The Boring PartsFederalLocal · USLocal · Canada
Coventry, CT

Coventry public meetings in 2025

325 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 22, 2025

Town Council

Town Council Steering Committee to discuss firearms and parks ordinances

The Town Council Steering Committee will consider several board appointments and potential ordinance changes. The meeting includes discussions on firearms safety and home shooting ranges, as well as updates to the Parks and Recreation Commission ordinance.

ordinancesappointmentsfirearms-safetyparks-and-recreationveterans-benefitssenior-services
✓ Decided: Town Council unanimously approves multiple commission appointments

The council accepted the November 24 minutes without amendment. It unanimously recommended and approved appointments to the Conservation Commission, Human Rights Commission, Pension & Retirement Committee, and Veterans Memorial & Events Commission. Several Parks & Recreation Commission appointments were continued to the next meeting. No other substantive actions were decided.

Thu Dec 18, 2025

Cemetery Commission

Commission to consider lot and interment price increases

The Coventry Cemetery Commission will review minutes and financial statements, hear reports from Public Works and Sexton, and discuss old business items including implementing previously approved lot price increases, a proposed interment price increase, and upcoming capital project proposals. New business will cover winter activity goals and a wreaths ceremony. An executive session may be held if needed.

cemeterypricingfinanceprojectscommunity
Thu Dec 18, 2025

Charter Revision Commission

Charter Revision Commission reviews draft charter revisions

The Charter Revision Commission will approve the minutes from its December 3, 2025 meeting, discuss input from the town registrar and town clerk, and review changes to the town charter, including Chapter V and Chapter VI, using the current charter and Draft Charter Revision V2 documents. The commission will also plan future meetings and address any other business.

charter-revisiontown-governmentmeetingpolicy
✓ Decided: Charter Revision Commission unanimously swaps Chapters V and VI

The commission approved the December 3 minutes unanimously and moved agenda items 3 and 4 to a later meeting. It voted unanimously to swap Chapter V (Appointed Offices) with Chapter VI (Town Manager) in the charter draft. The commission also agreed to edit Section 3‑1 using the attorney’s language, to delete Section 5‑1A and add a hiring statement to Section 5‑1, and to relocate the Planning and Zoning subsection to Section 5‑4.

Wed Dec 17, 2025

Senior and Affordable Housing Alternatives Study Committee

Special meeting on senior & affordable housing alternatives cancelled

The Senior & Affordable Housing Alternatives Study Committee's special meeting scheduled for December 17, 2025 was cancelled. No agenda items were decided or discussed. The next regular meeting is set for January 28, 2026.

senior-housingaffordable-housinghousing-studycancellation
Wed Dec 17, 2025

Inland Wetlands Agency

Inland Wetlands Agency reviews water circulator for Patriots Park

The Inland Wetlands Agency will review several permit applications for residential and municipal projects. The body will also address an enforcement case regarding material deposition at 77 Tall Oak Drive.

wetlandszoningenvironmentconstructionmunicipal-projects
✓ Decided: Commission discussed Patriots Park water aerator; no actions approved

The Inland Wetlands Agency reviewed the WP-25-30 water aerator proposal for Patriots Park, including design details, grant funding, and health monitoring data. Commissioners raised concerns about testing scope, geese management, and potential impacts on other lake areas. No formal approvals, denials, or votes were recorded.

Wed Dec 17, 2025

America 250 | Coventry CT Committee

Special meeting to discuss community events and 2026 plans

The Coventry Committee will review several old‑business items, including the Lions Club Christmas Tree, Christmas in the Village, the 2026 Kid Governor program, and an invitation to Prince William. New business will cover upcoming 2026 events, talks, and coordination among town departments and community groups. No formal decisions are noted on the agenda.

communityeventsplanningpublic‑forum
✓ Decided: Committee unanimously approved minutes and adjourned the meeting

The committee voted to accept the previous meeting minutes, which passed unanimously. A motion to adjourn the meeting was also passed unanimously. No other actions were decided.

Tue Dec 16, 2025

Zoning Board of Appeals

Zoning Board of Appeals to hold executive session on pending appeal

The Zoning Board of Appeals will meet to discuss a pending appeal of a previous decision in executive session. A scheduled public hearing for a variance at 710 Goose Lane has been postponed to January 20.

zoningvariancespublic-hearingsappeals
✓ Decided: Board approved November minutes and postponed a variance request

The Zoning Board of Appeals approved the November 18, 2025 special meeting minutes with corrections by a 5‑0‑0 vote. The board postponed the variance request ZBA-25-17 for 710 Goose Lane to the January 20, 2026 meeting. Handbooks for new members were distributed and a training session was scheduled for January 20, 2026. The meeting was adjourned by a 5‑0‑0 motion.

Mon Dec 15, 2025

Town Council

Coventry council to vote on bond projects and council goals

The Coventry Town Council will consider selecting projects for a bond referendum and setting goals for 2025-2027. The meeting also includes the ratification of the Town Manager's appointment of the Finance Director as Acting Deputy Town Manager.

town-councilbondinggoalsappointmentsminutescoventryct
✓ Decided: Town Council approved meeting minutes and consent agenda

The council voted to accept the December 1, 2025 meeting minutes. They also approved the consent agenda items in a single motion. Both actions passed unanimously.

Thu Dec 11, 2025

Board of Assessment Appeals

Board of Assessment Appeals to elect officers and set 2026 schedule

The Board of Assessment Appeals will meet to conduct internal organizational business. The agenda focuses on electing a Chairman and Secretary and establishing the meeting calendar for 2026.

board-administrationschedulinggovernance
✓ Decided: Board approves minutes, elects chair & secretary, and sets 2026 meeting schedule

The Board of Assessment Appeals approved the September 18, 2025 meeting minutes. Carolyn Arabolos was elected chair and Carolyn Gerrity elected secretary, each unanimously. The Board adopted the 2026 dates for real estate, personal property, and motor vehicle appeals, and scheduled a training session for January 7, 2027. All motions passed with all members in favor.

Thu Dec 11, 2025

Parks & Recreation Commission

Commission will decide 2026 meeting dates for Parks & Recreation

The Coventry Parks & Recreation Commission will meet on December 11, 2025. The commission will review an update on the Patriots Park STEAP project and discuss several community topics, including Lisicke Beach, the Coventry Lake Foundation, Music in the Park, and bandshell improvements. The body will also take action to set the dates for its 2026 meetings. No decisions are recorded for the discussion items at this time.

parksrecreationprojectsmeetingscommunity
✓ Decided: Commission approved 2026 meeting schedule, removing Dec 10 date

The commission voted to approve the November 13, 2025 minutes at the January 8, 2026 meeting. A motion moved the Coventry Lake Foundation discussion up on the agenda and was adopted. The commission accepted the listed 2026 meeting dates and removed the December 10, 2026 meeting.

