The Boring PartsFederalLocal · USLocal · Canada
College Station, TX

College Station public meetings in 2025

202 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 29, 2025 · 17:00

City Council

City Council posts notice for January 2026 events

The College Station City Council posted a notice for upcoming events in January 2026, including a business mixer and a ribbon-cutting ceremony. The agenda does not list any regular council meetings or items for decision.

noticeeventsbusinessceremony
Mon Dec 15, 2025 · 13:30

Audit Committee

Audit Committee to review drainage utility fee and payroll oversight audits

The City Council Audit Committee will discuss and potentially take action on several internal governance documents and audit reports. The meeting includes reviews of the city's fraud response and internal audit charter.

auditgovernancedrainage-utility-feepayrollinternal-controls
1101 Texas Ave, College Station
Thu Dec 11, 2025 · 15:00

City Council

Council to consider $5.76M Marion Pugh road rehabilitation contract

The City Council will meet in executive session to discuss litigation, real estate, personnel, and economic incentives. The open session includes a consent agenda with multiple infrastructure contracts, including a $5.76M Marion Pugh Rehabilitation project and a $4.77M utility relocation for SH 6. Other items involve a franchise agreement for trash valet services, purchase of radio replacements ($4.12M), and sale of surplus aggregate millings.

budgetcontractsinfrastructurepublic-safetyeconomic-developmentlitigationreal-estate
Tue Dec 9, 2025 · 13:30

City Council Legislative Engagement Committee

Committee to discuss legislative engagement efforts

The City Council Legislative Engagement Committee will hold a meeting to hear public comments and discuss legislative engagement efforts. The main agenda item is a presentation, discussion, and possible action regarding the city's legislative engagement. The committee may also discuss future agenda items.

city-councillegislative-engagementpublic-commentcollege-station
1101 Texas Avenue, College Station
Tue Dec 9, 2025 · 18:00

General

Bird conservation on agenda for Parks Board meeting

The College Station Parks and Recreation Board will meet to receive presentations on general parks matters and on bird conservation. The board will also consider approving minutes from the previous meeting and discuss items for future agendas. No votes on ordinances or contracts are scheduled.

parksrecreationbird-conservationcollege-stationpublic-meetingparks-board
2275 Dartmouth Street, College Station
Mon Dec 8, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to discuss feasibility studies, Jingle Bell ride, and Bicycle Plan revisions

The Bicycle, Pedestrian, and Greenways Advisory Board will hear presentations and consider action on a recap of recent bicycle and pedestrian feasibility studies, an update on the College Station Jingle Bell bicycle ride, and proposed changes to the Bicycle Plan as part of the development of a new Active Transportation Master Plan. The board will also approve previous meeting minutes and discuss future agenda items.

bicyclepedestriangreenwaysfeasibility-studiesactive-transportation-master-planjingle-bell-ridecollege-station
1101 Texas Avenue, College Station
Fri Dec 5, 2025 · 11:00

General

Design Review Board to consider landscape buffer appeal for 11720 Old Wellborn Road

The Design Review Board will review and possibly act on the meeting minutes from July 11, 2025. It will also consider an appeal to modify the landscape buffer standards in the Unified Development Ordinance for the property at 11720 Old Wellborn Road, which is zoned R Rural. The board may discuss any future agenda items raised by members.

zoningdevelopmentlandscaperuraldesign-review
1101 Texas Ave, College Station
Thu Dec 4, 2025 · 15:00

Planning & Zoning Commission

Impact Fee Advisory Committee to review semi-annual report on water, wastewater, roadway fees

The Impact Fee Advisory Committee will receive a presentation and discuss a semi-annual report on system-wide impact fees for water, wastewater, and roadway. They will also review their own roles and responsibilities and consider approval of meeting minutes from May 15, 2025. No votes or specific dollar amounts are listed for action.

impact-feesadvisory-committeewaterwastewaterroadwaycollege-station
1101 Texas Avenue, College Station
Wed Dec 3, 2025 · 14:00

Tourism Advisory Committee

Tourism committee to discuss hotel tax grants and strategic plan

The Tourism Advisory Committee will review Hotel Occupancy Tax grants for wrestling and softball events, discuss the FY25 end-of-year reports, and consider the FY26 plan of work. The committee will also present on the steering of the Tourism Strategic Plan and proposed facilities like a Multi-Events Center.

tourismhotel-taxgrantsstrategic-plansportsfacility-planning
1207 Texas Ave., College Station
Mon Dec 1, 2025 · 16:00

General

Historic Preservation Committee to discuss sub-committee programs

This is a routine meeting of the Historic Preservation Committee. The main items are presentations and possible actions on sub-committee programs (Cemetery Project, Historic Marker Program, Oral History Interviews, Exploring History Lunch Series, Americas 250) and a report from the Parks and Recreation Director. The committee will also approve previous meeting minutes and identify upcoming historical events.

historic-preservationcommitteecollege-stationprogramsmeeting
1101 Texas Avenue, College Station
Mon Dec 1, 2025 · 17:00

City Council

City Council posts notice of upcoming community events and meetings

This is a public notice listing several upcoming community events and meetings, including a neighborhood seminar on small area planning, a TxDOT public meeting on the SH30 (Harvey Road) corridor plan, and holiday celebrations. No council actions, ordinances, or resolutions are scheduled for this meeting. The agenda is primarily procedural and informational.

public-noticecommunity-eventsmeetingstxdotholidayplanningcollege-station
Mon Nov 24, 2025 · 16:00

City Council

City Council to vote on contracts, speed limits, and playground construction

The City Council will consider a series of contracts for utility repairs, a bomb robot, and playground construction, as well as temporary speed limit changes on State Highway 6. The meeting also includes a public hearing on zoning changes and a workshop on housing and drainage.

city-councilcontractsspeed-limitszoningpublic-hearingplaygroundswastewaterpolice
Fri Nov 21, 2025 · 10:00

General

Tourism Committee to discuss sponsorship and marketing opportunities

The Tourism Committee will meet to present, discuss, and potentially take action on sponsorship and marketing opportunities. The meeting also includes a period for citizens to address the committee on non-agenda items.

tourismmarketingsponsorship
1101 Texas Ave. , College Station
Fri Nov 21, 2025 · 18:00

General

Notice of Annual Steak & Cigar Dinner for City Council

This agenda is a procedural notice for a social event, the Annual Steak & Cigar Dinner, where a quorum of the City Council may be present. No formal business, ordinances, or decisions are scheduled. This is not a regular city council meeting.

public-noticecity-councilsocial-eventcouncil-dinner
16373 Tonkaway Ranch Road, College Station
Thu Nov 20, 2025 · 16:00

City Council

Council notice lists upcoming holiday events and ribbon cuttings

This agenda is a public notice of upcoming community events and ribbon cuttings, not a regular City Council meeting with decisions or discussions. Items include a Christmas parade, movie night, fun run, and several ribbon-cutting ceremonies. No ordinances, resolutions, or public hearings are scheduled.

eventscommunityholidayribbon-cuttingcollege-station
Thu Nov 20, 2025 · 18:00

Planning & Zoning Commission

P&Z to discuss zoning change for Castle Rock Parkway area

The Planning and Zoning Commission will discuss an ordinance to amend zoning district boundaries at the terminus of Castle Rock Parkway. Final action on the item is scheduled for the December 11, 2025, City Council meeting.

zoningplanningcastle-rock-parkwaypublic-hearingcity-councilagenda
1101 Texas Avenue , College Station
Wed Nov 19, 2025 · 15:00

Economic Development Committee

Committee to discuss Economic Development Master Plan and tourism update

The Economic Development Committee will discuss and possibly take action on the Economic Development Master Plan, tourism initiatives, Northgate District activities, and an update on the city's entrepreneurship initiative. They will also enter executive session to deliberate on real estate properties and economic incentive negotiations with Corinth Group, Inc. and developments in the Midtown Business Park.

economic-developmentmaster-plantourismnorthgatereal-estateincentivesentrepreneurship
Wed Nov 19, 2025 · 16:00

General

Housing Plan Advisory Committee to discuss implementing top actions from the Housing Action Plan

The Housing Plan Advisory Committee will consider approving minutes from its October meetings, present its recommendations to the City Council, and discuss how to implement the top‑ranked actions in the Housing Action Plan. The committee will also address future meeting schedules and potential future agenda items.

housingplanningcommitteecity-councilmeetings
1101 Texas Ave, College Station
Mon Nov 17, 2025 · 17:00

City Council

No substantive items on City Council agenda

The posted notice for the November 17, 2025 City Council meeting contains only procedural boilerplate and event announcements. No ordinances, resolutions, contracts, or public hearings are listed for council action.

proceduralcity-councilnotice
Thu Nov 13, 2025 · 15:00

City Council

Council to consider $7.7M Krenek Tap Road construction contract

The City Council will meet on November 13, 2025, with a heavy consent agenda including large construction contracts, grant authorizations, and a parking removal ordinance. An executive session is scheduled for litigation, land acquisition, personnel evaluations, and economic incentive negotiations. The workshop includes presentations on a tourism strategic plan and Texas A&M off-campus student services. A public hearing will be held on an ordinance amendment (details incomplete in agenda).

roadsinfrastructurepolicegrantsutilitiesparkstourism
Wed Nov 12, 2025 · 15:00

City Council Compensation and Benefits Committee

Committee to discuss city compensation and benefits plan

The City Council Compensation and Benefits Committee will meet to hear a presentation, discuss, and possibly take action on the City’s Compensation & Benefits Plan. The meeting also includes public comment and consideration of future agenda items. The full City Council may or may not attend.

compensationbenefitscommitteepersonnelcity-council
Mon Nov 10, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to hear safe passing ordinance overview and TxDOT SH6 update

The Bicycle, Pedestrian, and Greenways Advisory Board will meet to consider several items including an overview of a safe passing ordinance, presentations on planned bicycle and pedestrian improvements along the State Highway 6 corridor, and an update on the Active Transportation Master Plan. The board may also approve previous meeting minutes and discuss the Jingle Bell bicycle ride and upcoming meeting calendar. Public comment will be heard under Visitors.

safe-passing-ordinanceactive-transportation-master-plantxdot-sh6bicycle-pedestriangreenwaysjingle-bell-rideadvisory-board
1101 Texas Avenue, College Station
Mon Nov 10, 2025 · 16:00

General

Event and ceremony notices posted for Nov 10-21

This is a public notice of upcoming community events and ceremonies, not a regular city council meeting with voting or discussion items. Events include a community workshop, concert, groundbreaking, and ribbon cuttings. No council decisions or ordinances are on the agenda.

eventscommunity-workshopgroundbreakingribbon-cuttingpublic-noticeceremonies
Thu Nov 6, 2025 · 10:00

City Council Legislative Engagement Committee

Committee discusses legislative engagement efforts

The City Council Legislative Engagement Committee will hold a meeting to discuss and possibly take action on legislative engagement efforts. The agenda includes public comment and future agenda items, but the primary substantive item is a presentation and discussion on legislative engagement.

city-councillegislative-engagementcommittee
1101 Texas Avenue, College Station
Thu Nov 6, 2025 · 18:00

Planning & Zoning Commission

Commission to hear rezoning of 0.0175 acres from General Commercial to Townhouse

The Planning & Zoning Commission will hold a public hearing on a proposed ordinance to change the zoning of about 0.0175 acres from General Commercial (GC) to Townhouse (T) east of Holleman Drive South and Cain Road. The commission will also consider an ordinance amendment to the Unified Development Ordinance’s concept‑plan requirements for Planned Development Districts, and review the FY2025 Comprehensive Plan and UDO Annual Review. Additional agenda items include informational updates on recent rezoning approvals and new development applications.

