget and capital plan updates

The Westfield Airport Commission will consider approving a second lease extension for Air Methods. They will also receive updates on the Taxiway B South project, the five-year capital improvement program (FY2025-FY2029), and the FY2025 airport department budget. Standard updates on engineering, operations, and noise program will be presented.

airportbudgetcapital-improvementleasenoiseoperationstaxiway
✓ Decided: Air Methods lease extension approved by Airport Commission

The Westfield Airport Commission approved a lease extension for Air Methods Corporation, with a roll call vote of 2-0. The commission also approved the June 20, 2024 meeting minutes. Other items were informational, including updates on the Taxiway B South project, the five-year capital improvement plan, and the FY2025 airport budget, which was approved by the City Council as presented.

Tue Jul 16, 2024

Planning Board

Planning Board to hear six development applications including storage and contractor shops

The Westfield Planning Board will conduct a regular meeting on July 16, 2024, continuing public hearings for several applications including a self-storage expansion at 264 Lockhouse Rd. and a new self-storage at Norton St./0 Lockhouse Rd., along with contractor shop proposals at 1026 Southampton Rd. and 254 Union St. The board will also review a special permit for lot access from 457 E. Main St. and a new application for access to 0 North Rd. from Southampton Rd. Additionally, the board will discuss a review of the Planning Board ordinance and appointment terms requested by Mayor McCabe.

zoningplanning-boardpublic-hearingssite-plan-approvalstormwater-permitspecial-permitself-storagecontractor-shop
Tue Jul 16, 2024

Westfield Cultural Council

Westfield Cultural Council to review minutes, treasurer report, and farmer's market appearances

The Westfield Cultural Council is meeting primarily for procedural items: approval of previous meeting minutes, a treasurer's report, and verification of farmer's market appearances. Public participation is also scheduled.

cultural-councilminutestreasurer-reportfarmers-marketpublic-participation
Tue Jul 16, 2024

Commission for Citizens with Disabilities

Commission reviews playground access and 4th of July event outreach

The Commission for Citizens with Disabilities will review minutes from June, update on fine and forfeits accounts, discuss website links and a commission pamphlet, and review a meeting about the Cross Street All Access Playground. Members will also evaluate the disability table held at the 4th of July fireworks event. No votes on ordinances or spending are scheduled.

commission-for-citizens-with-disabilitiesaccessibilityplayground4th-of-julyminutesfines
Mon Jul 15, 2024

Police Commission

Police Commission meeting cancelled for July 15

The Westfield Police Commission meeting scheduled for July 15, 2024 has been cancelled. No items will be discussed or decided.

meeting-cancelledpolice-commission
Thu Jul 11, 2024

Westfield Housing Authority

Westfield Housing Authority to elect officers and discuss modernization updates

The Westfield Housing Authority will hold its annual meeting to elect new officers and discuss modernization updates. The agenda includes reviewing committee reports and communications from the Executive Office of Housing and Livable Communities. Bill payments for 400-1, 689, MRVP, and Section 8 programs will also be addressed.

housingelectionmodernizationfinancegovernment
Thu Jul 11, 2024

Council On Aging

Westfield Council on Aging to discuss strategic plan and budget updates

The meeting includes a discussion of Goal #4 within the Strategic Plan. The Director will also provide a year-end review and an overview of changes to the budget process.

senior-servicesstrategic-planbudgetadministration
Wed Jul 10, 2024

Municipal Light Board

The Municipal Light Board will review utility reports and a 12.5% discount.

The board will review several quarterly utility reports, including gas sales and energy supply outlooks. Members will also address sub-committee assignments and community communications. An executive session is scheduled to discuss real property negotiations.

utilityenergywestfieldmunicipal-lightpublic-utilities
Wed Jul 10, 2024

Board of Health

Review of updated City of Westfield Body Art Regulations

The Board will review minutes from the June 12, 2024 meeting and approve monthly bills for the Health Department and Transfer Station. The agenda also includes discussions regarding body art regulations, permit fees, and a landfill billboard lease.

body artlandfillhealth departmentregulationspermits
Tue Jul 9, 2024

Conservation Commission

Westfield Conservation Commission July 9 meeting cancelled

The Conservation Commission meeting scheduled for July 9, 2024, has been cancelled due to a lack of quorum. The only meeting scheduled for the month of July will be on July 23, 2024.

conservationmeeting-cancellationwestfield
Tue Jul 9, 2024

Board of Public Works

DPW Board considers Jupiter Power Company easement and tree removal

The Board of Public Works Commissioners will discuss an easement on Medeiros Way for Jupiter Power Company. The agenda includes a public hearing regarding tree removal at 420 Paper Mill Road and a review of a stormwater management plan for 0 Lockhouse Road.

utilitiestreesinfrastructurepublic-worksstormwater
Tue Jul 9, 2024

Personnel Department

Westfield Board of Health screening committee meets to interview job applicants

The Screening Committee of the Westfield Board of Health will meet in executive session to consider or interview applicants for employment or appointment. The committee will not return to open session following this meeting.

hiringpersonnelhealthgovernment
Mon Jul 8, 2024

City Council Finance Committee

Agenda for July 8, 2024, Finance Committee meeting is unavailable

The provided text contains only website navigation and a technical error message stating the agenda file could not be retrieved from the system. No specific items, proposals, or discussions are listed for this meeting.

westfieldfinance committeeagenda unavailable
Mon Jul 8, 2024

Police Commission

Westfield Police Commission meeting rescheduled to July 15, 2024

The regular meeting originally scheduled for July 8, 2024, has been moved to July 15, 2024. This notice contains only the rescheduling announcement and no other agenda items.

policeproceduralmeeting-notice
Mon Jul 8, 2024

License Commission

Ownership change application for Tribeca Gastro Bar & Grille at 89 Elm Street

The License Commission will consider an ownership change for Tribeca Gastro Bar & Grille. The meeting also includes reviews of one-day malt beverage licenses for the Westfield Fair and previously approved liquor licenses for Westfield State Dining.

liquor-licensesbusiness-ownershipwestfield-fairfood-and-beverage
Mon Jul 8, 2024

School Committee Subcommittee

Subcommittee to set 2024-2025 meeting schedule and review project updates.

The Facilities/Capital Planning Subcommittee will meet to determine the meeting schedule for the 2024-2025 school year. The committee will also receive an update on projects from the 2023-2024 period.

schoolsfacilitiescapital planningmeeting schedule
Mon Jul 8, 2024

City Council

Westfield City Council considers $1,040,343 public safety grant

The City Council will consider several grants from the State 911 Department for public safety operations and equipment. The agenda also includes a proposed new fee schedule for the Building Department and a motion to review speed zone changes outside the core district.

public-safetybudgettransportationbuilding-department
Mon Jul 8, 2024

Parks and Recreation Commission

Discussion of new skate park funding and memorial projects in Westfield parks

The commission will discuss funding for a new skate park and review a $900.00 donation to the skatepark account. The agenda also includes updates on memorial projects at Chauncey Allen Park and Parker Memorial Park.

parksrecreationskateparkmemorialsfunding
Thu Jul 4, 2024

City Council

Westfield City Council meeting rescheduled to July 8, 2024

This agenda contains a notice of meeting date change. The City Council meeting originally scheduled for Thursday, July 4, 2024, has been moved to Monday, July 8, 2024, at 7:00 PM.

city-councilmeeting-noticeschedule
Wed Jul 3, 2024

Municipal Light Board

Municipal Light Board July 3 meeting rescheduled to July 10

The Municipal Light Board meeting originally scheduled for July 3, 2024, has been moved to July 10, 2024. The meeting is set to take place at 6:00 p.m.

municipal-light-boardmeeting-noticerescheduling
Wed Jun 26, 2024

Youth Commission

Youth Commission meeting scheduled for June 26, 2024

The provided agenda contains only standard procedural items. No specific new business or projects are detailed in the document.

youthprocedural
Wed Jun 26, 2024

Traffic Commission

Westfield Traffic Commission reviews new signals and engine brake ordinances

The commission will consider requests for new traffic signals and 'No Turn on Red' designations at several intersections. The meeting also includes discussions on proposed city ordinances regarding engine brakes and crosswalk signage.

trafficordinancespublic-safetyparkingroads
Wed Jun 26, 2024

Off-Street Parking Commission

Review of food truck license request for Northside Creamery

The Commission will discuss a request from Northside Creamery to operate a food truck at the Elm Street Plaza and Lot. The Community Development Director will also provide updates on summer maintenance and the recent Elm Street Plaza event summary.

parkingfood truckelm street plazacommunity developmentbusiness
Wed Jun 26, 2024

Zoning Board of Appeals

Public hearing for porch expansion at 55 Day Ave.

The Westfield Zoning Board of Appeals will hold a public hearing regarding a special permit to rebuild or expand a porch at 55 Day Ave. The board will also review new applications and discuss a variance extension request for 0 Granville Rd.

zoningpublic-hearingresidentialpermits
Tue Jun 25, 2024

Conservation Commission

Westfield Conservation Commission reviews contractor shop proposals and enforcement orders

The Westfield Municipal Conservation Commission will hold public hearings for proposed contractor facilities at 254 Union Street and 103 Main Line Drive. The commission will also address several enforcement orders regarding unapproved clearing and construction. Additionally, the board will review the Land Management Plan for Tekoa Narrows.

conservationzoningenvironmentalpublic-hearingenforcement
Tue Jun 25, 2024

Westfield Airport Commission

Westfield Airport Commission to discuss property leases in executive session

The Westfield Airport Commission is holding a special meeting to discuss two real property leases. These discussions will take place during an executive session, and the commission does not intend to return to open session.

airportleasingreal-estatewestfield
Mon Jun 24, 2024

Historical Commission

Updates on Wyben Schoolhouse and National Historic Registry progress

The Historical Commission will discuss updates regarding the Wyben Schoolhouse and progress toward the National Historic Registry. The meeting also includes cemetery updates for Old Burying Grounds and Owen District, as well as demolition notifications.

historical-preservationwyben-schoolhousecemeterydemolitionwestfield
Thu Jun 20, 2024

Retirement Board

Westfield Retirement Board to review monthly investment performance

The Westfield Retirement Board will hold a regular meeting via conference call. The board will review monthly investment performance and approve routine administrative items including bills, minutes, and retirement applications.

retirementinvestmentsbudgetadministration
Thu Jun 20, 2024

City Council

Westfield City Council considers $4 million appropriation to reduce FY25 tax rate

The City Council will consider a $4 million appropriation intended to reduce the FY25 tax rate. The agenda also includes land acquisitions for a new police station and zoning amendments regarding signs. Additionally, the council will review grants for fire safety and digital equity planning.

taxpolicezoningbudgetfireinfrastructure
Thu Jun 20, 2024

City Council Legislative and Ordinance Committee

Committee reviews land acquisition for new police station in Westfield

The committee will consider resolutions for land acquisition at 6 Union Street, 24 Union Street, and 9 Columbia Street to build a new police station. The agenda also includes reviewing a TIF agreement for 323 Lockhouse Road and establishing several Council on Aging revolving accounts.

policezoningbudgetgrantshousingcouncil-on-aging
Thu Jun 20, 2024

City Council Finance Committee

Westfield Finance Committee reviews land purchase for new police station

The committee will consider appropriations to cover deficits in Department of Public Works snow and ice accounts. The agenda also includes a $758,083.33 appropriation for land at 6 Union Street, 24 Union Street, and 9 Columbia Street for a new police station. A proposed fee schedule for the Building Department will be presented.

policebudgetdpwland-purchasebuilding-department
Thu Jun 20, 2024

Westfield Airport Commission

The Commission will review the FY2025 airport fee schedule and budget.

The Westfield Airport Commission will discuss the FY2025 airport budget and fee schedule. The agenda includes updates on electric aircraft charging stations and an FAA inspection review. Members will also address a request for static aircraft at the new main gate.

airportbudgetfeesaviationinfrastructure
Wed Jun 19, 2024

Traffic Commission

Westfield Traffic Commission meeting rescheduled to June 26, 2024

The regular meeting scheduled for June 19, 2024, has been moved to Wednesday, June 26, 2024, due to a holiday. This notice contains only procedural information regarding the schedule change.

trafficmeeting-noticewestfield
Tue Jun 18, 2024

Westfield Cultural Council

The Westfield Cultural Council meeting for June 18, 2024, is cancelled.