Thu Dec 11, 2025

Water Pollution Control Authority

WPCA to discuss 2026-2027 budget and sewer use fees

The Water Pollution Control Authority will meet to approve minutes from November 2025 and discuss the Fiscal Year 2026-2027 Budget and Sewer Use Fees. The meeting will be held via Zoom on December 11, 2025.

watersewerbudgetfeeszoom
✓ Decided: WPCA approved prior meeting minutes and set a 5% sewer fee increase

The Water Pollution Control Authority approved the minutes from the November 13, 2025 meeting. Members voted to adopt the minutes with three votes in favor and one abstention. The board discussed the FY27 budget and agreed that a 5% increase in sewer use fees will be sufficient. No other formal actions were recorded.

Thu Dec 11, 2025

Water Pollution Control Authority

Public scoping meeting for Coventry Water Pollution Control Facility upgrade

The Water Pollution Control Authority is holding a public scoping meeting to discuss the Coventry Water Pollution Control Facility upgrade. The session includes overviews of the project and the Connecticut Environmental Policy Act (CEPA) process.

water-pollutioninfrastructureenvironmental-policypublic-hearing
✓ Decided: WPCA holds CEPA public scoping meeting on wastewater facility upgrade

The Water Pollution Control Authority met on Dec 11, 2025 to conduct a CEPA public‑scoping session for the proposed upgrade of the town’s wastewater treatment facility. Presentations described two alternatives – expanding the existing plant to 266,000 GPD with surface discharge, or converting to a pump station sending wastewater to Windham’s plant – and outlined the next steps for an Environmental Impact Evaluation. No formal decisions, approvals, or votes were taken; the meeting was informational and open for public comment.

Tue Dec 9, 2025

Housing Authority

Housing Authority to discuss senior housing expansion and solar contracts

The Housing Authority will meet to discuss expanding affordable senior housing at Orchard Hill Estates, review solar and GreenBank contracts, and set 2026 meeting dates.

housingsenior-housingsolarbudgetcoventry
✓ Decided: Housing Authority unanimously approves CT Greenbank solar lease contract

The board approved the October and November treasurer's reports and the October and November expenditures, both unanimously. It also approved the CT Greenbank solar lease as revised by David Hoopes with a unanimous vote. The 2026 meeting dates (second Tuesday of each month) and a motion to add a review of expenditures to the agenda were likewise approved unanimously. No other business was taken up.

Tue Dec 9, 2025

Inland Wetlands Agency

Low Impact Development Work Group to discuss policy and educational outreach

The Inland Wetlands Agency Low Impact Development Work Group is meeting to review a draft LID policy and resolution. The group will also discuss educational initiatives, including a sustainable landscape workshop and a town newsletter article.

wetlandsenvironmental-policyeducationwater-qualityland-use
✓ Decided: No formal approvals or votes were made at the IWA LID Work Group meeting

The December 9, 2025 meeting of the Coventry Inland Wetlands Agency Low Impact Development Work Group discussed draft policies, lake protection documents, and upcoming workshops. Members were assigned several follow‑up tasks, including circulating drafts and exploring a Lake Smart program. Future meeting dates were scheduled, but no formal decisions or votes were recorded.

Mon Dec 8, 2025

Coventry Lake Advisory & Monitoring Committee

Committee will approve 2026 meeting schedule and elect officers

The Coventry Lake Advisory & Monitoring Committee will meet on December 8, 2025 to consider approving the 2026 meeting schedule and electing officers for 2026. The committee will also receive an update on hydrilla management and a report on the Green Valley eagle count from January 2026. All items are on the agenda for this regular meeting held at Town Hall Conference Room D.

lake-managementenvironmentmeetingscheduleelections
✓ Decided: Committee approved meeting minutes, set 2026 schedule, elected officers

The committee approved the September 8, 2025 and October 21, 2025 meeting minutes. Members confirmed the 2026 regular‑meeting calendar for the second Monday each month. Charles Brown was elected Chair and Richard Pearson was elected Secretary (Pearson abstained). The committee also agreed to support the May 16, 2026 “Using Plants to Protect Our Water” workshop.

Mon Dec 8, 2025

Planning & Zoning Commission

Commission to hold hearing on farm expansion at 89 Flanders Road

The Planning and Zoning Commission will hold a public hearing and discuss a special permit for a non-conforming use and retail nursery at 89 Flanders Road. The body will also review a bridge replacement referral and a subdivision filing extension.

zoningland-useagricultureinfrastructuresubdivision
✓ Decided: Commission approved replacement of Bunker Hill Road bridge over Rufus Brook

The Planning & Zoning Commission approved the replacement of the Bunker Hill Road bridge over Rufus Brook, with the motion carried (vote tally recorded as X:X:X). It also adopted zoning regulation language changes for two‑family dwellings and set their effective date as January 1 2026. The commission extended the filing deadline for the Charlie Brown subdivision to April 1 2026 and continued the public hearing on the special permit for 89 Flanders Road to the January 12 2026 meeting. Minutes from the November 24 2025 meeting were approved with one abstention.

Mon Dec 8, 2025

Town Council

Review of future bonding projects and Capital Improvement Plan for FY2027-2031

The joint Finance Committee and Board of Education Fiscal Committee will discuss shared services, the health‑insurance renewal timeline, and the draft Capital Improvement Plan for FY 2027‑2031. They will review the FY 2025‑26 Board of Education budget drivers and the status of the FY 2024‑25 audit and auditor RFP. The committee will also consider items for future bonding projects. No formal decisions are noted in the agenda.

financeeducationbudgetbondingshared-serviceshealth-insurance
✓ Decided: Council finance meeting discussed shared services and upcoming health‑insurance review

The joint Town Council Finance Committee and Board of Education Fiscal Committee meeting reviewed shared service items, including janitorial services and utility contract bidding. They discussed the timeline for a health‑insurance presentation by USI and the need for BOE notification of contracts. Updates on the BOE CIP priorities, special education budget concerns, and the status of the FY 24/25 audit and upcoming auditor RFP were provided. No formal approvals, denials, or votes were recorded.