zoningdevelopmentplanningordinancecomprehensive-planpublic-hearing
1101 Texas Avenue , College Station
Wed Nov 5, 2025 · 15:00

Tourism Advisory Committee

Tourism Committee to discuss hotel tax grants and new event facilities

The Tourism Advisory Committee will meet to consider actions on Hotel Occupancy Tax grants and funding guidelines. The body will also discuss the Christmas in College Station Campaign and the Tourism Strategic Plan. Additionally, the committee will review proposals for a Multi-Events Center and the Southern Roots Baseball Complex.

tourismgrantseconomic-developmentsports-facilitieshotel-occupancy-tax
1207 Texas Ave., College Station
Mon Nov 3, 2025 · 16:00

General

Historic Preservation Committee to discuss cemetery and marker programs

The Historic Preservation Committee will meet to review previous minutes and discuss ongoing projects like the Cemetery Project and Historic Marker Program. The group will also identify local historical activities for a calendar of events.

historic-preservationparks-and-recreationcemeteryhistorycommitteeagenda
1101 Texas Avenue, College Station
Mon Nov 3, 2025 · 17:00

City Council

City Council public notice of upcoming community events

This document is a public notice listing scheduled appearances and events for the City Council. No legislative decisions, votes, or policy discussions are scheduled in this notice.

community-eventseconomic-developmentpublic-notice
Tue Oct 28, 2025 · 17:00

City Council

Ribbon cutting for Alvarenga Family Insurance Agency

The provided document is a public notice for a ribbon cutting event. There are no City Council legislative items, votes, or discussions listed.

ribbon-cuttingbusiness
Tue Oct 28, 2025 · 18:00

Construction Board Of Adjustments & Appeals

Board to recommend adopting 2024 building codes

The Construction Board of Adjustment and Appeals will hold a public hearing to recommend the City Council adopt the 2024 International Building Code and related amendments. The board will also consider adopting several other building and safety codes.

building-codesconstructionpublic-hearingcity-councilsafety
1101 Texas Avenue, College Station
Mon Oct 27, 2025 · 17:00

City Council

City Council schedules community events and committee meeting

The provided document is a public notice listing scheduled appearances and events for the City Council. It does not contain a formal meeting agenda for decisions or legislative actions.

community-eventslegislative-affairsribbon-cuttings
Thu Oct 23, 2025 · 15:00

City Council

Eminent domain proposed for Greens Prairie Road widening and Victoria roundabout

The council will begin in executive session to discuss pending litigation, real estate acquisitions, personnel evaluations, and economic development incentives. After reconvening, the consent agenda includes a $2.57M SAFER fire staffing grant, animal shelter funding, tax roll approval, and various community funding agreements. Workshop items cover the Northgate area plan update, overnight parking near the university, and baseball field projects. The regular agenda features resolutions authorizing eminent domain for the Greens Prairie Road Phase 2 widening and Victoria Avenue roundabout projects.

eminent-domainroadsfire-safetybudgethousingparkseconomic-developmentpublic-safety
Wed Oct 22, 2025 · 16:00

Housing Plan Advisory Committee

Committee discusses implementing top-ranked Housing Action Plan actions

The Housing Plan Advisory Committee will discuss and possibly take action on implementing the top-ranked actions from the Housing Action Plan. They will also consider approving meeting minutes and discuss future meetings. No specific financial items or rezonings are on this agenda.

housinghousing-planadvisory-committeecollege-station
1101 Texas Ave, College Station
Tue Oct 21, 2025 · 15:30

Transportation and Mobility Committee

TxDOT to present on Highway 6 expansion project

The Transportation and Mobility Committee will hear a presentation from TxDOT on the Highway 6 Expansion Project. Updates will also be provided from the Bicycle, Pedestrian, and Greenways Advisory Board and the Bryan College Station Chamber of Commerce Transportation Committee. The committee may also discuss future agenda items.

transportationhighwaysbicyclespedestriansgreenwayschamber-of-commercepublic-meetingcity-council-committee
1101 Texas Ave, College Station
Mon Oct 20, 2025 · 10:00

Housing Plan Advisory Committee

Committee will discuss possible changes to the Unified Development Ordinance

The Housing Plan Advisory Committee will present and discuss potential revisions to the Unified Development Ordinance to support the Housing Action Plan. The committee will also consider reducing or eliminating fees related to the plan. Additional items include approval of September 24, 2025 meeting minutes and discussion of implementing top‑ranked actions from the Housing Action Plan. The meeting allows public comments and may set future agenda topics.

housingzoningfeesmeeting-minutesadvisory-committee
1101 Texas Ave, College Station
Mon Oct 20, 2025 · 17:00

City Council

City Council agenda only lists events, no business items

This agenda is a public notice listing upcoming community events and conferences that Council members may attend. No ordinances, resolutions, public hearings, or other actionable items are scheduled for the October 20, 2025 meeting.

eventsnoticepublic-noticecommunity-eventsconference
Thu Oct 16, 2025 · 18:00

Planning & Zoning Commission

P&Z to hold public hearings on two rezonings: Park Place and McCullough Road

The Planning and Zoning Commission will hold public hearings on two rezoning requests. One would change 0.5 acres at 1612 Park Place A & B from General Suburban to Middle Housing. The other would rezone 3.60 acres at 3768 McCullough Road from Rural to Planned Development District. The commission will also receive informational updates on previously approved items.

zoningpublic-hearingrezoningplanningdevelopmentcollege-station
1101 Texas Avenue, College Station
Tue Oct 14, 2025 · 18:00

Parks & Recreation Board

Board will approve minutes from the previous Parks & Recreation meeting

The Parks and Recreation Board will review and vote on the minutes from its last meeting. It will also discuss scheduling for the November Board meeting and hear several informational presentations on upcoming events and projects, including the Brazos Valley Veterans Memorial, Westside Park student project, Christmas in the Park, and Zone 1 Park improvements.

parksrecreationminuteseventsprojects
2275 Dartmouth Street, College Station
Mon Oct 13, 2025 · 17:00

City Council

Council meeting notice lists upcoming community events

The agenda for the October 13, 2025 City Council meeting contains only public notices of upcoming events, such as a historical marker unveiling, a ribbon‑cutting, a food‑truck night, and a regional awards luncheon. No council actions, votes, or policy items are scheduled for discussion or decision at this meeting.

communityeventsnotice
Thu Oct 9, 2025 · 15:00

City Council

City Council to consider three rezoning requests and utility infrastructure projects

The City Council will hold public hearings on three rezoning requests and the use of parkland for sewer lines. The body is also deciding on several infrastructure contracts and an interlocal agreement with the City of Bryan for electric transmission lines.

zoningutilitiesinfrastructurebudgetpublic-works
Tue Oct 7, 2025 · 18:00

Zoning Board of Adjustments

Zoning Board to consider height variance for airport properties

The Zoning Board of Adjustment will meet to approve minutes and hold a public hearing on a request to modify height restrictions for properties near Easterwood Airport.

zoningairportpublic-hearingplanningvariance
1101 TEXAS AVE, COLLEGE STATION
Mon Oct 6, 2025 · 16:00

Historic Preservation Committee

Historic Preservation Committee to discuss sub-committees and programs

The Historic Preservation Committee will hear public comments, then discuss and possibly act on updates to its sub-committees and programs, including the Cemetery Project, Historic Marker Program, oral history interviews, and the Exploring History Lunch Series. A report from the Parks and Recreation Director will also be presented. The meeting includes routine items such as approving previous minutes and identifying upcoming historical events.

historic-preservationcommitteesparks-and-recreationoral-historycemetery-projecthistoric-marker-programexploring-history-lunch-series
1101 Texas Avenue, College Station
Mon Oct 6, 2025 · 17:00

City Council

City Council public notice for upcoming community events

This document is a public notice listing various events and appearances for the City Council. It does not contain a formal meeting agenda for legislative decisions or policy discussions.

community-eventspublic-noticecollege-station
Thu Oct 2, 2025 · 18:00

Planning & Zoning Commission

Public hearing on rezoning 4.71 acres from commercial to multi‑family near University Drive

The commission will consider a waiver request to the Unified Development Ordinance and review a preliminary plan for the Culpepper At TAMU subdivision, about 10.84 acres at College Avenue and University Drive (Case #PP2025-000008). It will also consider a waiver request and preliminary plan for the Bertram Grove subdivision, about 50 acres along Royder Rd (Case #PP2025-000009). A public hearing will be held on a rezoning that would change roughly 4.71 acres from General Commercial to Multi‑Family south of University Drive East and East Crest Drive, with final action slated for the October 9 City Council meeting (Case #REZ2025-000022).

zoningrezoningdevelopmentwaiverssubdivisionspublic-hearingplanning
1101 Texas Avenue , College Station
Wed Oct 1, 2025 · 14:00

Tourism Advisory Committee

Tourism Committee will discuss steering the Tourism Strategic Plan

The Tourism Advisory Committee will present and discuss the steering of the Tourism Strategic Plan and review data reports from the previous month. Citizens may address any issue not on the agenda for up to three minutes, after which staff may investigate or schedule it for a future meeting. The committee may also consider proposals for future agenda items.

tourismstrategic-planpublic-commentsdata-reportsagenda
1207 Texas Ave., College Station
Mon Sep 29, 2025 · 15:00

City Council

Council discusses convention/event center study and multi-event center opportunities

At this special meeting, the City Council will receive a presentation on a convention center study and discuss possible direction on the matter. They will also hear a presentation on potential opportunities for a multi-event center. No final decisions are scheduled; the council may give informal direction.

councilconventionsevent-centerseconomic-developmentspecial-meetingcollege-station
Mon Sep 29, 2025 · 17:00

City Council

City Council public notice lists upcoming community events

The provided document is a public notice listing several community events and ribbon cuttings. It does not contain a formal meeting agenda with items for decision or discussion.

community-eventsribbon-cuttingspublic-notice
Fri Sep 26, 2025 · 09:00

Economic Development Committee

Committee to discuss Economic Development Master Plan

The Economic Development Master Plan Steering Committee will meet to present and discuss the development of the Economic Development Master Plan. The committee may take action on the plan during the session.

economic-developmentmaster-planplanning
Thu Sep 25, 2025 · 16:00

City Council

City Council to consider multiple zoning changes and security contracts

The City Council will hold public hearings on several ordinances to remove Restricted Occupancy Overlays from various residential subdivisions. The body is also considering multiple contracts for security services and traffic cameras, as well as affordable housing funding.

zoningcontractshousingpublic-safetyinfrastructure
Wed Sep 24, 2025 · 14:00

Tourism Advisory Committee

Committee to discuss hotel occupancy grants and Texas Music Scene sponsorship

The Tourism Advisory Committee will consider approving previous meeting minutes, discuss hotel occupancy grants, receive an update from Parks & Recreation, and debate a sponsorship for the Texas Music Scene. They will also discuss representation for a wayfinding working group and review data reports. No specific dollar amounts are listed in the agenda.

tourismhotel-occupancy-grantsparks-and-recreationwayfindingtexas-music-scenedata-reports
1207 Texas Ave., College Station
Wed Sep 24, 2025 · 16:00