The Westfield Cultural Council meeting scheduled for June 18, 2024, has been cancelled due to election activity. The next meeting is scheduled for July 16, 2024, at 7 pm.

cancellationelection activitywestfield
Tue Jun 18, 2024

Commission for Citizens with Disabilities

Commission to vote on Nami liaison and review fine accounts

The Commission for Citizens with Disabilities will meet to approve minutes from May 21, 2024. The agenda includes an update on fine and forfeit accounts and a vote on a Nami liaison.

disability-servicespublic-meetingadministration
Mon Jun 17, 2024

Planning Board

Review of Pezzini Estates subdivision closeout and covenant release

The Westfield Planning Board is conducting a special meeting to review the subdivision closeout and covenant release for ‘Pezzini Estates’ regarding Dox Rd. Improvements.

subdivisioninfrastructurewestfield
Mon Jun 17, 2024

School Committee

Westfield School Committee to review teacher evaluation and stipend updates

The committee will review updates to teacher evaluation and stipends for Unit A teachers. Members will also consider policies regarding school choice and non-resident student admission.

schoolpolicybudgetteacherswestfield
Mon Jun 17, 2024

School Committee

School Committee to discuss teacher union bargaining strategy in executive session

The Westfield School Committee will hold an executive session on June 17, 2024. The committee will approve minutes from the June 4 meeting and discuss strategy regarding collective bargaining or litigation involving the Westfield Education Association Unit A.

school-committeelabor-relationsteachersexecutive-session
Mon Jun 17, 2024

School Committee Subcommittee

Subcommittee will review a high-level Scope and Sequence document.

The Instruction & Curriculum Subcommittee will review a high-level Scope and Sequence document. The subcommittee will also receive a presentation on data collection methods used to assess district effectiveness. Additionally, members will discuss planning topics for future meetings, including program updates and strategic priorities.

curriculumdataeducationplanning
Mon Jun 17, 2024

Personnel Department

Westfield Board of Health screening committee meets to consider job applicants

The Screening Committee of the Westfield Board of Health will meet to assign a chair and secretary. The committee will also enter an executive session to consider or interview applicants for employment or appointment.

personnelhiringboard-of-healthwestfield
Mon Jun 17, 2024

City Council Zoning, Planning and Development Committee

Proposed amendments to electronic and municipal sign zoning ordinances

The committee will consider two petitions from the Planning Board regarding amendments to the Zoning Ordinance. These proposals seek to relax permitting requirements for electronic messaging signs and signs at municipal facilities.

zoningordinancesignageplanning
Thu Jun 13, 2024

City Council

Public hearing on the Mayor's proposed annual budget

The City Council will hold a public hearing regarding the annual budget submitted by the Mayor. The Finance Committee is also scheduled to report on Fiscal Year 2025 Budget Reconciliation.

budgetfinancepublic-hearing
Thu Jun 13, 2024

Retirement Board

Westfield Retirement Board considers selling $5 million in index funds for cash

The Westfield Retirement Board met via conference call to discuss investment trades. The board reviewed recommendations to sell specific index funds to provide cash for capital calls and monthly bills.

retirementinvestmentsfinance
Thu Jun 13, 2024

Hampden Charter School of Science

Hampden Charter School Board to discuss mortgage refinancing and loans

The Hampden Charter School of Science Board will meet to discuss mortgage consolidation, refinancing, and a loan beyond the charter term. The board will also vote on the 2024-25 school calendar and trustee term renewals. A CEO report covering enrollment, academics, and personnel will be presented.

schoolfinancemortgageadministrationcharter-school
Wed Jun 12, 2024

City Council Finance Committee

Finance Committee to review reports from Engineering, DPW, and Sewer departments

The Finance Committee will hear updates from several city departments including Engineering, DPW, and Sewerage. The agenda also includes a report on Other Post-Employment Benefits (OPEB).

financeengineeringdpwsewerairportbenefits
Wed Jun 12, 2024

Board of Health

Westfield Board of Health to review updated body art regulations

The Westfield Board of Health will review meeting minutes and monthly bills for the Health Department and Transfer Station. The board is also scheduled to discuss updated body art regulations, permit fees, and nuisance or bee regulations.

healthregulationspermitspublic-health
Wed Jun 12, 2024

Board of Assessors

Approval of May abatement reports and roll back tax signing

The Board of Assessors will review the May monthly abatement and commitment reports. The meeting also includes an executive session for discussions or possible votes on abatement and exemption applications.

assessmenttaxesabatementexemption
Tue Jun 11, 2024

Conservation Commission

Westfield Conservation Commission reviews development proposals and enforcement orders

The Commission will review several requests for septic system replacements, tree removals, and construction projects within protected wetland zones. Members will also address multiple enforcement orders regarding unapproved land disturbances and construction. Additionally, the commission will discuss the FY25 budget and a land management plan for Tekoa Narrows.

wetlandszoningenforcementbudgetland-useconservation
Tue Jun 11, 2024

Board of Public Works

Board reviews FY25 Public Works budgets and stormwater permit exemptions

The Board will discuss FY25 division budgets and review the status of Gifford Avenue as a public roadway. The meeting also includes a public hearing for tree removal at 420 Papermill Road.

budgetroadsstormwaterpublic works
Tue Jun 11, 2024

Westfield Technical Academy

Price increases for Tiger’s Pride and catering events

The Culinary Arts Program Advisory Committee will discuss program updates, including freshman enrollment and upcoming student exams. The meeting also covers catering operations and equipment donations.

culinaryeducationcateringschool-programs
Mon Jun 10, 2024

Police Commission

Appointment of traffic control officers and a special officer

The Police Commission will consider the appointment of several traffic control officers and one special officer. The meeting also includes an update on a plaque for former Chief Lawrence Valliere and the approval of May 1, 2024 minutes.

policeappointmentspersonnelpublic-safety
Mon Jun 10, 2024

Parks and Recreation Commission

Westfield Parks Commission to vote on summer field permits and skatepark grant

The Westfield Parks and Recreation Commission is meeting to approve minutes, hear public comments, and discuss several permits and projects. Key items include a lacrosse permit for Boardman Field, a dedication date for Barbara Swords Park, a grant deadline for the skatepark, a new permit for Bullens Field, and a pickleball tournament permit. The meeting is scheduled for June 10, 2024, at City Hall.

parkspermitsgrantspickleballlacrosse
Mon Jun 10, 2024

Westfield Technical Academy

Status report on co-op survey letter and board attendance discussion

The Westfield Technical Academy Advisory Committee will review meeting minutes and discuss the status of a co-op survey letter. The committee will also discuss ways to improve board member attendance.

educationboard attendancewta
Mon Jun 10, 2024

Council On Aging

Westfield Council on Aging to discuss nutrition updates and strategic planning.

The board will review minutes from the May 13, 2024 meeting and hear a nutrition update for Highland Valley Elder Services. Discussion also includes an overview of Strategic Plan Goal #3 and paper towels in public restrooms.

senior-servicesnutritionstrategic-planpublic-facilities
Mon Jun 10, 2024

License Commission

Westfield License Commission considers farmers market and fair beer permits

The Westfield License Commission will review a special license request for Daggers Meadery to sell products at the Westfield Farmers Market and approve a one-day malt beverage permit for the 96th annual Westfield Fair. These approvals determine which vendors may serve alcohol at local summer events attended by residents. The body will also process administrative updates for two auto dealerships, receive police incident reports, and note an Off-Street Parking Commission approval for summer concerts in Elm Street Plaza.

licensingalcohol-salesfarmers-marketlocal-eventsauto-dealerspublic-safetycity-administration
Thu Jun 6, 2024

City Council

Westfield City Council to review zoning changes for electronic signs

The Westfield City Council will hold a public hearing on June 6, 2024, at the Municipal Building. The council is considering a Planning Board petition to amend zoning ordinance section 8-10.1&2. The proposed amendment would change how permits are issued for electronic message signs and signs at municipal facilities. Adjustments to these permitting rules may affect property owners, businesses, and city departments that install or maintain such displays.

zoningpublic-hearingsignagecity-councilwestfield-ma
Thu Jun 6, 2024

City Council

Public hearing for a contractor’s yard at 0 North Road

The Westfield City Council will hold a public hearing regarding an application for a contractor's yard with associated site improvements. The request includes a Special Permit, Site Plan Approval, and Stormwater Permit for the property located at 0 North Road. The application was submitted by RYMC, LLC.

zoningpublic-hearingdevelopmentland-use
Thu Jun 6, 2024

City Council

Westfield City Council considers land purchase for new police station

The council will review a proposal to spend $758,083.33 to purchase land for a new police station. The agenda also includes zoning hearings for electronic signs and a contractor's yard, alongside various fund appropriations for public works and police equipment.

zoningpolicebudgetpublic-worksinfrastructure
Thu Jun 6, 2024

City Council Legislative and Ordinance Committee

Proposals for animal control services, a police gift, and a property deed

The committee will consider an agreement with Easthampton for animal control services. It will also review the acceptance of a donated ambulance simulator for the Police Department and a deed for 31 Bristol Street.

animal-controlpolicepropertyintermunicipal-agreementdonation
Wed Jun 5, 2024

City Council Finance Committee

Westfield Finance Committee to receive updates from several city departments

The City Council Finance Committee will meet to hear presentations from various municipal departments and local organizations. No specific legislative actions or budget decisions are listed on this agenda.

financemunicipal-servicespublic-meetingswestfield
Wed Jun 5, 2024

Emergency Planning Committee

The committee will discuss creating a standardized process for city events.

The Westfield Local Emergency Planning Committee will review upcoming June events and departmental reports. The meeting also includes discussions regarding grant funds and emergency management updates.

emergency managementcity eventspublic safety
Wed Jun 5, 2024

Municipal Light Board

Municipal Light Board to review energy supply, finances, and Ward 5 special election

The board will review monthly financial reports and the Energy Stabilization Funds Quarterly Report. Members will discuss the energy supply outlook and the upcoming Ward 5 special election. The meeting also includes a discussion on supplementing WCF customers.

utilitiesfinanceelectionenergy
Wed Jun 5, 2024

Zoning Board of Appeals

Westfield ZBA to hold public hearings for several special permit applications

The Westfield Zoning Board of Appeals will conduct public hearings on various property use and setback requests. Applications include a change to a thrift store at 54-56 Washington St. and the addition of a second dwelling unit at 15 Noble Ave. The board may also consider a variance extension for 0 Harold Ave.

zoningpublic-hearingsresidentialspecial-permitswestfield
Tue Jun 4, 2024

City Council Finance Committee

Departmental reports for Westfield city departments

The City Council Finance Committee meeting consists of departmental updates and reports. No specific decisions or dollar amounts are listed on this agenda.

buildingpurchasinglegislativecommunity-developmenthealthpersonnel
Tue Jun 4, 2024

Planning Board

Westfield Planning Board to consider several site plan and special permit applications

The Westfield Planning Board will hold public hearings on multiple development applications. These include requests for a self-storage facility at Norton St./0 Lockhouse Rd. and a contractors' shops facility at 1026 Southampton Rd. The board will also review a ground sign permit for City Hall.

zoningland-usepublic-hearingwestfielddevelopment
Tue Jun 4, 2024

School Committee

Westfield School Committee to consider high school trip and home school application

The Westfield School Committee will meet on June 4, 2024, to review several administrative items. Proposed actions include approving a tentative Westfield High School trip to the University of New Hampshire and reviewing home school application #172.

schooleducationtraveladministration
Tue Jun 4, 2024

School Committee

Westfield School Committee to conduct nonunion personnel negotiation strategy

The Westfield School Committee will hold an executive session on June 4 and will not reconvene in open session. The meeting includes approving May 20, 2024, executive session minutes and conducting strategy sessions for negotiations with nonunion personnel.