Thu Dec 4, 2025

Board of Assessment Appeals

Board of Assessment Appeals to elect officers and set 2026 meeting dates

The Board of Assessment Appeals will meet to approve previous minutes and elect a Chairman and Secretary. The body will also establish its meeting schedule for 2026.

board-of-assessment-appealsadministrationscheduling
Thu Dec 4, 2025

Economic Development Commission

Economic Development Commission to review events procedures and business visits

The Coventry Economic Development Commission will hold a special meeting to review draft procedures for events, discuss business visitations, and review meeting dates for 2026. The body will also receive updates on social media, CT Countryside, and the Farmers' Market.

economic-developmentbusinesseventssocial-mediaagriculture
Thu Dec 4, 2025

Local Emergency Coordinating Committee

Coventry Local Emergency Coordinating Committee to debrief Veterans Day Road Race

The committee will meet to review agency updates and discuss local traffic authority items. The agenda includes a debrief of the November 8, 2025, Veterans Day Road Race and coordination for Christmas in the Village on December 7, 2025.

public-safetytrafficcommunity-events
✓ Decided: LECC approves Christmas in the Village traffic plan with cones and barricades

The Local Emergency Coordinating Committee met on December 4, 2025, and approved the existing traffic and parking plans for the upcoming Christmas in the Village event, with additional cone placements to block roads near food trucks. The committee also discussed the Veterans Day Road Race debrief, noting a record number of runners and considering one-way traffic for next year. Agency updates were provided, including police statistics, fire department equipment issues, and winter preparedness.

Thu Dec 4, 2025

School Energy & Building Efficiency Building Committee

Committee reviews HVAC, roof and payment items for school building projects

The School Energy and Building Efficiency Building Committee will approve the October 2, 2025 meeting minutes and examine financial statements for bonded HVAC projects. It will discuss the CHS roof project, the unit ventilator/HVAC project, and review recent payment applications and invoices. The meeting also includes a proposal for the 2026 meeting schedule.

school-energyhvacroofbudgetconstructionpayment
✓ Decided: Committee approves $204K in HVAC and engineering payments

The School Energy and Building Efficiency Building Committee approved four payments totaling $204,494.13 for the CHS HVAC and roof projects, including Pro-Mech applications 20 and 21, an ICDS engineering invoice, and a QA+M inspection invoice. The committee also approved the October 2, 2025 meeting minutes and the 2026 meeting schedule, which moves the January meeting to January 5 due to New Year's Day. The HVAC project remains in a holding pattern for air conditioning testing until warmer weather, with a requested extension through July.

Wed Dec 3, 2025

Conservation Commission

Coventry Conservation Commission meeting cancelled for December 3, 2025

The regularly scheduled meeting of the Coventry Conservation Commission for December 3, 2025, has been cancelled. The next regular meeting is scheduled for January 7, 2026.

conservationmeeting-cancellation
Wed Dec 3, 2025

Charter Revision Commission

Coventry Charter Revision Commission meets to discuss draft revisions

The Charter Revision Commission will review draft changes and discuss specific chapters of the town charter. The body will also approve prior meeting minutes and plan future sessions with town staff.

charter-revisiongovernmentcoventrytown-hallzoningpublic-hearing
✓ Decided: Commission moved agenda item 8 forward and approved prior meeting minutes

The Charter Revision Commission unanimously approved the minutes from the October 1, October 23 and November 20 meetings. A motion to place agenda item 8 (Planning of Meetings and Discussion of Charter With Town Staff) immediately after agenda item 4 was also passed unanimously. The commission agreed to capitalize all defined terms in the charter and to keep the planning‑of‑meetings item as a recurring agenda item. Additional staff, including the Registrar of Voters and the Town Clerk, were scheduled to attend upcoming meetings.

Mon Dec 1, 2025

Town Council

Town Council will consider a special session on housing and firefighter cancer relief

The Coventry Town Council meeting will accept the November 17, 2025 minutes and review project updates. Unfinished business includes an update from the Registrar of Voters on elections and department matters. New business items are a Board of Education correspondence, a daycare property tax abatement, a federal shutdown update, and a special session on housing and firefighter cancer relief.

housingfirefighter-healthtax-abatementeducationelections
✓ Decided: Council accepted November minutes, approved consent agenda, removed item 9.C

The Town Council accepted the November 17, 2025 meeting minutes after minor wording edits. They approved the consent agenda and, at the request of a member, removed item 9.C for brief discussion. All votes were unanimous with every member voting for and none against or abstaining.

Mon Nov 24, 2025

Town Council

Council will discuss firearms and parks ordinances and veterans tax exemption

The Town Council Steering Committee will accept the October 27, 2025 minutes and hear monthly board and commission reports. Members will discuss a proposed firearms ordinance prepared by the Firearms Safety/Home Shooting Range Study Committee. They will also discuss changes to the Parks and Recreation Commission ordinance. A possible action on expanding veterans residential property tax exemptions will be considered, though it is not ready for action.

firearmsparksrecreationveteranstaxordinancecouncil
✓ Decided: Council unanimously accepted October 27 minutes; no other actions taken

The Town Council Steering Committee accepted the minutes from the October 27, 2025 meeting by a unanimous vote. No appointments, ordinances, or other substantive measures were approved, denied, or tabled during this session.

Mon Nov 24, 2025

Planning & Zoning Commission

Commission will discuss recent ZBA action in an executive session

The Coventry Planning and Zoning Commission will meet on November 24, 2025 at Town Hall Annex. During the meeting, the commission will hold an executive‑session discussion of a recent Zoning Board of Appeals action. The commission will also consider a potential motion before adjourning.

zoninggovernmentmeetings
Mon Nov 24, 2025

Planning & Zoning Commission

Commission to consider zoning changes for two-family dwellings

The Planning and Zoning Commission will hold a public hearing and discuss modifications to zoning regulations regarding two-family dwellings. The body will also consider a special permit for a farm and retail nursery expansion.

zoninghousingagricultureland-use
✓ Decided: Commission approved two‑family dwelling zoning changes and appealed a variance

The Planning & Zoning Commission voted 5‑0‑0 to approve amendments to the zoning regulations for two‑family dwellings, aligning them with the Affordable Housing Plan. It also voted 4‑0‑1 to appeal the variance granted by the Zoning Board of Appeals on November 18, 2025. A special‑permit hearing for a farm property at 89 Flanders Road was scheduled for December 8, 2025. No other substantive actions were taken.

Thu Nov 20, 2025

Inland Wetlands Agency

Discussion of Columbia Watershed Protection measures

The Coventry Inland Wetland Agency Low Impact Development Work Group will meet with the Town of Columbia to review watershed protection measures. Participants will outline the work group's actions and explore future collaboration. No formal decisions or votes are scheduled for this meeting.

wetlandsenvironmentwatershedcollaborationdevelopment
✓ Decided: No formal decisions; tasks assigned for Columbia Lake management

The Inland Wetlands Agency meeting reviewed the Columbia Lake Management Plan, recent lake surveys, and nutrient allocation strategies. No votes or formal approvals were recorded. The agency assigned follow‑up actions: Columbia will send the nutrient regulation and current POCD, and the LID will invite residents to a May 16, 2026 water‑quality workshop, issue a Save‑the‑Date flyer, and consider a UConn internship for LID tracking.