Housing Plan Advisory Committee

Committee to discuss Housing Action Plan implementation

The Housing Plan Advisory Committee will consider approving meeting minutes and discuss the implementation of top-ranked actions from the Housing Action Plan. The body will also discuss future meeting schedules.

housingplanningcommitteeagendaminutes
1101 Texas Ave, College Station
Mon Sep 22, 2025 · 17:00

City Council

Public meeting to gather feedback on potential overnight parking restrictions

The City Council meeting includes a public hearing on possible overnight parking limits. Several ribbon‑cutting events and a police promotion ceremony are also scheduled. No decisions are listed; the agenda is mainly informational and procedural.

parkingpublic-hearingribbon-cuttingpolicecommunity-events
Thu Sep 18, 2025 · 18:00

Planning & Zoning Commission

Commission to weigh 237-acre rezoning on Greens Prairie Road

The Planning and Zoning Commission will hold public hearings on multiple rezoning requests, including a 237.65-acre change from Rural to General Suburban on Greens Prairie Road. Other items involve removing the Restricted Occupancy Overlay from dozens of lots in subdivisions such as North Forest Estates, Southwood, Cat Hollow, and Woodcreek. A smaller 4-acre rezoning from Rural to Estate at Yaupon Lane and Bradley Road will also be considered. Final decisions on most items will go to the City Council in late September or early October.

zoningpublic-hearingrezoningrestricted-occupancy-overlayunified-development-ordinancecollege-station
1101 Texas Avenue, College Station
Mon Sep 15, 2025 · 17:00

City Council

Agenda contains only community events, no council decisions

This City Council public notice lists only neighborhood gatherings, ribbon cuttings, and a tailgate event. No ordinances, resolutions, contracts, or public hearings are scheduled. The agenda is purely procedural with no substantive council business.

community-eventsribbon-cuttingtailgateprocedural
Thu Sep 11, 2025 · 16:00

City Council

Council to vote on $4.7M rehabilitation of William D. Fitch Parkway

The City Council will consider a consent agenda with numerous contracts and purchases, including a $4.7 million road rehabilitation project and a $2.3 million transformer purchase. A public hearing on a $774,978 budget amendment is scheduled. Executive session discussions include litigation, a 300-acre real estate negotiation in Midtown Business Park, and an economic development incentive with Corinth Group.

city-councilconsent-agendapublic-hearingbudgetroadsutilitiescontractseconomic-development
Tue Sep 9, 2025 · 18:00

General

Parks board to discuss sewer line at Memorial Cemetery

The Parks and Recreation Board will meet to discuss updates on Bond 2022 projects, a Recreation Center feasibility study, and future baseball fields at Veterans Park. The board will also hold a public hearing on a proposed change of use at the Memorial Cemetery of College Station for a sanitary sewer line.

parksrecreationbond-2022sewermemorial-cemeterypublic-hearing
2275 Dartmouth Street, College Station
Mon Sep 8, 2025 · 15:00

Audit Committee

Audit Committee to consider revisions to its own ordinance

The City Council Audit Committee will discuss and possibly act on proposed revisions to the ordinance that created the committee, as well as receive updates on the Fiscal Year 2025 Audit Plan and the 2025 Citywide Risk Assessment. The committee will also select audits for the Fiscal Year 2026 Audit Plan and review an audit of the Roadway Maintenance Fee. Public comments are invited at the start of the meeting.

auditadministrationfinanceordinancesroadway-maintenance-feerisk-assessmentcity-councilcollege-station
1101 Texas Ave, College Station
Mon Sep 8, 2025 · 15:30

General

Board to review pedestrian traffic stress analysis and Active Transportation Master Plan programs

The Bicycle, Pedestrian, and Greenways Advisory Board will discuss and possibly take action on a draft analysis of pedestrian level of traffic stress at crossings and segments as part of the Active Transportation Master Plan. They will also consider proposed programs for the Master Plan and hear updates on biking, walking, and greenways projects. The meeting includes approval of prior minutes and setting future meeting dates.

transportationpedestrianbicyclegreenwaysmaster-plantraffic-safety
1101 Texas Avenue, College Station
Mon Sep 8, 2025 · 16:00

Historic Preservation Committee

Historic Preservation Committee to discuss sub-committee programs and projects

The Historic Preservation Committee will hold a regular meeting to approve previous minutes, hear public comments, and receive reports. The main agenda item is a presentation, discussion, and possible action regarding sub-committees and programs, including the Cemetery Project, Historic Marker Program, Oral History Interviews, Exploring History Lunch Series, Americas 250, and American Mile. The Parks and Recreation director will also report on matters related to the committee.

historic-preservationcommitteespublic-meetingcemeteryhistorical-markersoral-historyeducation
1101 Texas Avenue, College Station
Mon Sep 8, 2025 · 17:00

City Council

City Council announces upcoming community events and ribbon cuttings

This document is a public notice listing several scheduled events for the City Council. No legislative decisions or policy discussions are scheduled for these dates.

community-eventsribbon-cuttingpublic-notice
Thu Sep 4, 2025 · 14:00

City Council Legislative Engagement Committee

Committee to discuss legislative engagement efforts

The City Council Legislative Engagement Committee will hold a meeting to discuss and possibly take action on legislative engagement efforts. Public comments on non-agenda items will be heard. The committee may also discuss future agenda items.

legislative-engagementcity-councilcommittee
1101 Texas Avenue, College Station
Thu Sep 4, 2025 · 18:00

Planning & Zoning Commission

Commission to consider updates to occupancy overlays and family definitions

The Planning and Zoning Commission will hold public hearings to discuss amending the city's Unified Development Ordinance. The body is considering changes to the definition of family and regulations regarding Restricted Occupancy Overlay (ROO) and High Occupancy Overlay (HOO) zoning districts.

zoningordinancehousingland-use
1101 TEXAS AVE, COLLEGE STATION
Tue Sep 2, 2025 · 14:00

Economic Development Committee

Committee to review development proposal for 4323 State Highway 6 South

The Economic Development Committee will discuss a development proposal from Corinth Properties and provide updates on Plug and Play activities. The committee may also meet in executive session to discuss real estate acquisitions and economic incentive agreements.

economic-developmentreal-estateincentiveszoning
1207 Texas Ave, College Station
Tue Sep 2, 2025 · 17:00

City Council

City Council to present 'Alex Caruso Day' proclamation

The agenda lists two upcoming events, including a joint proclamation presentation and a business gathering. No legislative decisions or policy votes are scheduled.

proclamationcommunity-events
Tue Sep 2, 2025 · 18:00

Zoning Board of Adjustments

Board to rule on two height variance requests near Easterwood Airport

The Zoning Board of Adjustment will hold public hearings on three variance requests: a front setback variance for 3011 Bluestem Drive and two height variances for properties at 550 Cross Street and 100 Church Avenue near Easterwood Airport. The board will also approve meeting minutes and discuss future agenda items.

zoningvariancesairport-zoningboard-of-adjustmentcollege-stationpublic-hearingsetbackheight-variance
1101 TEXAS AVE, COLLEGE STATION
Fri Aug 29, 2025 · 17:00

City Council

City Council agenda lists upcoming community events and notices

The council meeting agenda contains only public notices of upcoming events, ribbon cuttings, award ceremonies, and a legal notice about handgun possession. No policy decisions, ordinances, or contracts are scheduled for discussion. The agenda serves to inform residents of dates, locations, and contact information for accommodations.

community-eventspublic-noticeceremoniesawardslegal-notice
Thu Aug 28, 2025 · 16:00

City Council

College Station Council sets 2026 budget and tax rate

The City Council will discuss the 2026 budget, approve a $5 million construction contract for the Public Works Facility, and consider a tax rate increase. The meeting includes a public hearing on the tax rate and budget.

budgettaxespublic-worksconstructiontrafficeasements
Wed Aug 27, 2025 · 14:00

Tourism Advisory Committee

Committee to discuss Tourism Strategic Plan and Hotel Occupancy Tax Grants

The Tourism Advisory Committee will hear presentations and possibly act on steering the Tourism Strategic Plan, consider Hotel Occupancy Tax Grants, review the FY26 Media Plan, and examine monthly data reports. The meeting includes a public comment period and approval of previous meeting minutes.

tourismstrategic-planhotel-occupancy-taxgrantsmedia-planpublic-commentadvisory-committee
1207 Texas Ave., College Station
Wed Aug 27, 2025 · 16:00

Housing Plan Advisory Committee

Committee to discuss Housing Action Plan implementation

The Housing Plan Advisory Committee will consider approving meeting minutes, discuss implementation of top-ranked actions from the Housing Action Plan, and plan future meetings. Public comments will be heard at the start of the meeting.

housingaction-plancommitteecollege-station
1101 Texas Ave, College Station
Fri Aug 22, 2025 · 17:00

City Council

Ribbon cutting for White Rose Builders scheduled for August 27

The agenda lists a single event for the City Council. The body will attend a ribbon cutting ceremony for White Rose Builders.

ribbon-cuttingbusiness-development
Thu Aug 21, 2025 · 10:00

City Council Legislative Engagement Committee

Committee to discuss legislative engagement efforts

The City Council Legislative Engagement Committee will meet to hear public comments and discuss possible actions on legislative engagement efforts. The agenda includes a presentation and discussion on this topic, with potential for future agenda items. No other substantive items are scheduled.

legislative-engagementcity-councilcommittee-meetingpublic-comment
1101 Texas Avenue, College Station
Wed Aug 20, 2025 · 13:00

Planning & Zoning Commission

Planning and Zoning Commission holds training session on roles and responsibilities

This is a procedural training meeting for the Planning and Zoning Commission, not a regular decision-making meeting. The only substantive item is a presentation and discussion on the commission's role and responsibilities. No votes, public hearings, or binding actions are scheduled.

trainingplanning-and-zoningcommission-rolescollege-station
1101 TEXAS AVE, COLLEGE STATION
Wed Aug 20, 2025 · 17:00

City Council

Notice of possible quorum at Texas A&M Off Campus Student Carnival

This agenda is a procedural notice for a possible quorum of the City Council at the Texas A&M Off Campus Student Carnival event on August 24, 2025. No substantive decisions or discussions are listed for this meeting.

college-stationcity-councilproceduralnoticequorumstudent-carnival
Tue Aug 19, 2025 · 15:30

Transportation and Mobility Committee

Committee will review transportation planning and traffic calming updates

The Transportation and Mobility Committee will hear a presentation on city transportation planning. It will discuss the City Traffic Calming Program and consider possible action on it. Updates will be provided by the Bicycle, Pedestrian, and Greenways Advisory Board and the Bryan College Station Chamber of Commerce Transportation Committee. The committee will also discuss future agenda items.

transportationtraffic-calmingbicycle-pedestriangreenwayschamber-of-commerceplanning
1101 Texas Ave, College Station
Mon Aug 18, 2025 · 12:00

Comprehensive Plan Evaluation Committee

Committee reviews engagement data for Comprehensive Plan 5-year evaluation

The Comprehensive Plan Evaluation Committee will hear a presentation summarizing engagement activities and feedback analysis for the 5-year plan review. Members will then discuss recommendations for the final Evaluation & Appraisal Report. The meeting also includes a public comment period.

comprehensive-planevaluationpublic-engagementplanningland-usecity-government
1101 TEXAS AVE, COLLEGE STATION
Fri Aug 15, 2025 · 17:00