school-committeeexecutive-sessionpersonnelnegotiations
Tue Jun 4, 2024

School Committee Subcommittee

Review of school policies on public comment and student admissions

The Human Resources & Policy Subcommittee will meet to address several school committee policies. The agenda includes items regarding public comment procedures, school choice, and the admission of non-resident students.

schoolpolicyadmissionspublic-comment
Tue Jun 4, 2024

Westfield Redevelopment Authority

Possible vote on Riverfront District pre-development assistance application

The Westfield Redevelopment Authority will review the February 6, 2024 meeting minutes and a financial summary. The agenda includes an update on the Elm Street Plaza Project and a discussion regarding a possible vote to submit a Community One-Stop application for Riverfront District pre-development assistance.

redevelopmentriverfront-districtelm-street-plazafinance
Tue Jun 4, 2024

City Council Finance Committee

The Finance Committee will review a bond order amendment for Franklin Avenue School

The City Council Finance Committee is considering several funding requests using Free Cash. These items include purchases for the police department, public works maintenance, and the Columbia Greenway Rail Trail. The committee will also address a bond order amendment for the new Franklin Avenue School.

policepublic-worksbudgetschoolsinfrastructure
Thu May 30, 2024

City Council Finance Committee

Finance Committee to review public safety and IT departments

The City Council Finance Committee will meet to hear reports from Information Technology and public safety departments. The session includes updates from the Police, Fire and Ambulance, and Public Safety Communication sectors.

financepublic-safetypolicefireinformation-technology
Wed May 29, 2024

Youth Commission

Westfield Youth Commission to meet May 29

The Youth Commission will meet to conduct business including a review of meeting minutes and member status. The agenda consists of procedural boilerplate with no specific projects or proposals listed.

youth-commissionprocedural
Wed May 29, 2024

City Council Finance Committee

Mayor McCabe to submit Fiscal Year 2025 budget amendments

The City Council Finance Committee will review proposed amendments to the Fiscal Year 2025 Budget. The meeting includes financial overviews from the City Assessor, Collector/Treasurer, and Auditor.

budgetfinancegovernment-operationsschools
Tue May 28, 2024

Retirement Board

Westfield Retirement Board to review investment performance and 2023 annual statement

The Retirement Board will conduct a monthly performance review and discuss the need for a Request for Proposals (RFP) regarding international equity. The board is also scheduled to review and approve the 2023 Annual Statement. Additional business includes processing retirement and disability applications.

retirementinvestmentsfinancepensions
Tue May 28, 2024

Conservation Commission

Conservation Commission to review wetland and floodplain project applications

The Conservation Commission will hold public meetings and hearings regarding proposed construction and landscaping projects in protected jurisdictional areas. The body will also address enforcement orders for unauthorized clearing of wetlands and floodplains.

wetlandszoningenvironmentpublic-hearingsflood-control
Thu May 23, 2024

City Council Zoning, Planning and Development Committee

Committee to review truck terminal application for 209 Lockhouse Road

The Zoning, Planning and Development Committee is meeting to consider permit applications for a truck terminal. The body will review special permit, site plan approval, and stormwater permit requests for the site.

zoningplanningtruck-terminalpermits
Tue May 21, 2024

Planning Board

Planning Board to review self-storage and sign permit applications

The Planning Board will hold public hearings on several site plan approvals and a zoning ordinance amendment. The board is considering permits for storage facilities, a contractor's shop, and municipal signage.

zoningsite-planpublic-hearingsignscommercial-development
Tue May 21, 2024

Westfield Cultural Council

Westfield Cultural Council to review Articulture surveys and grant class planning

The Westfield Cultural Council will meet to discuss new business including Articulture surveys and farmer's market appearances. The body will also plan a grant class scheduled for September.

artsculturegrantscommunity-outreach
Tue May 21, 2024

City Council Personnel Action Committee

Personnel Action Committee to review two commission reappointments

The City Council Personnel Action Committee is meeting to process the reappointment of two members to city commissions. These actions determine who will serve on the Historical and License commissions.

appointmentshistorical-commissionlicense-commissioncity-council
Tue May 21, 2024

Commission for Citizens with Disabilities

Commission for Citizens with Disabilities to discuss access complaint

The Commission for Citizens with Disabilities will meet to review an access complaint regarding Circuit Coffee. The body will also discuss a possible liaison membership with Nami and updates to website links and pamphlets.

disability-rightsaccessibilitypublic-accesscommunity-outreach
Mon May 20, 2024

School Committee

Westfield School Committee to vote on closing Westfield Virtual School

The School Committee will vote on the closure of the Westfield Virtual School. The body will also consider employment agreements for the Director of Finance and teachers, as well as budget transfers and grant acceptances.

school-closureemployment-contractsbudgetgrantseducation
Mon May 20, 2024

School Committee

School Committee to hold executive session on contract negotiations

The Westfield School Committee will meet in executive session to discuss personnel and labor strategy. The meeting includes discussions regarding collective bargaining and specific employment contracts.

labor-relationscontractspersonnelschool-committee
Mon May 20, 2024

Historical Commission

Westfield Historical Commission to discuss Athenaeum presentation and cemetery wall

The Historical Commission will meet to review updates on the Wyben Schoolhouse and burying ground cleanup. The body will also consider a presentation request from the Trustees of the Westfield Athenaeum and discuss the Owen Cemetery Wall.

historic-preservationcemeteriespublic-buildingscommunity-events
Thu May 16, 2024

City Council

Mayor to present Fiscal Year 2025 Budget

The City Council will review the FY2025 budget and consider multiple appropriations from Free Cash for public safety, public works, and senior services. The body will also address zoning amendments and public hearings for commercial site permits.

budgetpublic-safetyzoninginfrastructurepublic-works
Thu May 16, 2024

City Council Finance Committee

Finance Committee considers funding for generator and fire alarm system

The City Council Finance Committee is reviewing several appropriations from Free Cash and the acceptance of state grants. These funds are intended for infrastructure upgrades and emergency equipment.

budgetinfrastructurefire-departmentgrantspublic-works
Wed May 15, 2024

Off-Street Parking Commission

Commission to consider food truck licenses for Elm Street Plaza

The Off-Street Parking Commission will discuss and potentially vote on food truck licenses for the Elm Street Plaza. The body will also review the FY 2025 budget and receive updates on summer maintenance.

parkingfood-trucksbudgetelm-street-plaza
Tue May 14, 2024

Board of Public Works

Board considers accepting four private ways as city streets

The Board of Public Works will discuss the adoption of several private roads into the city system. Members will also consider rate increases for stormwater and waste collection fees. A public hearing is scheduled regarding a tree removal request on Whispering Wind Road.

roadswaste-collectionstormwaterpublic-worksfees
Tue May 14, 2024

Conservation Commission

Conservation Commission to review wetland and riverfront project applications

The Conservation Commission will hold public meetings and hearings regarding proposed construction and installations in jurisdictional areas. The body will also address several enforcement orders related to soil disturbance and debris dumping in wetlands and riverfront areas.

wetlandszoningenvironmentriverfrontconstruction
Tue May 14, 2024

Franklin Avenue Project School Building Committee Meeting

School Building Committee to vote on school sign and sound panels

The School Building Committee will meet to receive updates from the Owner Project Manager and the Architect regarding the Franklin Avenue Project. The committee is scheduled to vote on a school sign and sound panel pictures.

school-constructionfranklin-avenue-projectpublic-facilities
Mon May 13, 2024

Police Commission

Westfield Police Commission meeting cancelled

The Police Commission meeting scheduled for Monday, May 13, 2024, has been cancelled.

policewestfield
Mon May 13, 2024

Council On Aging

Council on Aging to vote on curbside meals provider

The Westfield Council on Aging Board will meet to conduct board elections and review minutes. The board will discuss and vote on using Highland Valley Elder Services for curbside meals starting around July 1, 2024.

seniorsnutritionhuman-servicesboard-governance
Mon May 13, 2024

License Commission

License Commission to hold hearings on liquor license changes and premises alterations

The License Commission will conduct public hearings regarding ownership changes for Starfire's Concession and a premises alteration for Shortstop Bar & Grill. The body will also review several requests for special one-day liquor licenses and an entertainment license for the American Legion.

liquor-licensespublic-hearingsentertainment-licensealcohol-regulation
Mon May 13, 2024

Parks and Recreation Commission

Parks and Recreation Commission discusses skatepark and athletic field requests

The commission is meeting to discuss various facility improvements and requests for city parks. Items include a skatepark cost estimate and the potential addition of a batting cage and pickleball practice wall.

parksrecreationskateparkpickleballyouth-sports
Thu May 9, 2024

Westfield Housing Authority

Westfield Housing Authority to review quarterly operating statements

The Westfield Housing Authority will hold a special meeting to review quarterly operating statements and bill payments. The board will also discuss modernization updates and year-end statements.

housingbudgetpublic-housing
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
To approve Proprietary Bid for the purchase of stoves during the master meter installation at JFK. Unanimous vote 4 to 0. Ayes: Murphy, Mulligan, Murray, Carmichael ADJOURNMENT Upon the motion of…
3 yea
Murphy yea · Mulligan yea · Murray yea
Thu May 9, 2024

Westfield Airport Commission

Westfield Airport Commission to discuss FY2025 budget and hangar design

The commission will review the FY2025 Airport Department budget and an update on the designer selection for the WTA Hangar feasibility and design. Members may vote on a lease renewal for FlyLUGU Terminal Building Office #111 and a change to the meeting start time.

airportbudgetleasingaviation-infrastructuregovernment-administration
Wed May 8, 2024

Board of Assessors

Board of Assessors to review roll back and partial release for 0 Montgomery Rd

The Board of Assessors will meet to approve monthly abatement and commitment reports. The board will also consider a roll back and partial release for a property at 0 Montgomery Rd. An executive session is scheduled to discuss abatement and exemption applications.

assessorstax-abatementsproperty-valuationreal-estate
Wed May 8, 2024

City Council Natural Resources Committee

Natural Resources Committee to discuss water and sewer ordinances

The Natural Resources Committee will meet via teleconference to continue discussions on several old business items. These include zoning ordinances for water resource protection and regulations regarding septic and sewer systems.

water-resourcessewerzoningconservationenvironment
Wed May 8, 2024

City Council Legislative and Ordinance Committee

Committee reviews TIF for 323 Lockhouse Road and agricultural restrictions

The Legislative and Ordinance Committee is reviewing requests to reduce notice periods for agricultural preservation projects and a tax increment financing agreement. The body will also discuss revisions to city ordinances regarding the Department of Public Works and city departments.

agriculturetax-incentivesordinancesenvironmentpublic-works
Wed May 8, 2024

Board of Health

Westfield Board of Health meeting cancelled

The Board of Health meeting scheduled for May 8, 2024, has been cancelled. The next regular meeting is scheduled for June 12, 2024.

public-healthmeeting-cancellation
Tue May 7, 2024

Planning Board

Planning Board discusses storage facility, office conversion, and city hall signage

The Planning Board will conduct public hearings regarding a self-storage facility at Norton St./Lockhouse Rd. and an office-to-residential conversion at 70 Court St. The meeting also includes a request for a ground sign at City Hall and a discussion on truck terminal restrictions.

zoningstorageresidentialsignagetrucking
Tue May 7, 2024

City Council Personnel Action Committee

Personnel Action Committee to review two commission appointments

The City Council Personnel Action Committee is meeting to submit the appointment of one member to the Conservation Commission and the reappointment of one member to the Historical Commission.

appointmentsconservation-commissionhistorical-commissioncity-council
Mon May 6, 2024

School Committee

Westfield School Committee to vote on FY2024/2025 budget

The School Committee will vote on the FY2024/2025 budget and a three-year school bus transportation contract. The body will also consider several labor agreements and updates to school policies.

budgetcontractstransportationlabor-agreementsschool-policy
Mon May 6, 2024

School Committee

School Committee to hold executive session on labor and contract strategy

The Westfield School Committee is meeting in executive session to discuss collective bargaining and litigation strategies. The session includes negotiations regarding union and nonunion personnel.

labor-relationscollective-bargainingcontractsschool-committee
Thu May 2, 2024

City Council

City Council considers $10 million grant for natural gas pipeline reconstruction

The City Council is reviewing several funding appropriations, including grants for infrastructure and emergency equipment. The body will also hold a public hearing regarding a truck terminal and vote on various appointments and land restrictions.