Thu Nov 20, 2025

Cemetery Commission

Cemetery commission to vote on price increases and clean-up schedule

The Coventry Cemetery Commission will review and vote on proposals to increase lot and interment prices, select locations for a sycamore planting, and schedule a clean-up for Wreaths Across America. The meeting will also include a public works report and a sexton's report.

cemeterybudgetprice-increasepublic-hearingwreaths-across-america
✓ Decided: Cemetery commission approved lot price increase and discounts (3‑0)

The commission approved the minutes from the August, September and October meetings unanimously. It voted 3‑0 to send a draft letter to the Mansfield family about their Grant Hill Cemetery lot. The commission also approved a lot‑price increase, adding a 50 % discount for infants, keeping the veteran discount and removing the lower‑cost tier, with the changes to take effect after town‑manager notification and website update. Additionally, members voted 3‑0 to set aside $30,000 from Fund 202 and Trust 613 for a potential Rock of Ages columbarium project pending further approval.

Thu Nov 20, 2025

Charter Revision Commission

Coventry commission holds public hearing on initial charter revision

The Charter Revision Commission will hold a public hearing to gather initial comments and recommendations for revising the Coventry Town Charter. The meeting will also include a review of the current charter's chapters.

charter-revisioncoventrypublic-hearingtown-hallgovernance
✓ Decided: Commission unanimously reopened then closed the public hearing

The Charter Revision Commission voted to reopen the public hearing at 6:52 PM to hear a citizen who missed the earlier session; the motion was passed unanimously. Later, the commission voted to close the public hearing for the remainder of the meeting at 6:55 PM, also passing unanimously.

Wed Nov 19, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee to discuss Orchard Hills Estate and two-family housing regulations

The Senior and Affordable Housing Alternatives Study Committee will meet to review project updates and housing regulations. The body will also discuss providing affordable housing information on the website.

affordable-housingsenior-housingzoninghousing-regulations
✓ Decided: Committee unanimously approved prior minutes and 2026 meeting dates

The committee approved the minutes from the October 29 site walk and the September 24 regular meeting, each with unanimous support. A motion to adopt the 2026 meeting schedule was also passed unanimously. No other formal votes were taken; remaining agenda items were discussed and assigned for follow‑up.

Wed Nov 19, 2025

Inland Wetlands Agency

✓ Decided: Restoration of 77 Tall Oak Drive vernal pool to be completed by Dec 17 2025

The Inland Wetlands Agency set a Phase 1 restoration deadline of December 17, 2025 for the vernal pool at 77 Tall Oak Drive, with construction slated for November 20‑21, 2025. The WP‑25‑30 application for a surface‑water circulator at Patriots Park was continued to the December 17, 2025 meeting. For the proposed garage at 167 Geraldine Drive (WP‑25‑32), the commission required a new site plan, an encroachment permit and a construction sequence. For the demolition at 152 Cheney Lane (WP‑25‑33), the commission requested a remedial action plan for the existing 275‑gallon above‑ground storage tank.

Tue Nov 18, 2025

Housing Authority

Housing Authority to consider expanding affordable senior housing at Orchard Hill Estates

The Coventry Housing Authority will hear a presentation by Jana Roberson and Robin Newton on an ad‑hoc study committee examining options to expand affordable senior housing at Orchard Hill Estates. The board will also review the Solar and CT GreenBank contract, set meeting dates for 2026, and consider the director’s report and expenditure approvals. Standard items such as approval of minutes, correspondence, and the treasurer’s report are also on the agenda.

housingsenior-housingaffordable-housingcontractsbudgetmeeting-schedule
Tue Nov 18, 2025

Zoning Board of Appeals

ZBA will hear four variance requests for lot and setback changes

The Coventry Zoning Board of Appeals will hold public hearings on four variance applications. The requests involve lot line modifications, creation of a non‑conforming lot, a rear deck setback, and multiple setbacks for poultry structures at specific addresses. The board will also consider approving the 2026 meeting schedule and the minutes from the September 16, 2025 meeting.

zoningvariancesland-usepublic-hearingsmeeting-schedule
✓ Decided: ZBA elects new officers and approves Pine Lake Drive lot line variance

The Zoning Board of Appeals unanimously elected William Zenko as Chair, Mike Gerrity as Vice Chair, and Caroline Dowd as Secretary. The board approved variance ZBA-25-15 to adjust the lot line between 44 and 66 Pine Lake Drive with a 5‑0 vote. A second variance request (ZBA-25-16) was discussed but no decision was made.

Tue Nov 18, 2025

Housing Authority

Housing Authority to discuss expanding affordable senior housing at Orchard Hill Estates

The Housing Authority will hear a presentation from the Adhoc Senior and Affordable Housing Alternatives Study Committee. The body will also review a solar and CT Greenbank contract and approve expenditures.

affordable-housingsenior-housingsolarbudget
Mon Nov 17, 2025

Town Council

Town Council will vote on establishing a Charter Revision Commission

The Coventry Town Council meeting will consider a resolution to create a Charter Revision Commission. The council will also receive updates from the Registrar of Voters and approve an amended 2026 meeting schedule. Additional items include Board of Education minutes, October police and fire statistics, and public‑hearing documents on Mansfield zoning amendments.

charterelectionsscheduleeducationpublic-safetyzoning
✓ Decided: Council approves water tower site fund shift, accepts prior minutes

The Town Council accepted the November 3 and November 5 meeting minutes and approved the consent agenda. Council members voted unanimously to reallocate previously approved funds for the Coventry Village Water Tower preliminary engineering to focus on the Stonehouse Road site. The Council also approved funding for easements related to the Main Street pedestrian crosswalk project. No other substantive motions were decided at this meeting.

Thu Nov 13, 2025

Parks & Recreation Commission

Parks & Recreation Commission to review Patriots Park STEAP project

The Parks & Recreation Commission will meet to receive staff reports on facilities and programs. The commission will also receive an update on the Patriots Park STEAP Project.

parksrecreationinfrastructure
✓ Decided: Commission added Lisicke Beach maintenance and lake foundation topics to Dec 11 agenda

The commission voted to place a discussion on Lisicke Beach maintenance on the December 11 agenda. It also added Dan Eddy’s email about the Coventry Lake Aquatics Foundation to that agenda. The October 9 and October 15 meeting minutes were accepted with requested edits. A motion to discuss Patriots Park Bandshell updates at the December 11 meeting was also approved.