City Council

Council notice lists upcoming community events

This agenda is a public notice of upcoming community events, not a regular council meeting with decisions or discussions. It includes a ribbon cutting, economic outlook briefing, history luncheon, and business after hours event. No votes, ordinances, or public hearings are scheduled.

community-eventsribbon-cuttingeconomic-outlookhistory-luncheonbusiness-after-hours
Thu Aug 14, 2025 · 16:00

City Council

City Council to discuss 2025-2026 tax rate and land rezoning

The City Council will hold a public hearing on the proposed 2025-2026 ad valorem tax rate. The body is also considering rezoning approximately 38.24 acres south of University Drive East and East Crest Drive. Additionally, the council will review several municipal contracts and parking ordinances.

budgetzoningtax-ratecontractsparkingordinances
Tue Aug 12, 2025 · 16:00

City Council

Council to consider proposed tax rate, budget, and capital plan for FY 2025-2026

The City Council will hold a special meeting to receive a presentation, discuss, and possibly take action on the proposed tax rate, budget, and capital improvement plan for the 2025-2026 fiscal year. No attachments or additional details are provided in the agenda. This is the only substantive item on the agenda.

budgettax-ratecapital-improvement-planfiscal-year-2025-2026special-meeting
Wed Aug 6, 2025 · 15:00

Economic Development Committee

Economic Development Committee discusses master plan and tourism updates

The Economic Development Committee will review minutes from a previous meeting, discuss the Economic Development Master Plan, and receive updates on tourism and entrepreneurship efforts. The committee may also consider real estate matters regarding a property in the Midtown Business Park.

economic-developmenttourismentrepreneurshipmaster-planreal-estatecommittee
Tue Aug 5, 2025 · 18:00

Zoning Board of Adjustments

Zoning Board to consider front setback variance for 1004 Rose Circle

The Zoning Board of Adjustment will hold a public hearing to discuss a front setback variance for a property in the Sweet Briar Subdivision. The board will also consider the approval of meeting minutes from June 3, 2025.

zoningvariancesland-use
1101 Texas Avenue , College Station
Fri Aug 1, 2025 · 17:00

City Council

Notice lists community events, no council action items

This public notice announces several community events and a Legislative Affairs Committee meeting from August 4-8, 2025. No City Council decisions, ordinances, or public hearings are scheduled.

eventscommunityribbon-cuttingcommittee-meetingpublic-art
Thu Jul 31, 2025 · 10:00

City Council Legislative Engagement Committee

City Council Legislative Engagement Committee discusses outreach and future agenda

The Legislative Engagement Committee will hear brief citizen presentations and discuss the city's legislative engagement efforts. The committee may consider placing new topics on future agendas. No specific actions, contracts, or dollar amounts are listed.

legislative-engagementpublic-commentscity-councilmeetingsagenda
1101 Texas Avenue, College Station
Wed Jul 30, 2025 · 14:00

Tourism Advisory Committee

Tourism Committee to discuss strategic plan and FY26 budget

The Tourism Advisory Committee will meet to discuss the Tourism Strategic Plan and the FY26 budget update. The body will also consider actions regarding Hotel Occupancy Tax (HOT) grants and capital projects.

tourismbudgetgrantseconomic-development
Fri Jul 25, 2025 · 17:00

City Council

City Council schedules ribbon cuttings and community events

The agenda lists several upcoming public appearances and events for the City Council. No legislative decisions or policy discussions are scheduled for this notice.

community-eventsribbon-cuttingspublic-notices
Thu Jul 24, 2025 · 16:00

City Council

Council holds public hearing on FY2025-2026 budget

Council will first meet in executive session for litigation, real estate, personnel, and economic incentive negotiations. The open session includes a public hearing on the proposed FY2025-2026 budget, ordinances to issue general obligation bonds and certificates of obligation, and a letter of intent with the Brazos Valley Bombers. The consent agenda features contracts for drainage repairs and citywide sidewalk design.

budgetbondseconomic-developmentdrainage-infrastructuresidewalksparks-and-recreationhousingcommunity-development
Wed Jul 23, 2025 · 16:00

Housing Plan Advisory Committee

Committee to discuss implementing top Housing Action Plan priorities

The Housing Plan Advisory Committee will consider approving July 2 meeting minutes, discuss and possibly act on implementing the top-ranked actions from the Housing Action Plan, and schedule future meetings. The main substantive item is the implementation discussion.

housinghousing-planadvisory-committeeaction-plan
1101 Texas Ave, College Station
Mon Jul 21, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to review Active Transportation Master Plan survey results and micromobility

The Bicycle, Pedestrian, and Greenways Advisory Board will hear presentations and consider possible action on the Active Transportation Master Plan corridor feasibility study, including a recap of public meetings and survey responses. They will also discuss micromobility devices within the active transportation network and a Bicycle Level of Traffic Stress assessment. Other agenda items include approving meeting minutes, project updates, and setting the board's calendar.

transportationbicyclespedestriansgreenwaysmicromobilityactive-transportation-planpublic-meetingstraffic-stress
1101 Texas Avenue, College Station
Fri Jul 18, 2025 · 17:00

City Council

Council notice posted for ceremonial events and budget seminar

This agenda is a public notice listing upcoming ribbon cuttings, a fire department ceremony, and a neighborhood seminar on city budgeting. No legislative items, ordinances, or votes are scheduled for this meeting.

eventspublic-noticebudgetribbon-cuttingfire-departmentceremonial
Thu Jul 17, 2025 · 18:00

Planning & Zoning Commission

Commission to consider rezoning 38.24 acres near University Drive East

The Planning and Zoning Commission will hold public hearings regarding a comprehensive plan amendment and a rezoning request for land south of University Drive East and East Crest Drive. These actions would change land use and zoning designations to allow for residential and multi-family development.

zoningland-usehousingpublic-hearing
1101 TEXAS AVE, COLLEGE STATION
Wed Jul 16, 2025 · 08:30

City Council

Council to discuss FY 2025-2026 proposed budget

This is a special meeting of the College Station City Council with one substantive item: a presentation, discussion, and possible action on the proposed budget for fiscal year 2025-2026. No attachments or additional details were provided. The meeting is open to the public in person and virtually.

city-councilbudgetfiscal-year-2025-2026
Fri Jul 11, 2025 · 11:00

Design Review Board

Board to hear appeal on landscape buffer standards for 111 Cooner St

The Design Review Board will consider an appeal to the landscape buffer standards in the Unified Development Ordinance for a property at 111 Cooner Street, zoned GC General Commercial and R-4 Multi-Family. The appeal (Case #AWV2025-000028) includes a staff report, applicant's supporting information, zoning map, landscape buffer exhibit, and site plan. The meeting also includes approval of minutes and public comments.

design-review-boardzoninglandscape-bufferappealcommercialmulti-familyunified-development-ordinance
1101 Texas Ave, College Station
Thu Jul 10, 2025 · 16:00

City Council

Council to consider development agreement for 49.5 acres on Arrington Road

The College Station City Council will hold a public hearing on a development agreement with Brazos Valley TDC, LLC for 49.5 acres in the extraterritorial jurisdiction. The consent agenda includes contracts for park design, crossing guards, and easements for the Marion Pugh Rehab Project, plus a resolution approving up to $14.5 million in bonds for road improvements. The Council will also receive updates on the FY 2025-2026 proposed budget and a neighborhood parking study.

zoningbudgetroadsparkspublic-safetyhousingreal-estate
Mon Jul 7, 2025 · 16:00

City Council

City Council to consider FY 2025‑2026 budget and schedule a public hearing

The City Council will present, discuss, and possibly act on the FY 2025‑2026 Proposed Budget. Council members will also consider calling a public hearing on the same budget for Thursday, July 24, 2025 at 6:00 PM in the City Hall Council Chambers. Both items are sponsored by Mary Ellen Leonard.

budgetpublic-hearingcity-councilfinance
Mon Jul 7, 2025 · 16:00

General

Historic Preservation Committee to review markers and local history projects

The Historic Preservation Committee will discuss and potentially take action on several city programs and sub-committees. The meeting includes reports on historical initiatives and the identification of upcoming local historical events.

historic-preservationcommunity-programslocal-history
1101 Texas Avenue, College Station
Wed Jul 2, 2025 · 16:00

Housing Plan Advisory Committee

Committee to discuss 2025-2029 Consolidated Plan and housing goals

The Housing Plan Advisory Committee will meet to discuss recent housing legislation and prioritize goals and strategies for the city's housing plan. The body will also consider the proposed 2025-2029 Consolidated Plan and the FY2026 Annual Action Plan.

housingplanninglegislationcity-government
1101 Texas Ave , College Station
Tue Jul 1, 2025 · 18:00

Zoning Board of Adjustments

Board to consider height variance for property at 201 Church Avenue

The Zoning Board of Adjustment will hold a public hearing to discuss a height variance to the Airport Zoning Ordinance. The request concerns a property located at 201 Church Avenue, zoned NG-1 Core Northgate.

zoningairport-ordinanceheight-variancepublic-hearing
1101 Texas Avenue , College Station
Mon Jun 30, 2025 · 15:00

City Council Compensation and Benefits Committee

Committee to discuss city compensation and benefits plan

The City Council Budget and Finance Committee will hold a meeting to hear a presentation and discuss possible action on the City's Compensation & Benefits Plan. The agenda also includes time for public comments and consideration of future agenda items. The meeting is scheduled for June 30, 2025, at 3:00 PM.

budgetcompensationbenefitscity-council-committeecollege-station
Fri Jun 27, 2025 · 17:00

City Council

Council posts notices for ribbon-cutting, committee meeting, July 4 event

This notice lists upcoming non-voting events: a ribbon-cutting for Schulte Roofing, a Legislative Affairs Committee meeting, and the I Heart America Celebration. No city council decisions or public hearings are scheduled; the agenda is purely procedural.

city-councileventsribbon-cuttingcommittee-meetingholiday-celebration
Thu Jun 26, 2025 · 16:00

City Council

City Council to consider utility, construction, and zoning items

The City Council will reconvene from executive session to discuss contracts for utility relocation and construction projects, as well as a public hearing on a zoning change. The meeting also includes a workshop on legislative activities and a settlement agreement.

city-councilcontractszoningpublic-hearingutilityconstructionexecutive-sessionlegislative
Wed Jun 25, 2025 · 15:00

Tourism Advisory Committee

Committee to consider FY2026 funding requests and hotel tax grants

The Tourism Advisory Committee will hear public comments and consider approving previous meeting minutes. They will discuss and possibly act on FY2026 funding requests for the Brazos Valley Veterans Memorial and the Arts Center of the Brazos Valley, as well as current Hotel Occupancy Tax Grant applications. Other items include future signature events, data reports, and the Tourism Strategic Plan.

tourismfundinggrantsveteransartshotel-occupancy-taxstrategic-plan
Tue Jun 24, 2025 · 15:30

Budget and Finance Committee

Budget Committee to discuss FY 2026 budget status

The City Council Budget and Finance Committee will meet on June 24, 2025 at 3:30 PM. The agenda includes a presentation, discussion, and possible action on the status of the FY 2026 budget. The meeting also allows citizen comments and consideration of future agenda items.

budgetingfinancecity-councilpublic-hearingmeeting-procedure
Mon Jun 23, 2025 · 10:30

City Council

No substantive items; agenda is procedural notice only

This is a public notice for the College Station City Council meeting, but the agenda contains no specific items of business, discussion, or decisions. The only upcoming meeting referenced is a separate Economic Development Master Plan Steering Committee meeting on June 26. The document includes standard boilerplate about accessibility, handgun restrictions, and quorum.