infrastructuregrantszoningbudgetpublic-safety
Wed May 1, 2024

Police Commission

Police Commission to appoint one lieutenant and one sergeant

The Police Commission will hold interviews and make appointments for two positions effective May 4, 2024. The meeting includes the selection of one lieutenant and one sergeant from lists of three candidates each.

policeappointmentspersonnel
Wed May 1, 2024

Emergency Planning Committee

Westfield Emergency Planning Committee to discuss grant funds and city events

The Local Emergency Planning Committee will meet to review Emergency Management Grants (EMG) and coordinate planning for upcoming city events. The meeting includes updates from emergency management and reports from various city and regional departments.

emergency-managementpublic-safetygrantscity-events
Wed May 1, 2024

Mass Department of Agricultural Resources

Proposed agricultural preservation on North Road and Timber Swamp Road

The Massachusetts Department of Agricultural Resources proposes to acquire an agricultural preservation restriction on property owned by Patricia A. and Lawrence M. Field. This action aims to protect the land's agricultural resources from being converted to other uses in perpetuity.

agricultureland-usezoningwestfieldpreservation
Wed May 1, 2024

Mass Department of Agricultural Resources

Proposed agricultural preservation restriction for 354 Root Road

The Massachusetts Department of Agricultural Resources proposes to acquire an agricultural preservation restriction (APR) on property in Westfield. The goal is to protect the land's agricultural resources in perpetuity by preventing conversion to other uses.

agricultureland-preservationwestfield
Wed May 1, 2024

Municipal Light Board

Municipal Light Board to review FY2024 gas and electric price projections

The board will discuss energy supply, efficiency updates, and monthly financial reports. The agenda includes a review of FY2024 gas and electric price projections for the city. An executive session is also scheduled regarding real property transactions.

gaselectricbudgetutilitiesfinance
Wed May 1, 2024

Zoning Board of Appeals

Zoning Board to hear appeals and permit requests for George and Pleasant Streets

The Westfield Zoning Board of Appeals will hold public hearings regarding a garage permit and a lighting enforcement appeal. The board will also review new applications and discuss potential use changes for 54 Washington St.

zoningpublic-hearingsspecial-permitsland-use
Wed May 1, 2024

City Council Legislative and Ordinance Committee

Council committee to weigh TIF deal for Lockhouse Road LLC

The Legislative and Ordinance Committee is meeting to discuss several resolutions and ordinance revisions. Key items include a proposed Tax Increment Financing (TIF) agreement for SL323 Lockhouse Road LLC, acceptance of gift donations, a conservation restriction, and potential changes to the Department of Public Works ordinance.

tax-increment-financinggiftsconservationordinancepublic-works
Tue Apr 30, 2024

Westfield Technical Academy

Westfield Technical Academy Automotive Technology Advisory Committee meeting

The Automotive Technology Advisory Committee will meet to discuss program operations and student opportunities. The agenda includes reviews of enrollment, internships, and facility equipment.

educationvocational-trainingautomotiveinternships
Tue Apr 30, 2024

City Council Finance Committee

Finance Committee to consider $10 million grant for gas pipeline reconstruction

The Finance Committee will review several grant acceptances and fund appropriations. Key items include federal funding for gas infrastructure and state grants for emergency equipment. The body will also discuss payments from Westfield Gas and Electric and funding for historic restoration and animal control.

grantsinfrastructurepublic-safetybudgethistoric-preservation
Mon Apr 29, 2024

School Committee

School Committee to review FY2024/2025 budget proposal

The Westfield School Committee will hold a special meeting to review the budget proposal for the Westfield Public Schools for the 2024/2025 fiscal year.

budgeteducationwestfield-public-schools
Thu Apr 25, 2024

Retirement Board

Westfield Retirement Board to vote on FY2025 COLA

The Retirement Board will meet to review monthly investment performance and process retirement and disability applications. The board is scheduled to vote on the Cost of Living Adjustment (COLA) for fiscal year 2025 and review board election results.

retirementpensionsbudgetinvestmentscola
Wed Apr 24, 2024

Off-Street Parking Commission

Commission discusses Elm Street Plaza use and parking enforcement

The Commission will receive updates on summer maintenance and food trucks from the Community Development Director. Members will also discuss requests for events at Elm Street Plaza and matters regarding the Parking Enforcement Officer position and uniform contract.

parkingpublic-eventscommunity-developmentgovernment-staffing
Tue Apr 23, 2024

City Council

City Council to consider $10 million gas pipeline grant and $11.1 million bond

The City Council is reviewing several funding requests, including a large federal grant for gas pipeline reconstruction and a bond for athletic field improvements. The body will also consider zoning amendments and a special permit for a truck terminal.

infrastructuregrantszoningbudgetpublic-safetyparks-and-recreation
Tue Apr 23, 2024

City Council

City Council meeting rescheduled to April 23, 2024

The meeting originally scheduled for Thursday, April 18, 2024, has been rescheduled. No other agenda items were provided in the document.

procedural
Tue Apr 23, 2024

City Council

Public hearing for proposed truck terminal at 209 Lockhouse Road

The Westfield City Council will hold a public hearing to consider an application from DM Express, LLC. The request includes a special permit, site plan approval, and stormwater permit for a truck terminal.

zoningpublic-hearingtruck-terminalland-use
Tue Apr 23, 2024

City Council License Committee

License Committee reviews annual renewals for junk dealers and pawnbrokers

The City Council License Committee will meet to process the annual renewal of 2024 licenses. These include Junk Dealer, Junk Collector, Pawnbroker, and Fortune Teller licenses.

licensingbusinessgovernment-administration
Tue Apr 23, 2024

Conservation Commission

Westfield Conservation Commission meeting on April 23, 2024

The Commission will review several project applications and enforcement orders. Items include a proposed truck terminal at 209 Lockhouse Road and multiple enforcement actions regarding soil or debris violations.

wetlandszoningenforcementconstructionwater-supply
Mon Apr 22, 2024

Historical Commission

Westfield Historical Commission to discuss local landmarks and preservation

The Historical Commission is meeting to review updates on several city landmarks and preservation projects. The body will discuss the status of the Wyben Schoolhouse, Atwater Mansion, and Old Burying Grounds.

historic-preservationlandmarkscity-planning
Thu Apr 18, 2024

Traffic Commission

Traffic Commission discusses signal requests and turn restrictions

The Traffic Commission is reviewing several traffic control items, including requests for new signals and changes to parking zones. The meeting also addresses proposed 'No Turn on Red' restrictions at multiple signaled intersections.

trafficroad-safetyparkingsignalswestfield
Thu Apr 18, 2024

Westfield Airport Commission

Westfield Airport Commission to review FY2025 fee schedule

The Westfield Airport Commission will meet to discuss airport operations and infrastructure updates. The body may vote on a request for trailer space from Tobiko Restaurant and will review the fee schedule for fiscal year 2025.

airportfeesinfrastructurenoise-controlaviation
Wed Apr 17, 2024

Community Development

Public hearing on 2024-2025 Community Development Annual Action Plan

The City of Westfield is holding a public hearing to discuss the draft Annual Action Plan for the program year July 1, 2024, through June 30, 2025. This plan identifies resources and programs required to apply for certain U.S. Department of Housing & Urban Development (HUD) programs.

housingbudgetcommunity-developmenthud
Wed Apr 17, 2024

Community Development

Westfield proposes reallocation of CDBG funds for 2020-2024

The City of Westfield is proposing substantial amendments to its Consolidated Plan and Annual Action Plans for 2020-2022. The proposal seeks to reallocate $360,335.67 in unexpended funds to better serve community needs. A public hearing is scheduled for April 17, 2024.

cdbgbudgethousingeconomic-developmentcommunity-planning
Tue Apr 16, 2024

Planning Board

Planning Board considers office-to-residential conversion at 70 Court St.

The Planning Board will hold a public hearing regarding a special permit for a residential conversion of an office building. The board will also review house elevations for a project at 25 St. Paul St. and a proposed amendment to sign regulations for electronic message boards.

zoninghousingspecial-permitssignage
Tue Apr 16, 2024

Commission for Citizens with Disabilities

Commission for Citizens with Disabilities meeting scheduled for April 16

The Commission will review previous meeting minutes and provide an update on the Fine and Forfeits account. Discussion includes website links, a commission pamphlet, and a meeting at the Cross St. playground.

government-administrationpublic-participationcommunity-resources
Tue Apr 16, 2024

Westfield Cultural Council

Westfield Cultural Council to plan April reception

The Westfield Cultural Council will meet to review minutes and the treasurer's report. The body will also finalize plans for an April reception, specifically regarding food, beverages, and arrival times.

cultural-councileventswestfield
Thu Apr 11, 2024

Community Preservation Committee

Committee reviews new fund applications and the FY25 budget

The committee will hold an annual public hearing to solicit city needs regarding the Community Preservation Act. Members will review pending applications for schoolhouse restoration and a garden classroom. The agenda also includes discussions on potential future projects and a review of the Community Preservation Plan.

budgethistoricrecreationcommunity-preservation
Wed Apr 10, 2024

Police Commission

Police Commission to interview patrolman candidate and appoint traffic personnel

The Westfield Police Commission is holding a special meeting to conduct personnel interviews and appointments. The body will also review a leave of absence request for an officer.

policepersonnelhiringpublic-safety
Wed Apr 10, 2024

Board of Assessors

Westfield Board of Assessors meeting rescheduled

The Board of Assessors meeting originally scheduled for Wednesday, April 10, 2024, has been canceled and rescheduled for Tuesday, April 9, 2024.

procedural
Wed Apr 10, 2024

Health Plan Trust

Health Plan Trust to review FY 25 health insurance renewals

The Health Plan Trust is meeting to discuss health insurance renewals for active and early retirees for fiscal year 2025. The body will also review pharmacy and fitness reimbursement programs effective July 1, 2024.

health-insurancebenefitsbudgetretirees
Wed Apr 10, 2024

Board of Health

Board of Health to discuss Kratom and synthetic cannabinoid sales

The Board of Health will meet to review department bills and body art regulations. The agenda includes updates on substance use outreach and the landfill transfer station.

public-healthsubstance-useregulationswaste-management
Wed Apr 10, 2024

City Council Legislative and Ordinance Committee

Committee to review proposed changes to marijuana ordinances

The Westfield City Council Legislative and Ordinance Committee will meet to consider proposed changes to the city's marijuana ordinances, as outlined in a memorandum from the Assistant City Solicitor. The agenda also includes approval of the previous meeting's minutes and public participation.

marijuanaordinancescity-councillegislative-committee
Tue Apr 9, 2024

Board of Assessors

Board of Assessors to review abatement and exemption applications

The Board of Assessors will meet to approve March monthly abatement and commitment reports and PILOT approvals. The meeting includes an executive session to discuss and potentially vote on abatement and exemption applications.

assessorsabatementstaxesexemptions
Tue Apr 9, 2024

Board of Public Works

Board of Public Works to discuss waste collection and stormwater fee increases

The Board of Public Works will hold a public hearing regarding banner placements and discuss potential rate increases for stormwater and waste collection fees. The meeting also includes monthly reports from the Department of Public Works and City Engineering Department.

feeswaste-collectionstormwaterpublic-hearingbanners
Tue Apr 9, 2024

School Committee

Public hearing on proposed FY2024/2025 Westfield Public Schools budget

The Westfield School Committee will hold a special meeting to conduct a public hearing. The primary focus is the proposed budget for the fiscal year spanning July 1, 2024, to June 30, 2025.

budgetpublic-schoolspublic-hearing
Tue Apr 9, 2024

Franklin Avenue Project School Building Committee Meeting

School Building Committee meets regarding Franklin Avenue Project

The School Building Committee will meet to receive updates from the Owner Project Manager and the Architect. The committee is scheduled to vote on a school sign and plaque.

schoolsconstructionpublic-works
Tue Apr 9, 2024

Conservation Commission

Westfield Conservation Commission to review wetland and riverfront projects

The Commission will hold public hearings and meetings regarding proposed construction and installations in protected zones. The body will also address several enforcement orders for wetland and riverfront violations.