Thu Nov 13, 2025

Water Pollution Control Authority

WPCA to discuss FY 2027 budgets and sewer use increases

The Water Pollution Control Authority is meeting to discuss proposed FY 2027 budgets and an increase in sewer use. The body will also review sewer system capacity and receive updates on the Western Route 44 Sewer Project.

sewerbudgetwater-pollutioninfrastructure
✓ Decided: WPCA denies sewer capacity request for lot 239 Daly Rd

The Authority denied the sewer capacity request for the vacant lot at 239 Daly Road, telling the applicant to re‑apply in 6‑12 months. The board approved the minutes from the October 9, 2025 meeting with a 3‑0 vote. Members directed staff to add a new FY27 capital improvement project for major material removal and replacement in the infiltration basins. No final decision was made on FY27 sewer use fees or the Lake Street facility rate.

Wed Nov 12, 2025

Inland Wetlands Agency

Inland Wetlands Agency LID Work Group meeting cancelled

The Coventry Inland Wetland Agency Low Impact Development Work Group meeting scheduled for November 12, 2025 was cancelled. No agenda items were discussed or decided.

wetlandsenvironmentplanning
Mon Nov 10, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Advisory & Monitoring Committee meeting cancelled

The Coventry Lake Advisory & Monitoring Committee meeting scheduled for November 10, 2025, is cancelled.

lake-monitoringmeeting-cancelled
Mon Nov 10, 2025

Planning & Zoning Commission

PZC to consider condo development and zoning regulation changes

The Coventry Planning and Zoning Commission will hold a public hearing on a special permit for a 29-unit condominium development on Boston Turnpike and propose amendments to zoning regulations regarding two-family dwellings.

zoninghousingpublic-hearingcondominiumregulationfarmingplanning
✓ Decided: Commission approved special permit for 29‑unit condo development on Boston Turnpike

The Planning & Zoning Commission voted 3‑2 to approve the special permit (PZC‑25‑15) for a 29‑unit, nine‑building condominium project on 15.51 acres south of the Boston Turnpike. The commission also unanimously approved the 2026 regular meeting schedule and accepted the October 27, 2025 minutes. An application for a non‑conforming farm use at 89 Flanders Road was acknowledged but will wait on a ZBA decision, and a zoning‑regulation amendment (PZC‑25‑11) was continued to the November 24 meeting.

Mon Nov 10, 2025

Town Council

Town Council Finance Committee to review proposed bond projects

The Town Council Finance Committee will meet to discuss financial reports and capital spending policies. The committee will also consider and possibly act on a review of items for future bonding.

financebondingcapital-spendingbudget
✓ Decided: Finance Committee removed $62,000 fire pump from bond proposal

The committee voted to continue reviewing the monthly financial reports after a member was absent. It decided to drop the $62,000 fire pump from the upcoming bond package and to add the item to the December Joint Fiscal agenda. Members agreed to move forward with two separate bond referendums—one for fire/safety and one for road projects—as soon as feasible. The committee also asked the Town Manager to update project cost estimates and check for any grant opportunities.

Thu Nov 6, 2025

Planning & Zoning Commission

Commission to conduct site walk for proposed 29-unit condominium development

The Planning and Zoning Commission is holding a special meeting for a site walk. The visit concerns a special permit application for a residential development on Boston Turnpike.

zoninghousingcondominiumssite-walk
Thu Nov 6, 2025

Local Emergency Coordinating Committee

Coventry Local Emergency Coordinating Committee to review event debriefs and 2026 schedule

The committee will discuss agency updates and debrief the Halloween on Main event. Members will also consider the 2026 meeting schedule and items from the Local Traffic Authority.

public-safetyemergency-managementcommunity-eventstraffic
✓ Decided: Committee adopts 2026 meeting schedule and accepts prior minutes

The Local Emergency Coordinating Committee unanimously accepted the minutes from the October 2, 2025 meeting. The draft schedule for 2026 meetings was adopted by consensus. The meeting was then adjourned unanimously.

Thu Nov 6, 2025

School Energy & Building Efficiency Building Committee

School Energy & Building Efficiency Building Committee meeting cancelled

The regular meeting scheduled for November 6, 2025, was cancelled due to a lack of quorum.

school-facilitiesenergy-efficiencycancelled-meeting
Wed Nov 5, 2025

Conservation Commission

Commission will discuss new Vernal Pool Mapping project.

The Conservation Commission will review the October 1, 2025 minutes and a financial report showing $2,952.67 remaining in its budget. It will consider new‑business items such as a Vernal Pool mapping project, plans for Mill Brook Park, scheduling for 2026 meetings, and adding picnic tables. The commission will also revisit old‑business topics including the Patriots Park Woods Trail, the Rose Williams property, and the Nip Bottle Money issue.

conservationparksbudgetplanningpublic-engagement
✓ Decided: Commission approved 2026 meeting schedule and accepted minutes

The commission unanimously accepted the November 4 minutes. They also unanimously approved the schedule of commission meetings for 2026. A motion was made to purchase 20 composting containers, but the minutes do not record a vote outcome. The meeting was adjourned by unanimous vote.

Wed Nov 5, 2025

Energy Conservation / Alternative Energy Advisory Committee

Committee will vote to approve October 1 meeting minutes

The Energy Conservation/Alternative Energy Advisory Committee will meet on November 5, 2025 at 6:30 p.m. via Zoom. The agenda lists routine items: call to order, audience of citizens, approval of the October 1 minutes, and discussion of old and new business. No specific policy proposals or contracts are detailed. The meeting will end with adjournment.

energy-conservationalternative-energymeetingminutes
Wed Nov 5, 2025

Town Council

Coventry Town Council holds inauguration meeting

The Town Council will swear in new members and appoint a Chairperson, officers, and committees. The body will also vote on resolutions regarding the 2026 meeting schedule and standing rules of procedure.

governmentappointmentsprocedure
✓ Decided: Council adopts meeting schedule and standing rules, appoints officers

The Town Council adopted Resolution 2025-13 to set regular monthly meeting times and the process for special meetings. It also adopted the Standing Rules of Procedure unchanged from the prior term. New officers were appointed, including Chairwoman Lisa Thomas, Vice Chairman Peter Larson, and Secretary Matthew Kyer, and committee chairs were confirmed.

Mon Nov 3, 2025

Town Council

Council to clarify CNREF funding use for water tower engineering

The Coventry Town Council will discuss several new business items, including a presentation on the 2025 Summer Camp and an update on the Coventry Farmers’ Market. Council members will consider allocating NIP funds toward recycling equipment and community recycling/pollution education. They will also consider clarifying the use of CNREF funds allocated for preliminary engineering of the town's water tower project.

recyclingwaterfundingsummer-campfarmers-markettown-council
✓ Decided: Town Council appointed five members to various committees

The council accepted the October 20, 2025 meeting minutes and the consent agenda. It also approved appointments to the Senior and Affordable Housing Alternatives Study Committee, Cemetery Commission, Coventry Housing Authority, and two seats on the Planning & Zoning Commission.