city-councilproceduralnoticecollege-station
Fri Jun 20, 2025 · 17:00

City Council

City Council notices community and business events for June 2025

The provided document is a public notice listing several upcoming community seminars and business events. It does not contain a formal City Council meeting agenda with legislative items or decisions.

community-eventspublic-noticebusiness
Tue Jun 17, 2025 · 15:30

Transportation and Mobility Committee

Committee to discuss and potentially act on City Traffic Calming Program

The Transportation and Mobility Committee will review upcoming projects from Texas A&M University Transportation Services and the Bryan College Station Chamber of Commerce. The body will also receive an update from the Bicycle, Pedestrian, and Greenways Advisory Board and consider action on the City's Traffic Calming Program.

transportationtraffic-calmingbikingpedestriansinfrastructure
1101 Texas Ave, College Station
Mon Jun 16, 2025 · 17:00

City Council

Notice of Aspire Topping Out Celebration on June 20

This agenda is primarily a procedural notice. The only substantive item is a public announcement of the Aspire Topping Out Celebration at Aspire Reserve on June 20, 2025. No decisions or discussions are listed for the council.

public-noticecelebrationprocedural
Fri Jun 13, 2025 · 17:00

City Council

City Council lists community events and public notices for June

The College Station City Council agenda lists several community events, including a ribbon cutting, a Juneteenth celebration, and a police recruit ceremony. The document also includes a notice regarding open carry handgun laws and ADA accommodation procedures.

community-eventsjuneteenthpoliceadapublic-notices
Thu Jun 12, 2025 · 16:00

City Council

Council to consider rezoning 2.75 acres at Harvey Mitchell Parkway to urban residential

The City Council will hold public hearings on a rezoning of 2.752 acres at 2360 Harvey Mitchell Parkway South from General Commercial to Urban Residential and Planned Development District. Council also will consider an amendment to an economic development agreement with FUJIFILM Diosynth Biotechnologies, several consent items including a $315,000 polymer price agreement and a $410,100 design contract for Southwood Valley Trunkline, and workshop items on affordable housing fee reductions and solid waste rates.

zoningpublic-hearingeconomic-developmentcontractssolid-wasteaffordable-housingtransportationgrants
Tue Jun 10, 2025 · 18:00

Construction Board Of Adjustments & Appeals

Public hearing on unsafe structure at 1501 Holleman Drive

The Building and Construction Standards Commission will hold a public hearing to determine whether the structure at 1501 Holleman Drive Building 2 meets minimum standards and is unsafe under state and local codes. The commission may take action to address the condition of the building.

buildingsafetypublic-hearingunsafe-structurecollege-station
1101 TEXAS AVE, COLLEGE STATION
Tue Jun 10, 2025 · 18:00

General

Parks and Recreation Board to consider naming for Bill Whitehead Little League Field

The Parks and Recreation Board will discuss updates on baseball design, playground replacements, and the Undeveloped Smith Tract Property. The board may take action on the naming of the Bill Whitehead Little League Field.

parksrecreationland-useplaygrounds
2275 Dartmouth Street, College Station
Mon Jun 9, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to review corridor feasibility study and grant applications

The Bicycle, Pedestrian, and Greenways Advisory Board will discuss and possibly take action on several items related to the Active Transportation Master Plan, including a corridor feasibility study, status of existing master plan programs, and grant applications for walking and biking. They will also consider connections to transit stops and review upcoming calendar items. The board will also consider approving meeting minutes from May 12, 2025.

bicyclepedestriangreenwaysactive-transportationmaster-plancorridor-studygrantstransit-connections
1101 Texas Avenue, College Station
Fri Jun 6, 2025 · 17:00

City Council

Council meeting lists upcoming community events and public notices

The City Council meeting agenda contains only public notices of upcoming events. No ordinances, contracts, or policy decisions are listed for discussion or vote. The agenda serves to inform residents of scheduled ribbon cuttings, a music series, and related dates.

communityeventspublic-notice
Thu Jun 5, 2025 · 18:00

Planning & Zoning Commission

P&Z to consider rezoning 19 acres for commercial use

The Planning and Zoning Commission will consider an ordinance to rezone approximately 19.33 acres at 2855 Graham Road North from Rural to Commercial Industrial. Final action on this item is scheduled for the June 26, 2025 City Council meeting.

zoningplanningdevelopmentpublic-hearingcity-councilgraham-road
1101 TEXAS AVE, COLLEGE STATION
Tue Jun 3, 2025 · 18:00

Zoning Board of Adjustments

Zoning Board to hear height variance requests for Stasney Street properties

The Zoning Board of Adjustment will consider two public hearings regarding height variances to the Airport Zoning Ordinance for properties on Stasney Street. The board will also approve minutes from a previous meeting.

zoningairportvariancenorthgatestasney-streettamu
1101 Texas Avenue, College Station
Mon Jun 2, 2025 · 15:00

Audit Committee

Audit Committee reviews FY 2025 audit plan and possible amendments

The City Council Audit Committee will consider minutes from its March 24 meeting, a peer review of the Auditor's Office for 2022‑2024, the auditing standards used by the Internal Auditor, and an update to the Fiscal Year 2025 Audit Plan with potential changes. Citizens may address any issue not on the agenda for three minutes each. The committee may also place new topics on future agendas.

auditfinancegovernancepublic-meeting
1101 Texas Ave, College Station
Fri May 30, 2025 · 11:30

City Council

Notice of events; no council decisions on this agenda

This agenda is a public notice listing events where a quorum of the City Council may be present, including the ITGA conference, 4-H Roundup, and a ribbon cutting. No ordinances, resolutions, or other items for council action are listed.

proceduraleventspublic-notice
Thu May 29, 2025 · 10:00

City Council Legislative Engagement Committee

Committee to discuss legislative engagement efforts

The City Council Legislative Engagement Committee will discuss and possibly take action on legislative engagement efforts, hear public comments, and consider future agenda items. The agenda contains no specific legislation, ordinances, or financial items.

city-councilcommittee-meetinglegislative-engagement
1101 Texas Avenue, College Station
Wed May 28, 2025 · 15:00

Tourism Advisory Committee

Tourism Committee to consider Convention Center feasibility study

The Tourism Committee will discuss and possibly act on a Convention Center Feasibility Study, hotel occupancy grants, future signature events, and the Tourism Strategic Plan. Other items include approving previous meeting minutes and reviewing data reports. The meeting is open to public comments.

tourismconvention-centerhotel-occupancy-grantsstrategic-planpublic-comment
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Adjourn.
9 yea
Hunter Goodwin yea · Rhianon Elizabeth Whitney yea · Costa Dallis yea · Paul Allen Loy yea · Scott Logan yea · Connor Clark yea · Kevin Davis yea · William L. Peel, Jr. yea · Jim Ross yea
Wed May 28, 2025 · 16:00

Housing Plan Advisory Committee

Housing Plan Advisory Committee to review implementation progress and prioritize goals

The Housing Plan Advisory Committee will meet to approve previous minutes, review the implementation progress of the Housing Action Plan, and discuss the prioritization of the plan's goals and strategies.

housingplanningadvisory-committeecity-councilimplementationprioritization
1101 Texas Ave , College Station
Thu May 22, 2025 · 16:00

City Council

Council to consider $4M early works package for new water wells project

The City Council will hold public hearings on rezoning 9.5 acres at 505 William D. Fitch Parkway and adopting standards for youth recreational programs. The consent agenda includes a $4 million contract for Wells 10-12 project and a contract for Samsara camera hardware for fleet equipment. The council will also discuss legislative engagement and tourism updates, and consider issuing certificates of obligation.

city-councilzoningwater-infrastructurepublic-worksdebtyouth-programstourism
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Consent Agenda.
7 yea
John Nichols yea · Mark Smith yea · William Wright yea · David White yea · Melissa McIlhaney yea · Bob Yancy yea · Scott Shafer yea
Thu May 22, 2025 · 17:00

City Council

Council posts notice of upcoming community events

This document is a public notice listing upcoming community events, not a regular city council meeting with decisions or votes. Items include a Memorial Day observance, a neighborhood seminar on tourism, a public works open house, and various ribbon cuttings and receptions.

public-noticeeventsmemorial-daytourismpublic-worksmusicribbon-cutting
Tue May 20, 2025 · 15:30

Budget and Finance Committee

Budget committee to discuss FY 2026 budget and FY 2025 debt status

The Budget and Finance Committee will receive presentations and discuss the status of the FY 2025 debt issuance, the ongoing FY 2026 budget process, and the fiscal year 2025 year-to-date results. Possible action may be taken on these items. The meeting also includes a public comment period for residents.

budgetfinancedebtmunicipal-budgetpublic-commentcity-council-committee
Mon May 19, 2025 · 12:00

CDBG Public Service Agency Funding Review Committee

Committee will decide funding recommendations for RFP 25-059 Community Development Block Grant proposals

The CDBG Public Service Agency Funding Review Committee will discuss and possibly act on several items related to RFP 25-059, including the review process, ranking and scoring of proposals, and final funding recommendations. The meeting also includes a presentation on recognizing affidavits filed under state conflict‑of‑interest law and a review of the minutes. The committee may consider changes to the funding process for the next year.

cdbgfundinggrantrankingprocessaffidavitsminutes
1101 Texas Avenue, College Station
Fri May 16, 2025 · 17:00

City Council

Council notice lists upcoming community events, no decisions

This notice lists community events from May 19–24 where City Council members may be present. No council decisions or discussions are scheduled. It includes ribbon cuttings, public meetings, and a history launch.

community-eventsribbon-cuttingspublic-meetingsparkstransportation
Thu May 15, 2025 · 18:00

Planning & Zoning Commission

Committee to review semi‑annual system‑wide impact fee report

The Impact Fee Advisory Committee will meet on May 15, 2025 to consider a semi‑annual report on system‑wide impact fees for water, wastewater, and roadway. The agenda includes routine consent items such as approval of meeting minutes and a discussion of the impact‑fee report with related maps and status updates. Visitor comments may be heard, and the committee may consider items for future agendas.

impact-feeswaterwastewaterroadwayadvisory-committeereport
1101 TEXAS AVE, COLLEGE STATION
Thu May 15, 2025 · 18:00

Planning & Zoning Commission

P&Z to consider rezoning 2.752 acres on Harvey Mitchell Parkway South

The Planning and Zoning Commission will hold public hearings on changing the land use and zoning for a property at 2360 Harvey Mitchell Parkway South. The body will also consider a final plat for the Bugai Subdivision. Final action on the rezoning items is scheduled for the June 12 City Council meeting.

zoningland-usepublic-hearingssubdivisions
1101 TEXAS AVE, COLLEGE STATION
Tue May 13, 2025 · 18:00

General

Parks and Recreation Board to discuss parkland dedication process

The Parks and Recreation Board will meet to receive a report from the Director of Parks and Recreation. The board will also discuss the parkland dedication process and consider approving minutes from the previous meeting.

parksrecreationland-use
2275 Dartmouth Street, College Station
Mon May 12, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to discuss Corridor Feasibility Study for Active Transportation Master Plan

The Bicycle, Pedestrian, and Greenways Advisory Board will consider the Corridor Feasibility Study being performed as part of the Active Transportation Master Plan, including upcoming public meetings. They will also discuss the status of a future trail along the Gulf States Utility corridor and evaluate existing programs from the Bicycle, Pedestrian, and Greenways Master Plan. Items are advisory only; no binding decisions are made.