wetlandsenvironmentzoningconservationpublic-hearings
Tue Apr 9, 2024

City Council Personnel Action Committee

Personnel Action Committee to review Director of Health job description

The Personnel Action Committee is meeting to review a job description for the Director of Health. No other substantive items are listed on the agenda.

personnelpublic-healthcity-government
Mon Apr 8, 2024

Police Commission

Westfield Police Commission meeting cancelled

The Police Commission meeting scheduled for Monday, April 8, 2024, has been cancelled.

police
Mon Apr 8, 2024

Parks and Recreation Commission

Parks and Recreation Commission to review playground permits and storage requests

The commission is meeting to discuss several permit requests for the use of city playgrounds and Park Square. Members will also review pickleball protocols and designate a representative for the Community Preservation Act Commission.

parkspermitsrecreationpublic-space
Mon Apr 8, 2024

License Commission

License Commission discusses new liquor licenses and event permits

The Commission will hold public hearings for a flower truck business change and a new package store license. Members will also consider several one-day alcohol licenses for community events, block parties, and fundraisers.

liquorbusinesspublic-hearingsevents
Fri Apr 5, 2024

Retirement Board

Retirement Board to consider $30 million in investment adjustments

The Westfield Retirement Board is holding a special meeting to discuss recommended investment adjustments. The board will review proposals to redeem funds from several accounts and reallocate them into others.

retirementinvestmentsfinance
Thu Apr 4, 2024

City Council City Properties Committee

City Properties Committee to discuss rail trail bridge naming and property transfers

The City Properties Committee will meet to discuss the naming of the Main Street Rail Trail bridge and the transfer of the Twiss Street Transfer Station. The committee will also recommend a course of action for the Angie Holmes property on West Silver Street.

infrastructurepublic-workscity-propertyrail-trail
Thu Apr 4, 2024

City Council

City Council considers $11.1 million bond for athletic field improvements

The City Council will review several funding requests, including a large bond for athletic fields and a TIF agreement for 323 Lockhouse Road. The body is also discussing the acceptance of the 2023 Master Plan Update and the layout of Breighly Way as a City Way.

budgetparkszoninginfrastructurepublic-safety
Thu Apr 4, 2024

Parks and Recreation Commission

Parks and Recreation Subcommittee to discuss pickleball protocols

The Parks and Recreation Commission Subcommittee is meeting to discuss rules and regulations for municipal pickleball courts. The body will also review requests from the Westfield pickleball group.

parks-and-recreationpickleballmunicipal-courts
Wed Apr 3, 2024

City Council Legislative and Ordinance Committee

Council committee discusses street acceptances and land use changes

The Legislative and Ordinance Committee will review several petitions for street acceptances and a notice of intent regarding residential land conversion on Montgomery Road. The meeting also includes a resolution for paint stewardship.

zoningstreetsland-useresidentialenvironment
Wed Apr 3, 2024

Emergency Planning Committee

Westfield Emergency Planning Committee to elect officers and discuss event processes

The Local Emergency Planning Committee is meeting to elect a Chair, Vice Chair, and Secretary/treasurer. Members will discuss grant funds and the creation of a standardized process for city events. The meeting includes departmental reports and a discussion regarding an emergency drill with WG&E.

emergency-planningpublic-safetycity-eventsgovernment-administration
Wed Apr 3, 2024

Municipal Light Board

Municipal Light Board to discuss 2024 capital project and reconstruction budget

The Municipal Light Board will review several quarterly utility reports, including gas service reliability and rate comparisons. The board will also discuss the proposed 2024 capital project and reconstruction budget and evaluate the General Manager's contract.

utilitybudgetinfrastructuregaselectricfinance
Wed Apr 3, 2024

Zoning Board of Appeals

Zoning Board to hear requests for garage permit and house construction variance

The Westfield Zoning Board of Appeals will hold public hearings to consider two property applications. The board will decide on a special permit for a garage and a variance for house construction on a lot with limited frontage.

zoningpublic-hearingvariancesresidential-construction
Tue Apr 2, 2024

City Council Finance Committee

Finance Committee to consider $11.1 million bond for athletic field improvements

The City Council Finance Committee will review a bond order for athletic field improvements and a funding request for the Fire Department. The meeting includes a period for public participation.

budgetfire-departmentathleticspublic-works
Tue Apr 2, 2024

Planning Board

Planning Board to review residential conversions and new developments

The Planning Board will hold public hearings on three development applications, including a residential conversion and a self-storage facility. The board will also consider street acceptance petitions and a truck terminal application referred from the City Council.

zoninghousingcommercial-developmentroadspublic-hearings
Tue Apr 2, 2024

Westfield Redevelopment Authority

Westfield Redevelopment Authority to discuss naming of Elm Street Plaza

The Westfield Redevelopment Authority will meet to receive updates on the Elm Street Plaza project. The body will hold a discussion and possible vote regarding the naming of the plaza and brainstorm priority projects.

redevelopmentelm-street-plazacity-planningwestfield
Tue Apr 2, 2024

City Council Zoning, Planning and Development Committee

Committee to review 2023 Master Plan Update

The Zoning, Planning and Development Committee will meet to accept the 2023 Master Plan Update. This document was developed by City Planner Jay Vinskey, the Master Plan Committee, and several consulting firms.

planningzoningmaster-plan
Mon Apr 1, 2024

School Committee

Westfield School Committee meets April 1 to review policies and school year updates

The committee will consider a revised 2024-2025 school calendar and School Choice openings for all grade levels. Members will also review several school policies and a memorandum of agreement with the Westfield Education Association Unit B.

educationschool-calendarpolicybudgetemployment
Mon Apr 1, 2024

School Committee

School Committee to hold executive session on collective bargaining

The Westfield School Committee will meet in an executive session to discuss strategy regarding collective bargaining and litigation. The committee will not reconvene in open session following these discussions.

school-committeecollective-bargaininglabor-relationsexecutive-session
Mon Apr 1, 2024

Council On Aging

Westfield Council on Aging to discuss strategic plan and emergency protocols

The Council on Aging will review goals for its strategic plan and discuss the Learning Center reconfiguration. The board will also receive a quarterly stats report and review emergency response protocols for falls.

seniorsstrategic-planningpublic-safetyfacility-management
Thu Mar 28, 2024

Hampden Charter School of Science

Hampden Charter School of Science to review 2024-25 budget

The board will discuss the 2024-25 budget. The meeting also includes a CEO monthly report covering enrollment, academics, personnel, building, and parent relations updates.

educationbudgetcharter-school
Thu Mar 28, 2024

Hampden Charter School of Science

Hampden Charter School of Science Finance Sub-Committee to discuss 2024-25 budget

The Finance Sub-Committee is meeting to discuss the HCSS Budget for 2024-25. The session includes a period for public comment.

budgeteducationcharter-school
Wed Mar 27, 2024

City Council Natural Resources Committee

Natural Resources Committee to discuss water and sewer ordinances

The Natural Resources Committee will hold a meeting to continue discussions on several old business items. The body is reviewing zoning and regulations related to water and sewer systems.

watersewerzoningconservation
Tue Mar 26, 2024

Conservation Commission

Conservation Commission to review wetland permits and enforcement orders

The Conservation Commission will hold public hearings on three project proposals and review a request to remove a barn. The body will also address five enforcement orders regarding soil disturbance and dumping in protected areas.

wetlandsenvironmentzoningpublic-hearingsenforcement
Tue Mar 26, 2024

City Council Personnel Action Committee

Personnel Action Committee to review Parks and Recreation Commission appointment

The Personnel Action Committee is meeting to consider the appointment of a new member to the Parks and Recreation Commission. This appointment is intended to fill a vacancy for Ward 5.

appointmentsparks-and-recreationcity-council
Mon Mar 25, 2024

School Committee

School Committee to vote on Student Opportunity Act and teacher agreements

The Westfield School Committee will meet to vote on the Student Opportunity Act and a Memorandum of Agreement with the Westfield Education Association. The body will also review several school policies and approve a special education transportation contract.

educationcontractsstudent-opportunity-actspecial-educationschool-policy
Mon Mar 25, 2024

School Committee

School Committee to hold executive session on collective bargaining

The Westfield School Committee will meet in executive session to discuss strategy regarding collective bargaining and litigation. The meeting includes discussions concerning the Westfield Education Association Unit A and Unit D, as well as negotiations with the School Business Administrator.

collective-bargaininglabor-relationsschool-committeepersonnel
Mon Mar 25, 2024

Parks and Recreation Commission

Parks and Recreation Commission discusses playground expansions and pay increases

The commission is reviewing requests for park permits and equipment additions for pickleball courts. Members are discussing the potential acquisition and expansion of recreational land at Cross Street Playground and 146 Main St. The body is also considering hourly pay increases for seasonal staff.

parksrecreationpickleballland-acquisitionseasonal-staff
Mon Mar 25, 2024

Historical Commission

Westfield Historical Commission to discuss schoolhouse and mansion updates

The Historical Commission is meeting to review updates on the Wyben Schoolhouse and Atwater Mansion. The body will also discuss historic house plaques and scheduled walking tours.

historic-preservationlandmarkscommunity-events
Thu Mar 21, 2024

Retirement Board

Westfield Retirement Board to review investments and retirement applications

The Retirement Board will conduct a monthly performance review of investments and process retirement and disability applications. The board will also discuss a COLA notice to the City Council and board election updates.

retirementinvestmentspensionsbenefits
Thu Mar 21, 2024

City Council

City Council considers $11.1 million bond for athletic field improvements

The City Council will review several funding requests, including a large bond for athletic fields and a $500,000 MassDOT grant for street projects. The body will also consider a special permit for a truck terminal and a resolution to create a Downtown Westfield Cultural District.

budgetinfrastructurezoninggrantspublic-works
Thu Mar 21, 2024

City Council Water & DPW Committee (Ad-Hoc)

Westfield City Council Water & DPW Committee meeting scheduled for March 21

The meeting agenda consists of procedural boilerplate. The committee will review minutes from February 5 and March 4, 2024.

proceduralwaterdpw
Thu Mar 21, 2024

Westfield Airport Commission

Westfield Airport Commission to review FY2025 budget and infrastructure updates

The Westfield Airport Commission is meeting to receive updates on the FY2025 Airport Department Budget and several infrastructure projects. The body will also discuss airport rates, charges, and fuel services.

airportbudgetinfrastructureaviation
Wed Mar 20, 2024

Traffic Commission

Westfield Traffic Commission discusses road signage and traffic controls

The Commission is reviewing several ongoing traffic projects and addressing new business items. Discussions include updates on speed studies, parking restrictions, and proposed stop signs or crosswalks.

trafficroad-safetyparkingsignage
Wed Mar 20, 2024

Off-Street Parking Commission

Commission to vote on event use of Elm Street Plaza and Central Street lots

The Off-Street Parking Commission will discuss and potentially vote on requests to use city parking areas for community events. The body will also receive updates on summer maintenance and food trucks.

parkingpublic-eventscity-managementwestfield
Tue Mar 19, 2024

City Council Finance Committee

Finance Committee considers $500,000 grant for Broad and East Silver Street projects

The City Council Finance Committee is reviewing several fund appropriations and transfers for public works, police, and technology. The body is also seeking legal guidance on the process for ratifying city contracts.

budgetgrantspublic-workspoliceinfrastructurecontracts
Tue Mar 19, 2024

Planning Board

Planning Board to hear proposals for residential conversions and new condos

The Planning Board will hold public hearings on two residential development projects. The board will also review street acceptance petitions and a potential zoning amendment regarding municipal signs.

zoninghousingpublic-hearingsroadsspecial-permits
Tue Mar 19, 2024

Board of Health

Board of Health to discuss Health Director position

The Board of Health is holding a special meeting to discuss the position of Health Director. The board may deliberate and vote on the job description and the posting of the position.

health-departmentpersonnelhiring
Tue Mar 19, 2024

Commission for Citizens with Disabilities

Commission for Citizens with Disabilities to meet March 19

The Commission for Citizens with Disabilities will meet to review account updates and discuss commission outreach materials. The body will also address old business regarding zines.