Thu Oct 30, 2025

Town Council

Finance Committee to discuss Water Tower Project and NIPS funding

The Town Council Finance Committee will review monthly financial reports and Board of Education fiscal reports from September 2025. The committee will also hold discussions regarding the Water Tower Project and NIPS funding.

budgetfinancewater-towereducationinfrastructure
✓ Decided: Finance Committee urges Town Council to focus water tower project on Stonehouse Road

The committee unanimously accepted the minutes from the September 8, October 6 and October 10 Finance meetings. It recommended allocating NIPS funds for waste‑oil recycling, food‑waste containers, catch‑basin markers, bulk‑waste enforcement hours and anti‑freeze recycling, totaling about $35,500. It also unanimously recommended that the Town Council clarify previously allocated water‑tower funds to concentrate on the Stonehouse Road site. The meeting was adjourned at 8:16 PM.

Wed Oct 29, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee to conduct site visit to Orchard Hill Estates

The Senior and Affordable Housing Alternatives Study Committee is holding a special meeting. The session consists of a meeting with concept plan consultant Tony Bolduc and a site visit to Orchard Hill Estates.

senior-housingaffordable-housingplanning
✓ Decided: Committee held a site visit; no decisions were made

The Senior and Affordable Housing Alternatives Study Committee met, took a site walk at Orchard Hill Estates, and adjourned. No formal actions, approvals, or denials were recorded.

Wed Oct 29, 2025

Inland Wetlands Agency

Joint meeting to review wetland projects and discuss collaboration

The Coventry Lake Advisory and Monitoring Committee and the Inland Wetland Agency’s Low Impact Development Work Group will meet to review ongoing projects and discuss how the two groups will work together. The agenda includes separate project reviews by each group followed by a joint collaboration discussion.

wetlandslow-impact-developmentlake-advisorycollaborationtown-hall
Tue Oct 28, 2025

Ad-Hoc Protected Spaces Stewardship Committee

Committee reviews trail project updates and protected spaces acquisition

The Protected Spaces Stewardship Committee will review the September 4 meeting minutes and a financial report. Members will discuss volunteer feedback, elect committee officers, and receive updates on several trail projects, including Williams Preserve and Creaser Park. The meeting also includes a status update on protected spaces acquisition and other correspondence items.

stewardshiptrailsacquisitionvolunteerscommittee-meeting
✓ Decided: Committee approved supply purchases and set plans for future elections

The committee approved the minutes from the September 4, 2025 meeting. It approved funds for collecting baskets and wood preservative for trail projects, totaling about $200. Members reached consensus to postpone electing a chair, vice chair, and secretary until the January 2026 meeting.

Tue Oct 28, 2025

America 250 | Coventry CT Committee

Town Committee meeting will address routine reports and upcoming events

The Coventry Town Committee will hear routine reports and review old‑business items, including the Main Street Walk, the Kid Governor program, and a response to an invitation for Prince William. New business will cover the Town Clerk’s annual notice and the appointment of subcommittee members for events, finance/fundraising, and projects.

reportsold-businessnew-businesseventsfinanceprojectscommunity
✓ Decided: Committee accepted minutes and adjourned the meeting

The committee unanimously accepted the previous meeting minutes. A motion to adjourn was passed unanimously at 7:18 p.m. No other substantive actions or approvals were recorded.

Mon Oct 27, 2025

Town Council

Town Council Steering Committee to discuss firearms and parks ordinances

The Town Council Steering Committee will consider changes to the Parks and Recreation Commission ordinance and discuss a proposed firearms safety and home shooting range ordinance. The committee will also review several board and commission appointments.

ordinancesfirearmsparks-and-recreationappointmentsveterans-tax-exemptions
✓ Decided: Steering Committee appointed five members to town boards and commissions

The committee unanimously accepted the minutes from August 25 and September 29, 2025. It approved appointments of Carol Polsky, John Marvin, Cynthia Skripol, Steven Reviczky, and Darby Pollansky to various boards and commissions. The group also agreed to continue reviewing the draft firearms safety ordinance and to invite its chair to the next meeting. The meeting adjourned at 8:05 PM.

Mon Oct 27, 2025

Planning & Zoning Commission

Commission will consider a special permit for 29 condos on Boston Turnpike

The Planning & Zoning Commission will hold public hearings on three items: a proposal to modify zoning regulation language for two‑family dwellings (PZC-25-11), a renewal and modification of an existing special permit for a winery at 454 Cassidy Hill Road in the GR‑80 zone (PZC-25-14), and a special permit for a designed apartment/condominium development of 29 units on 15.51 acres south of Boston Turnpike in the GR‑40 zone (PZC-25-15). The commission will also review the meeting dates for 2026. All items are presented for discussion and possible approval.

zoninghousingdevelopmentspecial-permitplanning
✓ Decided: Commission approved renewal and modification of winery permit at 454 Cassidy Hill Rd

The commission adopted a modified agenda unanimously. It moved to hear the winery special‑permit application (PZC‑25‑14). The commission unanimously approved a waiver of the site‑plan requirement and then approved the renewal and modification of Special Permit 22‑10S for the winery, adding conditions. All motions passed with a 5‑0‑0 vote.

Thu Oct 23, 2025

Charter Revision Commission

Presentation on the Connecticut Municipal Charter Revision Process

The Charter Revision Commission will hear a presentation about the Connecticut municipal charter revision process and a presentation on state public‑meeting rules. The commission will then discuss and plan future meetings, set dates, address any other business, and adjourn.

chartergovernmentpublic-meetingsplanning
✓ Decided: Commission set regular meeting schedule and planned first public hearing for Nov 20

The Charter Revision Commission agreed that regular meetings will be held the first Wednesday and third Thursday of each month. It scheduled the next meeting for November 20, 2025 at 6:30 PM, designating the public hearing as the first item of business. Members adopted a 5‑minute limit for speakers at public hearings. The commission also asked that the current draft charter be attached to every meeting agenda.