transportationpedestrianbicyclegreenwaysmaster-plantrailspublic-meetingsadvisory-board
1101 Texas Avenue, College Station
Mon May 12, 2025 · 16:00

CDBG Public Service Agency Funding Review Committee

Committee to review CDBG Public Service Agency funding proposals

The CDBG Public Service Agency Funding Review Committee will discuss and possibly act on a ranking and scoring process for proposals submitted under RFP 25-059 for Community Development Block Grant Public Service Agency funding. They will also recognize conflict of interest affidavits, approve minutes from April 21, and discuss future agenda items.

cdbgpublic-service-agencyfundingcommitteerfpscoring
City of College Station, College Station
Fri May 9, 2025 · 17:00

City Council

Notice of council attendance at events, no regular business

This agenda is a public notice of events where City Council members may be present, not a regular meeting. It lists a legislative trip to Washington D.C., a law enforcement memorial service, a legacy luncheon, and an arts celebration. No ordinances, votes, or formal decisions are scheduled.

councileventsprocedurallegislative-tripmemorial-servicearts
Thu May 8, 2025 · 16:00

City Council

City Council to consider budget amendment and eminent domain for SH 6 widening

The City Council will meet to discuss a budget amendment for the 2024-2025 fiscal year and authorize the acquisition of land for the Texas Department of Transportation's State Highway 6 widening project. The meeting includes consent items for contracts and a workshop on street maintenance and economic development.

budgettransportationcontractspublic-workszoninggovernmentpublic-hearing
Wed May 7, 2025 · 15:00

Economic Development Committee

Committee to discuss tourism, master plan, and executive session on incentives

The Economic Development Committee will hear presentations and possibly take action on updates to tourism initiatives and the Economic Development Master Plan. The committee will also enter executive session to discuss real estate (including 1508 Harvey Road and Corporate Parkway/Midtown Drive) and economic incentive negotiations with multiple businesses, including Fujifilm Diosynth Biotechnologies.

economic-developmenttourismmaster-planreal-estateincentivesexecutive-sessionfujifilm
Tue May 6, 2025 · 15:30

Transportation and Mobility Committee

Transportation committee to discuss traffic calming program action

The College Station Transportation and Mobility Committee will hear presentations from Texas A&M University Transportation Services and receive updates from the Bicycle, Pedestrian, and Greenways Advisory Board and the Chamber of Commerce Transportation Committee. The committee may also discuss and take possible action on the City's Traffic Calming Program. Public comments will be accepted at the start of the meeting.

transportationtraffic-calmingbicyclepedestriangreenwaystexas-amchamber-of-commercepublic-comment
1101 Texas Ave, College Station
Tue May 6, 2025 · 18:00

Zoning Board of Adjustments

Zoning Board to consider setback variances for two residential properties

The Zoning Board of Adjustment will hold public hearings to discuss and possibly act on two variance requests regarding development standards. These requests involve property setbacks for locations on Berkeley Street and Anderson Arbor Court.

zoningvariancesland-useresidential
1101 TEXAS AVE, COLLEGE STATION
Mon May 5, 2025 · 16:00

General

Historic Preservation Committee to review markers and local history projects

The Historic Preservation Committee will discuss and potentially take action on several city history programs. The meeting includes reports from the Director of Parks and Recreation and a review of upcoming historical events.

historic-preservationcommunity-projectscultureparks-and-recreation
1101 Texas Avenue, College Station
Fri May 2, 2025 · 17:00

City Council

No substantive business items listed on agenda

This is a public notice listing upcoming ribbon cuttings and community events, not a regular City Council meeting with decisions or discussions. No ordinances, resolutions, contracts, or public hearings are on the agenda.

eventsribbon-cuttingspublic-notice
Thu May 1, 2025 · 11:30

City Council Legislative Engagement Committee

Committee to discuss legislative engagement efforts

The City Council Legislative Engagement Committee meets to hear public comments and discuss its legislative engagement activities. The main agenda item is a presentation and possible action on legislative engagement efforts.

legislative-engagementcity-councilcommittee
1101 Texas Avenue, College Station
Thu May 1, 2025 · 18:00

Planning & Zoning Commission

Rezoning of 9.5 acres at 505 William D. Fitch Parkway to be decided

The Planning and Zoning Commission will hold a public hearing and consider an ordinance to rezone approximately 9.499 acres at 505 William D. Fitch Parkway from Planned Development District to General Commercial, Office, and Natural Areas Protected. The agenda also includes approval of April 3 meeting minutes, discussion of new development applications, and future agenda items.

zoningland-useplanning-and-zoning-commissioncollege-stationrezoningpublic-hearing
1101 TEXAS AVE, COLLEGE STATION
Wed Apr 30, 2025 · 15:00

Tourism Advisory Committee

Tourism Committee will discuss the Convention Center Feasibility Study

The College Station Tourism Advisory Committee will meet on April 30, 2025 to present, discuss, and possibly act on several items. Agenda items include the minutes of the previous meeting, monthly data reports, the Tourism Strategic Plan, the Convention Center Feasibility Study, and the FY25 use of the HOT Fund with FY26 budget requests. The committee will also hear citizen comments and consider future agenda topics.

tourismplanningbudgethot-fundconvention-center
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Adjourn.
9 yea
Hunter Goodwin yea · Greg Stafford yea · Rhianon Elizabeth Whitney yea · Costa Dallis yea · Paul Allen Loy yea · Scott Logan yea · Cortney Phillips yea · Connor Clark yea · Jim Ross yea
Mon Apr 28, 2025 · 14:00

Architectural Advisory Committee

Discussion on Lincoln Recreation Center Project

The Architectural Advisory Committee will review and possibly act on two projects: the Lincoln Recreation Center Project and the Fun for All Donor Plaza. The meeting also includes routine items such as approval of prior minutes and a public comment period. No decisions are recorded in the agenda; the items are presented for discussion and potential future action.

architecturepublic-projectsminutespublic-commentplanning
1101 Texas Ave, College Station
Fri Apr 25, 2025 · 17:00

City Council

Council meeting notice lists upcoming community events, no agenda items

The City Council public notice for the April 25, 2025 meeting contains only announcements of upcoming community events. No ordinances, contracts, or policy matters are scheduled for discussion or decision at this meeting. Residents are directed to the listed events for details.

public-noticecommunity-eventscity-councilplanningfire-station
Thu Apr 24, 2025 · 16:00

City Council

City Council to consider $13.48 million for Fire Station #7 construction

The City Council will discuss several high-value infrastructure contracts and recycling franchise agreements. The body will also hold an executive session to discuss litigation, real estate, and economic development incentives.

public-safetywaste-managementinfrastructureeconomic-developmentreal-estate
Wed Apr 23, 2025 · 16:00

Housing Action Plan Steering Committee

Committee to discuss Housing Action Plan progress and prioritize goals

The Housing Plan Advisory Committee will hold a meeting to hear visitor comments and discuss several items, including a presentation on the City's Comprehensive Plan, the committee's own charge and structure, an updated Housing Action Plan Existing Conditions Report and implementation progress, and recommended prioritization of the Plan's Goals, Strategies, and Actions. The committee may also discuss future agenda items.

housingcomprehensive-plancommittee-structuregoalsstrategiesactionscollege-station
City of College Station City Hall, College Station
Mon Apr 21, 2025 · 16:00

CDBG Public Service Agency Funding Review Committee

CDBG committee to review public service agency funding and RFP process

The CDBG Public Service Agency Funding Review Committee will discuss and possibly act on Community Development Block Grant and Public Service Agency funding allocations, as well as RFP 25-059 and the committee's review process. The committee will also consider conflict-of-interest affidavits and approve previous meeting minutes. Future meeting dates and site visits may be scheduled.

cdbgpublic-service-agencyfundingcommitteerfpsconflicts-of-interestcollege-station
City of College Station City Hall, College Station
Thu Apr 17, 2025 · 10:00

City Council Legislative Engagement Committee

Legislative Engagement Committee to discuss legislative priorities

The City Council Legislative Engagement Committee will meet to discuss and possibly act on legislative engagement efforts. The agenda includes a presentation on state/federal legislative priorities, a public comment period, and discussion of future agenda items.

legislative-engagementcity-councilcommittee
1101 Texas Avenue, College Station
Thu Apr 17, 2025 · 17:00

City Council

No substantive business; notice of community events only.

This agenda contains only notices of upcoming community events such as a neighborhood seminar on power, food truck Wednesday, ribbon cuttings, and a household hazardous waste collection. There are no ordinances, resolutions, or public hearings scheduled for this meeting.

community-eventsnotice-only
Tue Apr 15, 2025 · 18:00

Zoning Board of Adjustments

Training session on Zoning Board of Adjustment roles and responsibilities

This meeting is a training session for the Zoning Board of Adjustment, consisting only of a presentation and discussion on the board's role and responsibilities. No votes, public hearings, or decisions are scheduled.

trainingzoning-board-of-adjustmentcollege-stationprocedural
1101 TEXAS AVE, COLLEGE STATION
Mon Apr 14, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to review Active Transportation Master Plan policies

The Bicycle, Pedestrian, and Greenways Advisory Board will discuss policies for the Active Transportation Master Plan and provide feedback for the 2025 Comprehensive Plan evaluation. The board will also review the status of a future trail along the Gulf States utility corridor.

bikingpedestriangreenwaystransportationcity-planning
1101 Texas Avenue, College Station
Fri Apr 11, 2025 · 15:00

City Council

Council agenda lists ribbon cuttings, hotel opening, and small‑area plan meeting

The City Council meeting agenda consists mainly of public notices for community events. Items include ribbon cuttings at De Baca Steakhouse and Brenham National Bank, the grand opening of the Drury Plaza Hotel, and a draft Northgate Small Area Plan to be presented to the committee. No formal council actions or votes are listed.

eventsribbon-cuttinghotelsmall-area-plancommunity
Thu Apr 10, 2025 · 16:00

City Council

Council to vote on $7.87M residential recycling contract

The City Council will hold a first reading of a five-year residential recycling collection franchise agreement with BVR Waste and Recycling for $7,870,060.50. They will also discuss an update on the City Council Strategic Plan, legislative engagement, and the 2024 Existing Conditions Report. Executive session includes litigation, real estate negotiations (including 1508 Harvey Road and 300 acres in Midtown), and economic incentive discussions with Fujifilm Diosynth Biotechnologies and others. Consent items include franchise agreements for commercial recyclables and a records management system upgrade.

city-councilrecyclingfranchise-agreementlitigationreal-estateeconomic-developmenthousinginfrastructure
Tue Apr 8, 2025 · 18:00

Parks & Recreation Board

Board to discuss Parks Master Plan update visioning

The Parks and Recreation Board will hear presentations on the 2025 Comprehensive Plan evaluation and the Parks Master Plan update visioning work session. The board may also approve previous meeting minutes and discuss future agenda items. No votes on substantive policy or funding are expected.

parksrecreationcomprehensive-planmaster-planboard-meetingplanningvisioning
2275 Dartmouth Street, College Station
Mon Apr 7, 2025 · 16:00

Historic Preservation Committee

Historic Preservation Committee to discuss 2025 Comprehensive Plan

The Historic Preservation Committee will meet to review minutes, discuss feedback for the 2025 Comprehensive Plan, and review committee programs and historical projects.

historic-preservationcommitteecomprehensive-planhistoryagenda
1101 Texas Avenue, College Station
Fri Apr 4, 2025 · 17:00