disability-servicespublic-outreachcity-administration
Tue Mar 19, 2024

Municipal Light Board

The Municipal Light Board will discuss the General Manager bonus structure

The Municipal Light Board is holding a special meeting to discuss the General Manager bonus structure and vote on releasing minutes from prior executive sessions. The board also plans to enter an executive session to discuss litigation strategy regarding an open meeting law complaint.

utilitiespersonnellitigationgovernment
Mon Mar 18, 2024

Police Commission

Police Commission to interview candidates for Sergeant position

The Westfield Police Commission will hold a special meeting to interview four candidates for a Sergeant position. The commission will also announce an appointment to a Lieutenant position.

policepersonnelappointments
Mon Mar 18, 2024

City Council Legislative and Ordinance Committee

Committee considers $17,000 appropriation for airport eminent domain

The Legislative and Ordinance Committee will discuss real estate acquisition for the Westfield-Barnes Regional Airport and the creation of a Downtown Westfield Cultural District. The body will also review proposed changes to marijuana and public works ordinances.

airporteminent-domaincultural-districtmarijuana-ordinancepublic-worksstreet-acceptance
Fri Mar 15, 2024

Police Commission

Police Commission to interview candidate for Sergeant position

The Westfield Police Commission is holding a special meeting to conduct an interview for a Sergeant position. The commission will interview candidate Jason Perron.

policepersonnelhiring
Thu Mar 14, 2024

Community Preservation Committee

Vote to release grant funds for Old Town Hall Veterans Housing project

The Westfield Community Preservation Committee will vote on the release of 100% of grant funds for the Old Town Hall Veterans Housing project. This item concerns releasing funds prior to the recording of required deed restrictions as per the agreement with Domus, Inc.

housinggrantsveteranswestfield
Wed Mar 13, 2024

City Council Natural Resources Committee

Natural Resources Committee to schedule meetings on zoning and conservation

The committee will discuss document archive options and schedule working meeting dates for specific topics. These topics include the Conservation Plan, BAPAC, and the Water Resources Protection District Zoning Ordinance.

zoningconservationwater-resourcesnatural-resources
Wed Mar 13, 2024

Board of Health

Board of Health to discuss Health Director position and Honeyland Farms hearing

The Board of Health will discuss the job description, posting, and screening process for the Health Director position. The meeting includes a fine hearing for Honeyland Farms and a review of anti-choking regulations.

public-healthpersonnelinspectionswaste-management
Wed Mar 13, 2024

Westfield Housing Authority

Westfield Housing Authority to hold special meeting on March 13

The Westfield Housing Authority will meet to discuss budget revisions and capital project updates. The body will also review bill payments and tenant write-offs.

housingbudgetpublic-housingwestfield
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
to approve HUD Annual Plan for fiscal year *24-’25. Unanimous vote 4 to 0. Ayes: Murphy, Mulligan, Murray, Carmichael. ADJOURNMENT Upon the motion of Commissioner Mulligan and seconded by…
3 yea
Murphy yea · Mulligan yea · Murray yea
Wed Mar 13, 2024

Board of Assessors

Board of Assessors to review 3ABC applications and abatement reports

The Board of Assessors will meet to approve February monthly abatement and commitment reports. The board will also consider 3ABC applications for specific properties and hold an executive session to discuss abatement and exemption applications.

assessorsproperty-taxabatementszoning
Tue Mar 12, 2024

Board of Public Works

Board of Public Works to consider banner placement and new public roadway

The Board of Public Works will hold a public hearing regarding the placement of Westfield Starfires banners. Members will also vote on the acceptance of Breighly Way as a public roadway and a change to authorized account signees.

public-worksroadspublic-hearingadministration
Tue Mar 12, 2024

School Committee Subcommittee

School Committee Subcommittee to review 12 personnel and district policies

The Human Resources & Policy Subcommittee will meet to discuss various school committee policies. The agenda focuses on updating guidelines regarding technology, student conduct, and nutrition services.

school-policystudent-conducttechnologyschool-mealseducation
Tue Mar 12, 2024

Conservation Commission

Conservation Commission to review wetland permits and enforcement orders

The Conservation Commission will hold public hearings on home construction and vegetation management. The body will also address five enforcement orders regarding illegal dumping and soil disturbance in protected areas.

wetlandsenvironmentzoningpublic-hearingsenforcement
Tue Mar 12, 2024

City Council Personnel Action Committee

Personnel Action Committee to review City Engineer job description

The Personnel Action Committee is meeting to discuss a change to the job description for the City Engineer.

personnelcity-engineerjob-description
Mon Mar 11, 2024

Parks and Recreation Commission

Westfield Parks and Recreation Commission meeting canceled

The meeting scheduled for March 11 was canceled because there were not enough board members. The next meeting is scheduled for March 25.

parks-and-recreationmeeting-cancellation
Mon Mar 11, 2024

Police Commission

Police Commission to interview candidates for Captain and Lieutenant positions

The Police Commission will conduct interviews for one Captain position and one Lieutenant position. The body will also consider the appointment of Paul Beebe as a Traffic Control officer.

policepersonnelappointmentspublic-safety
Mon Mar 11, 2024

Council On Aging

Westfield Council on Aging to discuss FY25 nutrition program vision

The Council on Aging is meeting to review the FY25 Nutrition Program vision, including partnerships and expansion. The board will also discuss the strategic plan and updates to the vision and mission statement.

seniorsnutrition-programstrategic-planningcity-administration
Mon Mar 11, 2024

License Commission

License Commission to hold hearing on new alcohol license for Xtra Credit

The License Commission will review several liquor and entertainment license applications, including a public hearing for a new all-alcoholic beverages license. The body will also vote on the 2024 seasonal population increase and review various auto dealer licenses.

liquor-licensesentertainment-licensesauto-dealerspublic-hearingsbusiness-permits
Fri Mar 8, 2024

Health Plan Trust

Health Plan Trust to discuss FY 25 health insurance renewal

The Health Plan Trust is meeting to review the trust balance and receive an update from HNE. The body will also discuss the health insurance renewal for active and early retirees for fiscal year 2025.

health-insuranceretireesbenefitsbudget
Thu Mar 7, 2024

School Committee

School Committee to consider rescinding closure of Fort Meadow School

The School Committee will hold a special meeting to discuss and potentially vote on whether to reverse a previous decision to close Fort Meadow School. If the vote to rescind passes, the school would not close on June 30, 2024.

school-closurefort-meadow-schooleducation
Thu Mar 7, 2024

City Council

City Council considers $500,000 grant for Broad Street and East Silver Street projects

The City Council will vote on several grant acceptances, budget appropriations from free cash, and the creation of the Downtown Westfield Cultural District. The body will also review zoning amendments and the 2023 Master Plan Update.

grantsbudgetzoninginfrastructurecultural-districtpublic-safety
Thu Mar 7, 2024

City Council Zoning, Planning and Development Committee

Committee to review zoning amendment and 2023 Master Plan Update

The Zoning, Planning and Development Committee will consider a petition to change how non-residential lots access vehicles. The body will also review the 2023 Master Plan Update developed by City Planner Jay Vinskey and various consultants.

zoningplanningmaster-planland-use
Wed Mar 6, 2024

Emergency Planning Committee

Westfield Emergency Planning Committee to elect officers and discuss event processes

The Local Emergency Planning Committee will elect a Chair, Vice Chair, and Secretary/treasurer. Members will discuss grant funds for the LEPC and the creation of a standardized process for city events.

emergency-planningpublic-safetycity-eventsgrants
Wed Mar 6, 2024

Municipal Light Board

Municipal Light Board to review annual utility reports and gas rate updates

The board will review several 2023 annual reports, including data on outages, street lighting, and safety. Members will also receive verbal updates regarding natural gas rates and energy supply.

utilitygaselectricityenergypublic-safetybudget
Wed Mar 6, 2024

Zoning Board of Appeals

Zoning Board to hear special permit requests for Broad St. and George St.

The Westfield Zoning Board of Appeals will hold public hearings to consider special permits for two properties. The board will decide if these projects may proceed despite non-conforming setbacks and coverage.

zoningpublic-hearingsspecial-permitssetbacks
Mon Mar 4, 2024

School Committee

School Committee to select name for new elementary school opening January 2025

The Westfield School Committee will meet to name a new elementary school and approve a Memorandum of Agreement with the Westfield Education Association Unit A. The body will also discuss a parking lot redesign for Westfield Middle School and review school climate survey results.

elementary-schoollabor-agreementschool-facilitiesbudgeteducation
Mon Mar 4, 2024

School Committee Subcommittee

School Committee Subcommittee to discuss MSBA Statement of Interest

The Facilities/Capital Planning Subcommittee will meet to discuss school building interests and specific sites. The agenda includes items regarding the Massachusetts School Building Authority and St. Casimir Church/Parkside Academy.

schoolscapital-planningfacilities
Mon Mar 4, 2024

City Council Water & DPW Committee (Ad-Hoc)

Committee to discuss revisions to DPW ordinance and City Charter

The Water and DPW Ad-Hoc Committee will meet to discuss and potentially vote on recommendations for the full Council. The focus is on revisions to City Ordinance Chapter 18 and City Charter Section 9.

dpwcity-charterordinancegovernment-administration
Mon Mar 4, 2024

School Committee

School Committee to discuss strategy regarding Westfield Custodian Association

The Westfield School Committee will hold an executive session to discuss collective bargaining or litigation strategy. The committee will also review minutes from the February 5, 2024, executive session.

collective-bargaininglabor-relationsschool-committee
Thu Feb 29, 2024

School Committee Subcommittee

School Committee Subcommittee to review and rescind district policies

The Human Resources & Policy Subcommittee is meeting to discuss six school committee policies and the rescinding of two other policies. These items relate to digital use, food services, and student admissions.

school-policydigital-resourcesfood-servicesstudent-admissions
Wed Feb 28, 2024

Youth Commission

Westfield Youth Commission to discuss school policies and maintenance

The Youth Commission will meet to review the status of its members and current projects. The body is discussing cell phone policies, student exchange policies, and bathroom maintenance.

youthschool-policymaintenancewestfield
Wed Feb 28, 2024

Franklin Avenue Project School Building Committee Meeting

School Building Committee to review Franklin Avenue Project updates

The School Building Committee will receive updates from the Owner Project Manager and the Architect regarding the Franklin Avenue Project. The committee may vote on change orders as needed.

schoolsconstructionfranklin-avenue-project
Tue Feb 27, 2024

Conservation Commission

Conservation Commission to hold hearings on wetland and riverfront projects

The Conservation Commission will hold public hearings for four development and restoration proposals. The body will also review requests for certificates of compliance and address eight enforcement orders regarding permit violations and wetland disturbances.

wetlandszoningenvironmentpublic-hearingsordinances
Mon Feb 26, 2024

City Council Personnel Action Committee

Personnel Action Committee to review four board and commission appointments

The City Council Personnel Action Committee is meeting to submit appointments and reappointments for several city boards. These actions determine who will serve on the Board of Health, Parks and Recreation Commission, Conservation Commission, and Traffic Commission.

appointmentsboard-of-healthparks-and-recreationconservation-commissiontraffic-commission
Mon Feb 26, 2024

Historical Commission

Westfield Historical Commission to review Ghost Tour and Wyben Schoolhouse

The Historical Commission is meeting to evaluate a recent Ghost Tour presentation and review builder quotes for the Wyben Schoolhouse. The board will also discuss historic home plaques and the WHC Master Plan.

historic-preservationtourismcity-planning
Thu Feb 22, 2024

Retirement Board

Westfield Retirement Board to analyze Private Equity RFP submissions

The Retirement Board will review monthly investment performance and analyze submissions for a Private Equity Request for Proposals (RFP). The body will also process retirement and disability applications and review dependent allowance overpayments.

retirementinvestmentspensionsfinance
Tue Feb 20, 2024

Planning Board

Planning Board to consider office-to-residential conversion at 70 Court St.