Thu Oct 23, 2025

Economic Development Commission

EDC will discuss a visit to Worn Yesterday Shoppe and plan a Dec 7 open house

The Coventry Economic Development Commission will review a business visitation to Worn Yesterday Shoppe at 1364 Main Street and consider a suggested open house on December 7, 2025. The commission will also address procedures for future EDC events, receive planner and manager reports, and hear member updates. New business items include social‑media and communications, CT Countryside updates, and farmers‑market updates.

economic-developmentbusinesscommunityeventscommunications
Wed Oct 22, 2025

Senior and Affordable Housing Alternatives Study Committee

Senior housing committee meeting cancelled

The Ad-Hoc Senior & Affordable Housing Alternatives Study Committee has cancelled its October 22 meeting. A special meeting is being scheduled for a later date. The next regular meeting is set for November 19, 2025.

housingsenior-housingmeeting-cancellationcoventry
Wed Oct 22, 2025

Inland Wetlands Agency

Coventry Inland Wetlands Agency to review surface water circulator for Patriots Park

The agency will consider applications for a surface water circulator at Patriots Park and residential projects on Shore Drive and Zeya Drive. The meeting also includes an enforcement update regarding material deposition at 77 Tall Oak Drive.

wetlandsenvironmentzoningpublic-workspatriots-park
✓ Decided: Commission approved wetland permits for 29 Shore Drive and 64 Zeya Drive

The Inland Wetlands Agency voted 3‑0‑0 to approve permit WP‑25‑26 for the Czaikowski Family at 29 Shore Drive, allowing a permeable‑paver patio, driveway and walkway and adding an annual inspection condition. The agency also voted 3‑0‑0 to approve permit WP‑25‑28 for Debbie Ann Durkin at 64 Zeya Drive, authorizing a new home location with six additional monitoring and maintenance conditions and closing all outstanding violations.

Tue Oct 21, 2025

Zoning Board of Appeals

Zoning Board of Appeals meeting on Oct 21, 2025 is cancelled

The Coventry Zoning Board of Appeals meeting scheduled for Tuesday, October 21, 2025 at 7:00 PM in the Town Hall Annex and via Zoom has been cancelled. No agenda items were considered. The next meeting is set for November 18, 2025 at 7:00 PM, both on Zoom and in person at 1712 Main Street.

zoningmeetingcancellation
Tue Oct 21, 2025

Coventry Lake Advisory & Monitoring Committee

Joint meeting with LID Work Group scheduled for Oct 29, 2025

The Coventry Lake Advisory & Monitoring Committee will discuss a joint meeting with the LID Work Group, set for October 29, 2025 at 7 PM. No decisions are listed for this special meeting; the agenda is limited to the joint meeting notice.

lakewater-qualityenvironmentmonitoring
✓ Decided: Special meeting held, no decisions were made

The Coventry Lake Advisory & Monitoring Committee met on October 21, 2025. Members discussed ideas for assisting the LID Working Group and providing education about LID strategies in the watershed. No motions were adopted, and the meeting adjourned at 7:45 p.m.

Mon Oct 20, 2025

Town Council

Council reviews lake treatment update and Patriots Park improvement project

The Coventry Town Council will accept the September 2 and October 6 meeting minutes, act on a consent agenda that includes the Steering Committee and COVRRA items, receive updates on the Lake Wangumbaug aquatic invasive species treatment and the STEAP improvement project at Patriots Park, and consider Board of Education agenda and minutes along with September police and fire department statistics.

councilminutespresentationslake-wangumbaugpatriots-parkboard-of-educationpolice-fire
✓ Decided: Town Council unanimously accepts meeting minutes and consent agenda

The council voted to accept the September 2, 2025 Town Council meeting minutes. They also approved the October 6, 2025 minutes. A consent agenda covering multiple items was accepted without opposition.

Thu Oct 16, 2025

Cemetery Commission

Cemetery Commission to review columbarium pricing and sycamore planting

The Coventry Cemetery Commission will review financial statements and reports from Public Works and the Sexton. The body is discussing the configuration and pricing for a columbarium and reviewing pricing data from other cemeteries.

cemeteriespublic-worksbudgetlandscaping
Thu Oct 16, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee to review draft firearms ordinance

The Firearms Safety/Home Shooting Range Study Committee will review a draft of a firearms ordinance. The committee will also plan a second public comment meeting and future sessions.

firearms-safetyordinancepublic-safety
✓ Decided: Committee approves Firearms Ordinance draft 6 with revisions

The Firearms Safety/Home Shooting Range Study Committee approved the September 30, 2025 minutes and unanimously adopted Draft 6 of the firearms ordinance with the changes discussed at the meeting. The committee also decided the vacant seat need not be filled because its charge is ending soon. The approved amendments include title and purpose changes, removal of certain language, and revisions to sections on backstops, notification, and penalties.

Thu Oct 16, 2025

Inland Wetlands Agency

Review of Draft Low Impact Development Work Plan Matrix

The Inland Wetlands Agency LID Work Group will review and discuss the draft Low Impact Development (LID) Work Plan Matrix. They will also consider a residential educational initiative and plan a Spring/Summer 2026 LID Sustainable Landscape Workshop, including presentations, a field trip, and potential business sponsorships. Additional items include updates to the agency’s website resources and expansion of the communication listserv.

low-impact-developmentwetlandseducationworkshopcommunity-outreach
✓ Decided: Work group accepted prior notes and set future meeting dates

The Inland Wetlands Agency LID Work Group reviewed and accepted the September 11 meeting notes. They agreed to produce a one‑page “State of the Lake” summary for public distribution and to continue outreach efforts. Future meetings were scheduled for November 12, December 9, January 13 2026, and February 20. No votes were recorded.

Wed Oct 15, 2025

Parks & Recreation Commission

Parks commission to discuss ordinance changes

The Parks & Recreation Commission will meet to discuss potential actions regarding the Parks and Recreation Ordinance. The meeting is scheduled for Wednesday, October 15, 2025, at 6:30pm at the Annex.

parksrecreationordinancemeeting
✓ Decided: Commission approved submission of draft ordinance letter and chart

The Parks & Recreation Commission voted to approve a motion for Jennifer Rodgers to submit the draft letter and accompanying chart discussed at the meeting. The motion was made by Pam Miller, seconded by Bev Carlson, and passed with votes from Jennifer Rodgers, Bev Carlson, Jillian Miner, and Pam Miller. No other substantive actions were taken.

Tue Oct 14, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Advisory & Monitoring Committee meeting cancelled

The Coventry Lake Advisory & Monitoring Committee scheduled for October 13, 2025 was cancelled. No agenda items were considered or decided at this meeting. The cancellation was noted by Chair Deborah Zeppa.

environmentwater-managementadvisory-committee
Tue Oct 14, 2025

Housing Authority

Review and approval of expenditures at the Coventry Housing Authority meeting

The Coventry Housing Authority will consider approving its recent expenditures. The board will also review a solar contract with CT Greenbank and receive a director's report on the Orchard Hill project. Additional items include the approval of minutes, a treasurer's report, and discussion of equal‑housing opportunity.

housingfinancecontractssolarequal-housing
✓ Decided: Housing Authority approved September minutes, treasurer’s report, and expenditures

The board unanimously approved the September 9, 2025 meeting minutes. It also approved the September treasurer’s report and the September expenditures as presented. The meeting was then adjourned unanimously.