City Council

Council notice lists community events, no business items

This agenda is a procedural notice listing upcoming community events from April 7-13, 2025, such as a student leader dinner, library anniversary, food truck Wednesday, and an Easter celebration. No ordinances, resolutions, contracts, or public hearings are scheduled for council action. The item is purely informational.

community-eventsnoticesprocedural
Thu Apr 3, 2025 · 10:00

City Council Legislative Engagement Committee

Legislative Engagement Committee to hear Texas Municipal League update

The City Council Legislative Engagement Committee will receive a presentation and discuss an update from the Texas Municipal League, followed by a discussion and possible action on broader legislative engagement efforts. The committee may also discuss future agenda items and could convene in executive session on any listed item.

city-councillegislative-engagementtexas-municipal-leaguecommittee-meetingcollege-station
1101 Texas Avenue, College Station
Thu Apr 3, 2025 · 18:00

Planning & Zoning Commission

P&Z to discuss feedback for 2025 Comprehensive Plan 5-Year Evaluation

The Planning and Zoning Commission will consider approving minutes from March 6 and discuss the 2024 Existing Conditions Report. The main item is a presentation and discussion on commissioners' feedback for the 2025 Comprehensive Plan 5-Year Evaluation & Appraisal Report. Informational items include updates on three recently approved rezonings on Knox Drive, Baby Bear Drive, and Deacon Drive West.

planningzoningcomprehensive-plandevelopmentrezoningpublic-commentminutes
1101 TEXAS AVE, COLLEGE STATION
Tue Apr 1, 2025 · 18:00

Zoning Board of Adjustments

Zoning Board to consider height variance for 201 Boyett Street

The Zoning Board of Adjustment will hold a public hearing to discuss a height variance to the Airport Zoning Ordinance. The request concerns a 0.511-acre property located at 201 Boyett Street.

zoningairport-ordinancepublic-hearingvariances
1101 TEXAS AVE, COLLEGE STATION
Fri Mar 28, 2025 · 17:00

City Council

City Council schedules committee meetings and community events for early April

The notice lists several upcoming committee meetings and public events. These include a Northgate Small Area Plan Committee walking tour and a Legislative Affairs Committee meeting.

planninglegislative-affairsnorthgatecommunity-events
Thu Mar 27, 2025 · 16:00

City Council

Council to consider system-wide impact fees for water, wastewater, roadways

The City Council will discuss and possibly take action on system-wide impact fees for water, wastewater, and roadways. A proposed ordinance would establish a pool inspection program administered by the Brazos County Health District. The council will also hold public hearings on three rezonings of Barracks II parcels from Planned Development District to Middle Housing and High Occupancy Overlay. Consent agenda includes contracts totaling $490,400 for water utility and road design, plus a hotel occupancy tax grant of $50,000.

impact-feeszoninghousingwaterwastewaterroadwayspool-inspectionscontracts
Wed Mar 26, 2025 · 15:00

Tourism Advisory Committee

Tourism Committee to appoint vice-chair, set future meeting dates

The College Station Tourism Advisory Committee will meet to appoint a vice-chairperson, discuss future meeting dates, and receive an orientation on committee operations. No major funding or policy decisions are on the agenda; the items are largely organizational.

tourism-committeeappointmentsmeetingscollege-stationprocedural
1207 Texas Ave., College Station
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Adjourn.
8 yea
Greg Stafford yea · Rhianon Elizabeth Whitney yea · Paul Allen Loy yea · Scott Logan yea · Cortney Phillips yea · Connor Clark yea · William L. Peel, Jr. yea · Jim Ross yea
Wed Mar 26, 2025 · 15:30

General

City Transportation Committee to discuss Traffic Calming Program

The Transportation and Mobility Committee will receive a presentation on the City's Traffic Calming Program and consider possible action. Updates will also be provided from the Bicycle, Pedestrian, and Greenways Advisory Board and the Bryan College Station Chamber of Commerce Transportation Committee. The meeting includes public comment and discussion on future agenda items.

transportationtraffic-calmingbicyclespedestriansgreenwayspublic-commentcommittee
1101 Texas Ave, College Station
Tue Mar 25, 2025 · 15:30

City Council

Committee to review FY 2025 budget status and FY26 development

The Budget and Finance Committee will receive presentations and discuss the status of the current FY 2025 Budget and the development of the FY 2026 Budget. Possible action may be taken on the FY 25 Investment Strategy. No specific dollar amounts or project names are included in the agenda.

budgetfinanceinvestment-strategyfiscal-year-2025fiscal-year-2026
Mon Mar 24, 2025 · 15:00

Audit Committee

Audit Committee to discuss FY2025 Audit Plan amendment and HR Audit

The City Council Audit Committee will consider approving minutes from March 6, 2025, and discuss a potential amendment to the Fiscal Year 2025 Audit Plan. They will also review the Human Resources Audit and may take action on both items. Public comments are heard early in the meeting.

audithuman-resourcesfiscal-year-2025committeecollege-station
1101 Texas Ave, College Station
Fri Mar 21, 2025 · 17:00

City Council

Council notice lists events only, no official business

This agenda is a public notice listing community events where a quorum of the City Council may or may not be present. No official council decisions, discussions, or votes are scheduled.

eventspublic-noticecommunity
Thu Mar 20, 2025 · 10:00

City Council Legislative Engagement Committee

Committee to discuss legislative engagement and appoint a chair

The City Council Legislative Engagement Committee will meet to discuss legislative engagement efforts. The committee may also take action to appoint a committee chair.

governmentlegislative-engagementappointments
1101 Texas Avenue, College Station
Mon Mar 17, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to discuss new Active Transportation Master Plan vision and goals

The Bicycle, Pedestrian, and Greenways Advisory Board will review a proposed Community Vision Statement and goals for a new Active Transportation Master Plan. The board will also discuss the 2024 Bicycle Friendly Community Report Card and the 2025 Cycle with Council event.

bikingpedestriansgreenwaystransportation-planningtrails
1101 Texas Avenue, College Station
Fri Mar 14, 2025 · 17:00

City Council

City Council to meet on Northgate Small Area Plan

The City Council is scheduled to meet regarding the Northgate Small Area Plan, focusing on land use, regulations, housing, and retail recruitment. The document also lists several ribbon cuttings and community events.

zoninghousingeconomic-developmentcity-planning
Thu Mar 13, 2025 · 18:00

City Council

City Council to consider audit reports and contract amendments

The City Council will review the annual audit and financial report for fiscal year 2024, and consider contract amendments including a $392,979.47 reduction for LULAC Oak Hill and a $372,532.71 Door Badge Access Replacement contract. The body will also hold a public hearing on vacating a sidewalk easement.

budgetauditcontracteasementpolicypublic-hearing
Tue Mar 11, 2025 · 18:00

General

Parks and Recreation Board to discuss recreation center and baseball field committees

The Parks and Recreation Board will review a Recreation Center Feasibility Study update and the department's purpose statement. The board may take action to appoint steering committee members for the recreation center study and the Veteran's Park Baseball Field Design.

parksrecreationplanningveterans-park
2275 Dartmouth Street, College Station
Fri Mar 7, 2025 · 17:00

City Council

City Council notices for Food Truck Wednesday and BCS Chamber Crawfish Boil

This document serves as a public notice for two upcoming events. No legislative actions, votes, or policy decisions are scheduled for these dates.

public-noticecommunity-events
Thu Mar 6, 2025 · 10:00

City Council Legislative Engagement Committee

Committee to discuss legislative engagement and Texas Municipal League update

The City Council Legislative Engagement Committee will receive an update from the Texas Municipal League. The committee will also discuss and potentially take action on legislative engagement efforts and future agenda items.

legislative-engagementtexas-municipal-leaguecity-council
1101 Texas Avenue, College Station
Thu Mar 6, 2025 · 15:30

Audit Committee

Audit Committee to review 2024 minutes and annual financial reports

The City Council Audit Committee will meet to review the minutes from their December 3, 2024 meeting, discuss the Annual External Audit and Annual Comprehensive Financial Report, and provide an update on the Fiscal Year 2025 Audit Plan.

auditfinancecity-councilmeetingreport
1101 Texas Ave, College Station
Thu Mar 6, 2025 · 18:00

Planning & Zoning Commission

3 rezonings to Middle Housing and High Occupancy Overlay

The Planning and Zoning Commission will hold public hearings on three rezoning requests to change zoning from Planned Development District (PDD) to Middle Housing (MH) with a High Occupancy Overlay (HOO) on properties near Knox Drive, Baby Bear Drive, and Deacon Drive West. The commission may also approve meeting minutes under the consent agenda and receive updates on previously approved items.

zoningpublic-hearinghousingcollege-stationplanning-commissionrezoning
1101 TEXAS AVE, COLLEGE STATION
Mon Mar 3, 2025 · 16:00

General

Historic Preservation Committee to review city markers and historical projects

The Historic Preservation Committee will discuss and potentially take action on several city programs and projects. The meeting includes reports on historical initiatives and the identification of upcoming local historical events.

historic-preservationcity-markersparks-and-recreationlocal-history
1101 Texas Avenue , College Station
Fri Feb 28, 2025 · 17:00

City Council

City Council schedules Northgate Small Area Plan and Legislative meetings

The provided document is a public notice listing scheduled meetings and events for City Council members. It includes a planning meeting for the Northgate area and a Legislative Affairs Committee meeting.

planningtransportationlegislative-affairspublic-notice
Thu Feb 27, 2025 · 15:00

City Council

Council to consider $20M Texas Independence Park project and emergency culvert repairs

The City Council will enter executive session to discuss litigation, real estate deals, personnel evaluations, power supply, and economic incentive negotiations. In open session, they will consider consent items including emergency culvert repairs ($535,675), a fire station HVAC replacement, and a $20M construction contract for Texas Independence Park. Public hearings are scheduled for zoning changes in Glenhaven Estates, McCullough Road, and Southwest Parkway. Workshop items include updates on over-occupancy enforcement and feasibility studies for a recreation center and convention center.

city-councilzoningpublic-hearingbudgetcontractsemergency-repairsparkseconomic-development
Tue Feb 25, 2025 · 15:30

Transportation and Mobility Committee

Committee to discuss transportation goals and TAMU gameday traffic operations

The Transportation and Mobility Committee will discuss upcoming goals and priorities for the coming year, hear a presentation on Texas A&M football gameday traffic operations, and receive updates on TxDOT Highway Safety Improvement Program projects and advisory board activities. The meeting includes public comment and potential discussion on future agenda items.

transportationtrafficsafetybicyclespedestriansfootballtxdot
1101 Texas Ave, College Station
Mon Feb 24, 2025 · 10:00

Comprehensive Plan Evaluation Committee

Committee to review process for 2025 Comprehensive Plan 5-Year Evaluation

The Comprehensive Plan Evaluation Committee will meet to review a proposed process and timeline for the 2025 Comprehensive Plan 5-Year Evaluation. The committee will also discuss and provide feedback on the proposed public participation plan.

city-planningcomprehensive-planpublic-participation
Fri Feb 21, 2025 · 17:00

City Council

Notice of quorum at city events, no actionable agenda

This notice lists several community events (Business Over Breakfast, Community Impact Awards Luncheon, Neighborhood Seminar, CSPD Banquet) where a quorum of the City Council may be present. No items for council decision or discussion are included.