The Planning Board will hold public hearings regarding a special permit for a residential conversion and a zoning ordinance amendment for vehicular access. The board will also review plans for 1237 Russell Rd. and discuss non-residential district zoning updates.

zoningresidential-conversionland-usepublic-hearingroads
Tue Feb 20, 2024

Planning Board

Planning Board to consider zoning amendment for non-residential lot access

The Planning Board will hold a public hearing to consider a petition from Devcon Shops, LLC. The proposal seeks to amend zoning ordinance 4-40.2 to allow vehicular access to non-residential lots via special permit rather than only across their frontage.

zoningpublic-hearingland-useplanning
Tue Feb 20, 2024

Westfield Cultural Council

Westfield Cultural Council to discuss April reception

The Westfield Cultural Council will meet to review minutes and the treasurer's report. The body will also discuss plans for a reception in April.

arts-and-culturecommunity-eventswestfield
Tue Feb 20, 2024

Commission for Citizens with Disabilities

Commission for Citizens with Disabilities to set 2024 goals

The Commission for Citizens with Disabilities will meet to discuss goals for 2024 and review website links and pamphlets. The body will also review attendance from a January 25th training session.

disability-servicesgovernment-administrationpublic-information
Thu Feb 15, 2024

City Council

City Council considers $8.8 million grant for Westfield-Barnes Regional Airport

The City Council will review several grant acceptances and fund appropriations, including airport infrastructure and veterans housing. The body will also hold a public hearing on a zoning ordinance amendment and vote on a zone map change for properties on Woodcliff Drive and Union Street.

airportzoninggrantshousinginfrastructurebudget
Thu Feb 15, 2024

City Council

City Council to hold public hearing on zoning amendment for vehicular access

The City Council is holding a public hearing to consider a petition from Devcon Shops, LLC. The proposal seeks to amend zoning ordinance 4-40.2 to allow vehicular access to non-residential lots via special permit rather than only across their frontage.

zoningpublic-hearingland-use
Wed Feb 14, 2024

Board of Assessors

Westfield Board of Assessors meeting scheduled for February 14, 2024

The Board will review January monthly abatement and commitment reports. The meeting includes an executive session to discuss possible votes on abatement and exemption applications.

taxationgovernment-administrationassessments
Wed Feb 14, 2024

Board of Health

Board of Health to appoint Acting Health Director

The Board of Health will meet to appoint an Acting Health Director and conduct a fine hearing for MZY Corporation. The board will also review nicotine sales violations and anti-choking regulation devices.

public-healthpersonneltobacco-regulationinspections
Wed Feb 14, 2024

Westfield Housing Authority

Westfield Housing Authority to review quarterly statements and budgets

The Westfield Housing Authority will meet to discuss quarterly operating statements ending December 31, 2023, and bill payments. The body will also review budgets and modernization updates.

housingbudgetpublic-housinggovernment-administration
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] Ix ADJOURNMENT Upon the motion of Commissioner Mulligan and seconded by Commissioner Murray it was VOTED: to adjourn at 9:29 am
3 yea
Murphy yea · Mulligan yea · Murray yea
Tue Feb 13, 2024

City Council Finance Committee

Finance Committee considers $2.1 million for Powdermill Brook Dam match

The City Council Finance Committee is reviewing several fund appropriations and transfers. The body is also seeking legal guidance on the process for ratifying city contracts.

budgetappropriationsinfrastructurehousingpublic-safety
Tue Feb 13, 2024

Conservation Commission

Westfield Conservation Commission meeting cancelled

The Conservation Commission meeting scheduled for February 13, 2024, was cancelled due to weather. The next meeting is scheduled for February 27, 2024.

conservation-commissionmeeting-cancellation
Mon Feb 12, 2024

License Commission

Westfield License Commission meeting cancelled

The regularly scheduled meeting for February 12, 2024, has been cancelled. The next meeting is scheduled for March 11, 2024.

licensingwestfield
Mon Feb 12, 2024

Westfield Technical Academy

Westfield Technical Academy Advisory meeting to review shop equipment and co-ops

The committee is meeting to discuss the status of shop equipment and co-op surveys. The agenda includes updates on specific facility retrofits and trainer equipment. No new business was listed for this session.

educationvocational-trainingfacilitiesequipment
Mon Feb 12, 2024

Police Commission

Police Commission to interview patrolman candidates and appoint traffic personnel

The Police Commission will meet to interview five candidates for full-time Patrolman positions. The body will also consider the appointment of three individuals as Traffic Control personnel.

policehiringpersonneltraffic-control
Mon Feb 12, 2024

Council On Aging

Westfield Council On Aging to discuss strategic plan and elder services

The Council On Aging will review the strategic plan, specifically Goal #1 and the director's goals. The board will also discuss Highland Valley Elder Services and the lunch registration process.

seniorsstrategic-planningelder-servicespublic-health
Mon Feb 12, 2024

Board of Registars

Board of Registrars to discuss 2024 early voting location and stamps

The Board of Registrars is meeting to determine the early voting location for all 2024 elections. The board will also consider the authorization to use Board of Registrar stamps for 2024.

electionsvotingadministration
Mon Feb 12, 2024

Parks and Recreation Commission

Parks and Recreation Commission to elect officers and review park requests

The commission will hold its annual election for chairman, pro-temper, and secretary. Members will discuss requests for a new youth baseball field and a flag incinerator, as well as event permits for the Westfield Puerto Rican Assoc. and Westfield Watershed Association.

parks-and-recreationpermitselectionscommunity-facilities
Thu Feb 8, 2024

Pioneer Valley Planning Commission

PVPC to review FY2025 draft budget and local assessment rates

The Pioneer Valley Planning Commission is meeting to introduce the Fiscal Year 2025 draft budget and certify local assessments. The commission will also receive a presentation on the Affordable Homes Act.

budgethousinglocal-assessmentsplanning
Thu Feb 8, 2024

Westfield Airport Commission

Westfield Airport Commission to review FY2025 budget

The Commission will review the FY2025 Airport Budget and consider a vote on a MassDOT ASMP Taxiway B5 Engineering Grant amendment. The body will also discuss a feasibility study for a new hangar and updates to airport signage and fueling facilities.

airportbudgetgrantsinfrastructureaviation
Wed Feb 7, 2024

Parks and Recreation Commission

Parks and Recreation Commission to discuss flag cremation incinerator

The commission is holding an informational meeting to discuss a request for a flag cremation incinerator at Parker Memorial Park. The device would be used to cremate old and retired flags.

parks-and-recreationparker-memorial-parkpublic-facilities
Wed Feb 7, 2024

Zoning Board of Appeals

Zoning Board to consider residential conversion at 70 Court St.

The Westfield Zoning Board of Appeals will hold public hearings to review two special permit applications. The board will also conduct its annual election of the Chair.

zoningspecial-permitshousingresidential-conversion
Wed Feb 7, 2024

Municipal Light Board

Municipal Light Board meeting on February 7, 2024

The Municipal Light Board will review several annual reports regarding gas and electric services from 2023. The board also intends to discuss the Ward 5 Commissioner vacancy and the General Manager bonus structure.

utilitiesgovernment-administrationenergypublic-safety
Tue Feb 6, 2024

Planning Board

Planning Board reviews large-scale industrial and educational projects

The Planning Board will hold public hearings on three major development applications. The board will also review site plan modifications and an accessory apartment permit.

zoningindustrial-developmentpublic-hearingssite-planshousing
Tue Feb 6, 2024

Westfield Redevelopment Authority

Westfield Redevelopment Authority holds annual meeting

The Westfield Redevelopment Authority is meeting to conduct annual business. The body will review activity reports, a financial report, and elect its officers.

administrationelectionsfinanceredevelopment
Tue Feb 6, 2024

Westfield Redevelopment Authority

Westfield Redevelopment Authority to discuss Elm Street Plaza naming and permits

The Westfield Redevelopment Authority will meet to review the Elm Street Plaza project. The body will discuss the naming of the plaza and the permitting authority for events held at the site.

redevelopmentelm-street-plazapermitscity-planning
Mon Feb 5, 2024

City Council Water & DPW Committee (Ad-Hoc)

Committee to discuss revisions to DPW ordinance and City Charter

The Water and DPW Ad-Hoc committee will meet to discuss and potentially vote on recommendations for the full Council. The focus is on revisions to City Ordinance Chapter 18 and City Charter Section 9.

dpwcity-charterordinancegovernment-structure
Mon Feb 5, 2024

School Committee

School Committee to name new elementary school and approve future calendars

The Westfield School Committee will select a name for a new elementary school opening in January 2025. The body will also vote on the school calendars for the 2024-2025 and 2025-2026 school years.

educationschool-calendarelementary-schoolgrantspersonnel
Mon Feb 5, 2024

School Committee

School Committee to discuss collective bargaining strategy

The Westfield School Committee will hold an executive session to approve previous meeting minutes and discuss strategy regarding the Westfield Education Association Unit A (teachers). The committee will not reconvene in open session.

collective-bargainingteachersexecutive-sessionschool-committee
Thu Feb 1, 2024

City Council

City Council to consider $2.1 million appropriation for Powdermill Brook Dam

The City Council is reviewing several funding requests, including appropriations for dam rehabilitation, veterans housing, and airport improvements. The body will also vote on numerous board appointments and a zone change petition for Union Street.

budgetzoninginfrastructurehousingairportpublic-safety
Thu Feb 1, 2024

City Council Governmental Relations Committee

Committee to discuss timing of compensation changes for city officials

The City Council Governmental Relations Committee is meeting to discuss compensation for the mayor, city council, school committee, and compensated boards and commissions. The discussion focuses on applying these compensation changes to future terms and budget years.

compensationcity-councilbudgetgovernment-administration
Wed Jan 31, 2024

City Council Legislative and Ordinance Committee

Committee considers $915 gift for skate park improvements

The Legislative and Ordinance Committee is meeting to review a resolution regarding a donation to the city. The body will discuss the acceptance of funds for the Department of Public Works.

donationsparks-and-recreationpublic-works
Tue Jan 30, 2024

City Council Finance Committee

Finance Committee to review over $1.3 million in appropriations and transfers

The City Council Finance Committee is meeting to discuss several fund appropriations from Free Cash and internal account transfers. These items cover equipment for the Fire Department, airport projects, police medical costs, and technology upgrades.

budgetfire-departmentpoliceairportpublic-workstechnology
Tue Jan 30, 2024

City Council Personnel Action Committee

Personnel Action Committee to review city board and commission appointments

The committee is meeting to submit various new appointments and reappointments for city boards and commissions. These actions include filling vacancies and renewing terms for members of local oversight bodies.

appointmentscity-governmentboards-and-commissions
Tue Jan 30, 2024

City Council Zoning, Planning and Development Committee

Committee to review zone change petition for Union Street and Woodcliff Drive

The Zoning, Planning and Development Committee will meet to discuss a petition to change the zoning designation of two properties. The proposal seeks to move the parcels from residential classifications to Business B.

zoningland-useunion-streetwoodcliff-drive
Thu Jan 25, 2024

Community Development

Public hearings on 2024 federal community development funding

The Office of Community Development and Planning is holding two public hearings to discuss priorities for HUD funds. The city will use this input to make funding decisions for the Community Development Block Grant (CDBG) program.

budgetfederal-fundinghousingcommunity-development
Wed Jan 24, 2024

Youth Commission

Westfield Youth Commission to meet January 24

The Youth Commission will meet to conduct business and hear public participation. The agenda consists of procedural boilerplate items.

youthwestfieldcommission
Tue Jan 23, 2024

City Council

City Council considers cybersecurity funding and various board appointments

The City Council will review several appropriation requests from the Mayor, including funds for cybersecurity and opioid settlement purposes. The body is also considering a large number of appointments and reappointments to city commissions and boards. Additionally, the council will hear a zoning petition regarding vehicular access for non-residential lots.

cybersecuritybudgetzoningappointmentspublic-safety
Tue Jan 23, 2024

Conservation Commission

Conservation Commission to review wetland violations and riverfront restoration

The Conservation Commission will hold public hearings on riverfront restoration and site development. The body will also address five enforcement orders regarding unauthorized wetland disturbances and review requests for certificates of compliance.