noticeprocedural
Thu Feb 20, 2025 · 10:00

City Council

Council committee to discuss legislative engagement efforts

The City Council Legislative Engagement Committee will meet to present, discuss, and potentially take action regarding legislative engagement efforts.

legislative-engagementcity-council
1101 Texas Avenue, College Station
Thu Feb 20, 2025 · 18:00

Planning & Zoning Commission

Commission will consider waiver and preliminary plan for 41.8‑acre College Station West subdivision

The Planning & Zoning Commission will vote on a waiver request to the Unified Development Ordinance’s geometric standards and on a preliminary plan for the College Station West subdivision (about 41.8 acres at Jones Road and Raymond Stotzer Parkway). The body will also approve the February 6 meeting minutes and review recent public‑engagement results for the Active Transportation Master Plan. Additional informational items include updates on two rezoning projects that were previously recommended and approved by the City Council.

zoningdevelopmenttransportationplanningsubdivisionpublic-engagementwaiver
1101 TEXAS AVE, COLLEGE STATION
Wed Feb 19, 2025 · 08:30

City Council

Council retreat: strategic planning, executive session on litigation, real estate, economic deals

The City Council holds a special retreat meeting to discuss strategic planning in open session, then moves to executive session for closed-door consultations on pending litigation, real estate acquisitions, personnel matters (including city manager evaluation and council self-evaluation), and economic development incentive negotiations. Final actions on any item will be taken in public after the executive session.

city-councilretreatstrategic-planningexecutive-sessionlitigationreal-estatepersonneleconomic-development
800 Krenek Tap Rd., College Station
Tue Feb 18, 2025 · 09:00

City Council

Council will discuss strategic planning and future agenda requests

The City Council held a special retreat meeting on February 18, 2025. Council members will hear a presentation and discuss possible action on strategic planning, sponsored by Bryan Woods. They will also review procedures for placing items on future agendas and the standing list of council‑generated items. No contracts, ordinances, or fee changes are on the agenda.

strategic-planningagendacouncil-proceduresretreatcity-council
800 Krenek Tap Rd., College Station
Fri Feb 14, 2025 · 17:00

City Council

Notice of council attendance at community events, no decisions scheduled

This is a public notice listing community events city council members may attend, including a committee meeting, ribbon cuttings, and a banquet. No ordinances, resolutions, or votes are scheduled. The agenda consists entirely of procedural boilerplate.

eventscommunityribbon-cuttingnotice
Thu Feb 13, 2025 · 16:00

City Council

City Council to consider rezoning and infrastructure contracts

The City Council will discuss several construction contracts and two rezoning requests. The meeting includes an executive session to deliberate on real estate, legal litigation, and economic development agreements.

zoningcontractsinfrastructureeconomic-developmentreal-estate
Tue Feb 11, 2025 · 18:00

General

Parks and Recreation Board discusses park projects and sets March meeting date

The Board will approve minutes from its previous meeting and consider the date for its March meeting. It will present updates on the 2022 Park Bond projects, Texas Independence Park at Midtown, and a baseball field project. The agenda also includes a board overview and discussion of the department’s purpose statement and Chapter Five of the Comprehensive Plan.

parksrecreationbudgetprojectsmeeting-schedule
2275 Dartmouth Street, College Station
Mon Feb 10, 2025 · 15:30

Bicycle, Pedestrian, & Greenways Advisory Board

Board to discuss Active Transportation Master Plan public input

The Bicycle, Pedestrian, and Greenways Advisory Board will hear a recap of public engagement conducted in November and December 2024 for the Active Transportation Master Plan. They will also discuss planning for the Cycle with Council event and other activities for National Bike Month in May. Other items include approving prior meeting minutes and reviewing updates on biking, walking, and greenways projects. The board will also consider its regular meeting schedule and upcoming calendar.

bicyclepedestriangreenwaysactive-transportation-master-plannational-bike-monthpublic-engagement
1101 Texas Avenue, College Station
Fri Feb 7, 2025 · 17:00

City Council

Council attends two ribbon cuttings, no decisions

This notice announces that a quorum of the College Station City Council may attend two ribbon-cutting ceremonies on February 11 and 12, 2025. No official decisions or discussions are listed on the agenda.

ribbon-cuttingeconomic-developmenteventscity-council
Thu Feb 6, 2025 · 17:00

City Council

Council delegation trip to Austin, no formal action

This notice announces a quorum of the College Station City Council may attend the Chamber Austin Delegation Trip on February 10–11, 2025, but no formal votes or decisions are scheduled. The agenda consists entirely of procedural boilerplate and does not include any ordinances, resolutions, or public hearings.

city-councildelegationtravelprocedural
Thu Feb 6, 2025 · 18:00

Planning & Zoning Commission

Planning & Zoning Commission to consider three rezoning and land use requests

The Commission will hold public hearings on three requests to change zoning districts or land use designations. These items are subject to final action by the City Council on February 27, 2025.

zoningland-usepublic-hearingscomprehensive-plan
1101 TEXAS AVE, COLLEGE STATION
Wed Feb 5, 2025 · 15:00

Economic Development Committee

Committee to discuss land purchase and multiple economic development agreements

The Economic Development Committee will consider the minutes from its November 6, 2024 meeting and receive updates on tourism initiatives, the Economic Development Master Plan, and entrepreneurship efforts. In executive session, members may deliberate possible actions on a 300‑acre land purchase in the Midtown Business Park and on three economic development agreements at specific intersections. Any final actions will be taken in the public portion of the meeting.

economic-developmentreal-estateincentivestourismmaster-planentrepreneurship
1207 Texas Ave S, College Station
Mon Feb 3, 2025 · 16:00

General

Historic Preservation Committee reviews sub-committee programs and projects

The committee will discuss and potentially approve previous meeting minutes and take action on sub-committee programs, including the Cemetery Project, Historic Marker Program, Oral History Interviews, Exploring History Lunch Series, Pictorial Book update, American Mile, and Lone Star Legacy Park designation. A report from the Director of Parks and Recreation and identification of upcoming historical activities are also on the agenda.

historic-preservationparks-and-recreationcommittee-meetinghistorycollege-station
300 Krenek Tap Road, College Station
Fri Jan 31, 2025 · 17:00

City Council

City Council posts notices for upcoming committee meetings and events

The provided document is a public notice listing upcoming meetings and events for the City Council and its committees. It does not contain a formal agenda of decisions or legislative actions for a single meeting.

public-noticecity-councilcommitteescommunity-events
Tue Jan 28, 2025 · 14:00

Architectural Advisory Committee

Committee to discuss CSU Operations Expansion and Texas Independence Park projects

The Architectural Advisory Committee will hear presentations and discussions on two projects: the CSU Operations Expansion Project and the Texas Independence Park Project. No votes are scheduled; the items are for discussion only. The committee may also consider placing future items on an upcoming agenda.

architectural-advisory-committeecsu-operations-expansiontexas-independence-parkcollege-stationpresentationsdiscussion
1101 Texas Ave, College Station
Tue Jan 28, 2025 · 18:00

General

Discussion of the Northgate Small Area Plan and community vision

The City Council and/or Planning and Zoning Commission will hold a public meeting to discuss the Northgate planning area and the small area planning process. Attendees will share community ideas and a vision for the Northgate area. No formal decisions are indicated in the agenda.

planningzoningcommunity-engagementnorthgate
1101 Texas Avenue, College Station
Fri Jan 24, 2025 · 17:00

City Council

City Council schedules Northgate Small Area Plan kickoff and capital projects seminar

The City Council has posted a notice for several upcoming events and ribbon cuttings. These include a kickoff meeting for the Northgate Small Area Plan and a seminar regarding 2025 capital projects.

planningcapital-projectseconomic-developmentpublic-meetings
Thu Jan 23, 2025 · 16:00

City Council

Council to consider $14.7M budget amendment

The City Council will hold a public hearing and vote on Budget Amendment Number 1 for $14,718,759 for FY 2024-2025. They will also consider a rezoning of 3.3 acres at Cain Road and Holleman Drive from Rural/Townhouse to General Commercial and Townhouse. Other items include a $3.68M contract for Carter Creek wastewater plant improvements and a $10.96M closeout change order for the cancelled Texas Independence Ballpark project.

budgetzoningwastewaterparkscontractspublic-hearinginfrastructure
Thu Jan 16, 2025 · 17:00

City Council

Notice of upcoming city events, no council decisions

This agenda is a public notice listing community events such as the MLK Freedom March, ribbon cuttings, a planning kickoff, and a ground breaking. No ordinances, resolutions, or public hearings are scheduled for City Council action.

eventspublic-noticecommunity
Thu Jan 16, 2025 · 18:00

Planning & Zoning Commission

Planning & Zoning Commission to consider four land-use and zoning changes

The Commission will hold public hearings on several requests to change land use and zoning designations. The body will also discuss appointments for the BioCorridor Board and the Comprehensive Plan Evaluation Committee.

zoningland-usepublic-hearingsplanning
1101 TEXAS AVE, COLLEGE STATION
Fri Jan 10, 2025 · 17:00

City Council

Council notice lists upcoming events, no decisions

This is a public notice from the College Station City Council listing several upcoming events and meetings, not a meeting agenda with items for council decision. Events include a subregional meeting, legislative update, two ribbon cuttings, and the annual MLK celebration. No ordinances, contracts, or votes are scheduled.

eventspublic-noticeribbon-cuttingmlk-celebrationcity-council
Thu Jan 9, 2025 · 16:00

General

City Council to consider $13 million land sale to Capstone in Midtown Business Park

The council will review several executive‑session matters and then move to open‑session items. Consent agenda items include minutes, a fuel contract up to $2.5 million, and a $250,000 funding agreement for Plug and Play. Regular agenda items cover a rezoning of 2.018 acres at 550 Fraternity Row, the Capstone land sale for $13 million, and a resolution authorizing eminent‑domain for a 1.113‑acre easement for the Water Well 10 project.

zoningreal-estatebudgethousinginfrastructureeconomic-developmentcontracts
Tue Jan 7, 2025 · 18:00

Zoning Board of Adjustments

Zoning Board to consider two variance requests at Guernsey and Suffolk streets

The Zoning Board of Adjustment will hold public hearings and consider two variance requests. One request is for a rear setback variance and a variance to the maximum size of an accessory structure at 600 Guernsey Street. The other is for a rear setback variance at 200 Suffolk Avenue. Both properties are zoned GS General Suburban with NCO Neighborhood Conservation Overlay.

zoningvarianceboard-of-adjustmentpublic-hearingcollege-stationguernsey-streetsuffolk-avenue
1101 Texas Avenue
Fri Jan 3, 2025 · 16:00

City Council

Council notice lists community events, no official business

This agenda is a public notice of several upcoming community events, not a regular city council business meeting. No decisions, ordinances, or discussions are scheduled.

eventscommunityribbon-cuttingmuseumopen-house
Thu Jan 2, 2025 · 18:00

Planning & Zoning Commission

Commission to consider rezoning 2.018 acres at 550 Fraternity Row to Multi-Family

The Planning and Zoning Commission will hold a public hearing and consider an ordinance to rezone approximately 2.018 acres at 550 Fraternity Row from R-4 Multi-Family to MF Multi-Family. The item will then go to City Council on January 9, 2025. The meeting also includes approval of previous meeting minutes, discussion of new development applications, and an update on previously approved items.

zoningpublic-hearingrezoningmulti-familycollege-stationplanning-commission
1101 TEXAS AVE, COLLEGE STATION