wetlandsenvironmentzoningpublic-hearingsenforcement
Mon Jan 22, 2024

Historical Commission

Westfield Historical Commission to finalize Ghost Tour and elect 2024 officers

The Historical Commission is meeting to discuss upcoming events and administrative updates. The body will finalize details for February tours and elect its officers for 2024.

historic-preservationtourismlocal-governmentcommunity-events
Mon Jan 22, 2024

Board of Health

Board of Health to hold hearings on smoke shop fines and septic variances

The Board of Health will review nicotine sales violations and food protection variances. The meeting includes a public hearing for a septic plan variance at 1430 Russell Rd and a discussion on mattress sticker sales at the transfer station.

public-healthzoningnicotine-saleswaste-managementfood-safety
Thu Jan 18, 2024

Retirement Board

Westfield Retirement Board meeting scheduled for January 18, 2024

The board will conduct a monthly performance review of investments and consider investment recommendations. The agenda also includes the approval of bills, warrants, retirement applications, and disability applications.

retirementinvestmentsgovernment-financewestfield
Thu Jan 18, 2024

Community Preservation Committee

Committee reviews housing and historic preservation funding applications

The Community Preservation Committee will review current funds and new applications for several projects. The meeting also includes the annual election of the Chair and Vice Chair.

housinghistoric-preservationopen-spacebudgetwestfield
Thu Jan 18, 2024

City Council

Westfield City Council meeting rescheduled to January 23

The City Council meeting originally scheduled for Thursday, January 18, 2024, has been moved to Tuesday, January 23, 2024. This document serves as a notice of the date change.

proceduralcity-council
Wed Jan 17, 2024

Off-Street Parking Commission

Commission to discuss regulations for Elm Street Plaza Lot and Stage

The Off-Street Parking Commission will receive updates on the Elm Street Plaza and lot construction. Members may vote to establish regulations for the permitting and usage of the Elm Street Plaza Lot and Stage.

parkingelm-street-plazapermittingpublic-space
Wed Jan 17, 2024

City Council Legislative and Ordinance Committee

Council considers agreement to provide Veteran Services to Montgomery

The Legislative and Ordinance Committee is meeting to discuss a resolution regarding an intermunicipal agreement. This agreement would allow the Mayor to provide Veteran Services to the town of Montgomery.

veterans-servicesintermunicipal-agreementmontgomery
Tue Jan 16, 2024

Westfield Technical Academy

Westfield Technical Academy Allied Health Advisory Board meeting

The Allied Health Advisory Board will meet to discuss program updates and industry information. The agenda includes reviewing freshman enrollment numbers, new clinical facilities, and vaccine updates.

educationhealthcareworkforce-developmentwestfield
Tue Jan 16, 2024

Westfield Technical Academy

Construction Technology Program Advisory Meeting cancelled

The Joint Carpentry and Cabinetmaking meeting scheduled for January 16, 2024, was postponed. The cancellation was due to inclement weather and school closures.

educationconstruction-technologymeeting-cancellation
Tue Jan 16, 2024

Planning Board

Planning Board to review warehouse and religious building projects

The Planning Board will hold public hearings on site plans and permits for a warehouse facility and a religious/educational building. The board will also review plans for 218 Belanger Dr. and conduct its annual election of officers.

zoningsite-planwarehousingpublic-hearingsland-use
Tue Jan 16, 2024

School Committee

School Committee and Technical Academy General Advisory Committee hold joint meeting

The Westfield School Committee and Westfield Technical Academy General Advisory Committee are meeting to review school updates and tour CTE programs. The body will consider the approval of a student trip to Collins Aerospace.

educationvocational-trainingschool-trip
Tue Jan 16, 2024

Westfield Cultural Council

Westfield Cultural Council meeting cancelled

The meeting scheduled for January 16, 2024, has been cancelled. The next meeting is scheduled for February 20, 2024.

proceduralcancellation
Tue Jan 16, 2024

Commission for Citizens with Disabilities

Commission for Citizens with Disabilities to elect 2024 officers

The Commission for Citizens with Disabilities will meet to elect its 2024 officers and establish goals for the year. The body will also review an account update for fines and forfeits and a printing invoice for brochures.

disability-servicesgovernment-administrationappointments
Tue Jan 16, 2024

Westfield Technical Academy

Joint meeting of Westfield School Committee and WTA General Advisory Council

The Westfield School Committee and Westfield Technical Academy General Advisory Committee are meeting to review school updates and tour CTE programs. The body will consider the approval of a student trip to Collins Aerospace.

educationvocational-trainingschool-committee
Tue Jan 16, 2024

Westfield Technical Academy

Westfield Technical Academy IT Shop Program Advisory Committee meeting cancelled

The January 16, 2024, meeting of the IT Shop Program Advisory Committee was cancelled due to inclement weather. The committee is scheduled to meet next on March 27, 2024.

educationmeeting-cancellation
Tue Jan 16, 2024

Westfield Technical Academy

Culinary Arts Program Advisory Committee discusses pricing and equipment

The Culinary Arts Program Advisory Committee is meeting to discuss program operations and student competitions. The body will review price increases for catering events and the Tiger’s Pride restaurant.

educationculinary-artsvocational-trainingwestfield-technical-academy
Thu Jan 11, 2024

Community Preservation Committee

Committee reviews housing and historic preservation funding applications

The Community Preservation Committee will review current funds and pending applications for two projects. The committee will also discuss potential future projects and conduct annual elections for Chair and Vice Chair.

housinghistoric-preservationbudgetcommunity-funds
Thu Jan 11, 2024

Board of Assessors

Board of Assessors to review tax liens on North Rd

The Board of Assessors will meet to approve monthly abatement and commitment reports. The board will also consider the approval of 61A tax liens for specific parcels on North Rd. An executive session is scheduled to discuss abatement and exemption applications.

taxesproperty-assessmenttax-liensabatements
Thu Jan 11, 2024

Hampden Charter School of Science

Hampden Charter School of Science to review East Draft Renewal Report

The board will meet to receive a CEO monthly report on school operations and personnel. The meeting includes a review of the HCSS East Draft Renewal Report.

educationcharter-schoolschool-administration
Thu Jan 11, 2024

Westfield Airport Commission

Westfield Airport Commission to review signage and budget updates

The Westfield Airport Commission will meet to discuss the FY2024 budget and the City of Westfield Sign Ordinance. The body will also receive updates on airport marketing, snow removal, and the Westfield Aviation Museum.

airportbudgetsignageaviation-museumnoise-control
Wed Jan 10, 2024

Westfield Housing Authority

Westfield Housing Authority to discuss Annual Plan and Budget Revision

The Westfield Housing Authority will meet to review committee reports and bill payments. The body will discuss the Annual Plan, budget revisions, and the Capital Improvement Plan. The meeting also includes updates on modernization and personnel.

housingbudgetcapital-improvementspublic-housing
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
To approve Annual Plan for the Fiscal Year 2024/25 and submit to EOHLC for approval. Unanimous vote 4 to 0. Ayes: Murphy, Mulligan, Murray, Carmichael. 5. Meeting Date — Upon the motion of…
3 yea
Murphy yea · Mulligan yea · Murray yea
Wed Jan 10, 2024

Board of Health

Westfield Board of Health meeting cancelled

The Board of Health meeting scheduled for January 10, 2024, has been cancelled. The next meeting is scheduled for January 22, 2024.

public-healthmeeting-cancellation
Tue Jan 9, 2024

Police Commission

Police Commission to approve 2024 lists for special officers and traffic control

The Westfield Police Commission will meet to approve the 2024 lists of Special Police Officers and Traffic Control Members. The commission will also discuss the effective date for Captain Hall and the scheduling of interviews for Sergeant and Lieutenant appointments.

policepersonnelpublic-safetyappointments
Tue Jan 9, 2024

Board of Public Works

Board of Public Works to vote on accepting Breighly Way as a public roadway

The Board of Public Works will meet to discuss and vote on the acceptance of Breighly Way as a public road. The meeting also includes reports from the Department of Public Works and the City Engineering Department.

roadsinfrastructurepublic-works
Tue Jan 9, 2024

Franklin Avenue Project School Building Committee Meeting

School Building Committee to vote on playground equipment colors

The School Building Committee is meeting to receive updates from the Owner Project Manager and the Architect regarding the Franklin Avenue Project. The committee will also vote on the color selection for playground equipment.

schoolsfranklin-avenue-projectplayground
Tue Jan 9, 2024

Conservation Commission

Conservation Commission meeting for January 9, 2024, cancelled

The Conservation Commission meeting scheduled for January 9, 2024, has been cancelled. The next meeting is scheduled for January 23, 2024.

conservation-commissionmeeting-cancellation
Mon Jan 8, 2024

Parks and Recreation Commission

Parks and Recreation Commission to discuss skatepark funding and park permits

The commission is meeting to vote on establishing a skatepark gift account and accepting a $915.00 donation. Members will also discuss seasonal painting permits for Park Square and follow up on various park projects and budget goals.

parksrecreationbudgetskateparkpermits
Mon Jan 8, 2024

School Committee

Westfield School Committee to elect officers and assign subcommittees

The School Committee will meet to elect a Vice Chair and Secretary and announce subcommittee assignments. The body will also select members to sign payroll and weekly warrants.

governanceadministrationschool-committeepayroll
Mon Jan 8, 2024

Council On Aging

Council On Aging to consider CDBG grant application authorization

The Westfield Council On Aging Board will meet to discuss the AARP Tax Assistance Program and a strategic plan overview. The board is deciding whether to authorize the Special Projects Coordinator to submit a Community Development Block Grant (CDBG) application.

seniorsgrantsstrategic-planningtax-assistance
Mon Jan 8, 2024

License Commission

Elks Lodge proposes license alteration to increase usable space

The Commission will consider a public hearing regarding the Westfield-West Springfield Lodge of Elks at 56 Franklin Street. The proposal involves altering an all alcoholic beverages restaurant on-premise license to increase usable space by 1,600 sq. ft. while reducing parking by the same amount.

liquor-licenseszoningpublic-hearingsrestaurants
Thu Jan 4, 2024

City Council

City Council to hold public hearing on zoning map amendment

The City Council will hold a public hearing to consider a petition to change the zoning map for two properties. The request seeks to change portions of the land from Rural Residential to Business B.

zoningland-usepublic-hearing
Thu Jan 4, 2024

City Council

Council considers zoning change for 137 Woodcliff Drive and 254 Union Street

The City Council will hold a public hearing regarding a petition to change the zoning of two properties to Business B. The body will also consider a $50,000 fund transfer for police officer medical care and a special permit for a contractor's yard.

zoningpolicebudgetarpapublic-hearing
Wed Jan 3, 2024

Municipal Light Board

Municipal Light Board to elect new Chair and Vice Chair

The Municipal Light Board will conduct elections for the positions of Chair and Vice Chair. The meeting also includes reviews of subcommittee assignments, quarterly reports, and a joint public meeting announcement.

governmentutilitieselectionspublic-meeting
Wed Jan 3, 2024

City Council Zoning, Planning and Development Committee

Committee to review permit applications for contractor's yard at 0 Progress Ave

The Zoning, Planning and Development Committee will meet to discuss permit applications for a contractor's yard. The body will review site plan and stormwater permit requests for the property at 0 Progress Ave.

zoningplanningpermitscontractor-yard
Tue Jan 2, 2024

City Council

Westfield City Council to elect leadership and adopt rules

The City Council is holding a special meeting to elect a President Pro Tempore and a permanent President. The body will also adopt its rules and assign seating for members.

city-councilgovernanceelections
Tue Jan 2, 2024

Planning Board

Planning Board to hear on building expansion at 323 Lockhouse Rd.

The Planning Board will hold public hearings on several special permits and a zoning map amendment. The board will also consider a recommendation to accept Breighly Way as a public way.

zoningpublic-hearingsland-useroads
Tue Jan 2, 2024

Planning Board

Planning Board to consider zoning map amendment for Woodcliff Dr. and Union St.

The Planning Board will hold a public hearing to consider a petition to change the zoning map for two properties. The request seeks to change portions of 137 Woodcliff Dr. and 254 Union St. from Rural Residential to Business B.

zoningpublic-hearingland-use