Tue Oct 14, 2025

Veterans Memorial & Events Commission

Veterans Memorial & Events Commission to review upcoming October and November events

The commission is meeting to discuss upcoming commemorative events and the Coventry Desert Storm and Post 9/11 Veterans Monuments Committee. The body will also determine the 2026 meeting schedule.

veterans-affairscommunity-eventsmemorials
✓ Decided: Veterans Memorial Commission approves minutes and sets 2026 meeting schedule

The commission approved the September 9, 2025 meeting minutes. It confirmed the officer slate will stay the same and approved opening a checking account for the War Monuments committee, with the account name to be shortened. Members assigned tasks to collect receipts, request an information table at the Veterans Day Race, and create donation flyers. The board also set proposed dates for 2026 meetings.

Tue Oct 14, 2025

Planning & Zoning Commission

Commission reviews garage permit and apartment development proposal

The Planning & Zoning Commission will hold a public hearing regarding a large residential garage. The body will also discuss a 29-unit condominium development and a site plan waiver for religious use.

zoninghousingland-usecondominiumspublic-hearings
✓ Decided: Commission discussed special permit for 535 Merrow Road; no decision taken

The Planning & Zoning Commission held a public hearing on application PZC-25-12 for a detached residential motor vehicle garage with an accessory dwelling unit at 535 Merrow Road. Members reviewed zoning criteria, wetlands permits, and possible agricultural classification, but no vote or final determination was recorded. The discussion focused on interpreting Section 4.06.01e and the definition of “footprint” versus “size.”

Mon Oct 13, 2025

Coventry Lake Advisory & Monitoring Committee

Committee will discuss updates on Lake Gate.

The Coventry Lake Advisory & Monitoring Committee will hold its regular meeting on October 13, 2025 at 7 PM in the Town Hall Conference Room D. The committee will receive updates on Lake Gate, Hydrilla, water quality, and enhanced wake boats, and will announce a joint meeting with the LID Work Group scheduled for October 29, 2025. No decisions or votes are listed; the agenda items are informational updates and a future joint meeting.

lakewater-qualityinvasive-speciesrecreationplanning
Fri Oct 10, 2025

Town Council

Finance Committee to review HVAC and roof project resolution

The Town Council Finance Committee is holding a special meeting to review background information and statutes regarding Resolution 2025-12. The discussion focuses on the HVAC and roof projects and the preparation of explanatory text.

hvacinfrastructurefinancetown-council
✓ Decided: Finance Committee seeks clarification on HVAC bond figures, no decisions made

The committee discussed discrepancies in the HVAC project cost numbers ($12,442,000 vs. $12,642,000) and asked Attorney Palmer to review the resolution language. Palmer said the error in Section 8 does not require correction because Section 9 lists the correct amount. The town attorney instructed Drumm to prepare the explanatory text quickly, and Town Clerk Lori Tollman was given an opportunity to draft a new version. No formal votes or approvals were recorded.

Thu Oct 9, 2025

Parks & Recreation Commission

Commission considers action on Patriots Park STEAP Grant

The Parks & Recreation Commission will meet to review staff reports on facilities and programs. The body will consider possible action regarding the Patriots Park STEAP Grant following a presentation by the Town Engineer.

parks-and-recreationgrantspublic-facilitiessummer-camps
✓ Decided: Commission set a special meeting for Oct 14 to draft a letter to the Steering Committee

The commission approved a motion to move Old Business to the first agenda item. Town Engineer Todd Penney presented Patriots Park playground site plans and a STEAP grant update, but no formal actions were taken on the project. Commissioners agreed to hold a special meeting on Oct 14 to write a letter to the Steering Committee, with Lesley Munshower arranging space and agenda.

Thu Oct 9, 2025

Water Pollution Control Authority

WPCA reviews FY2025 budget surplus and final payment for Lake Street sewer extension

The Coventry Water Pollution Control Authority will hold a public hearing and regular meeting on Oct. 9, 2025. Attendees will discuss three sewer use bills for 26 Mason Street, 1218 Main Street, and 95 Lakeview Drive. The board will review the FY2025 budget surplus of $53,000 and a $13,075 final payment for the 2015 Lake Street sewer extension. Additional updates include WPCA regulations, the 2026 meeting schedule, and project reports.

waterbudgetsewerpublic-hearinginfrastructure
✓ Decided: WPCA adopts new regulations and approves 2026 meeting schedule

The Authority adopted the proposed updates to its regulations with a unanimous vote. It approved the 2026 regular meeting schedule to continue on the second Thursday of each month. The board agreed to reduce the sewer use bill for 95 Lakeview Drive to one EDU once the Certificate of Completion is issued, and authorized staff to submit billing change memos to the Collector of Revenue. Staff were also authorized to proceed with a $5,000‑per‑year herbicide treatment for infiltration basins.

Thu Oct 9, 2025

Town Council

Joint Town Council Finance and Board of Education Fiscal Committee meeting canceled

The joint meeting of the Town Council Finance Committee and the Board of Education Fiscal Committee scheduled for October 9, 2025, has been canceled.

town-councilboard-of-educationfinance
Mon Oct 6, 2025

Town Council

Town Council to fund two new police interceptor vehicles and HVAC bond transfer

The Finance Committee will consider an appropriation of up to $61,000, including $33,466 in insurance proceeds, to purchase a 2025 Ford Police Interceptor to replace a damaged vehicle. It will also consider an appropriation of up to $77,000 for another 2025 Ford Police Interceptor. In addition, the committee will review explanatory text for an HVAC project that involves transferring bond funds for a referendum scheduled for November 4, 2025. The meeting is a special session on October 6, 2025 at the Town Hall Annex.

police-vehiclesbudgetfinance-committeehvacbond-fundsreferendum
✓ Decided: Town Council approves funding for two new police vehicles

The Finance Committee recommended and the Town Council unanimously approved up to $61,466 for a 2025 Ford Police Interceptor, using $33,466 of insurance proceeds and the remaining amount from the 1½% Fund. A second unanimous vote approved up to $77,000 for another 2025 Ford Police Interceptor, funded entirely from the 1½% Fund. The committee also discussed discrepancies in HVAC bond figures, but no action was taken.

Mon Oct 6, 2025

Town Council

Town Council considers funding for two new police vehicles

The Coventry Town Council will discuss appropriations for two 2025 Ford Police Interceptor vehicles. The body will also review recommended appointments for several town commissions and receive an update on the Human Services Department.

policebudgetappointmentspublic-safetyhuman-services
✓ Decided: Council appoints four members to local commissions and approves consent agenda

The Town Council approved the consent agenda by a 7‑0 vote. The September 2 minutes were continued by consensus, and the September 15 minutes were accepted with a 6‑0‑1 vote (one abstention). The Council also confirmed appointments to the Cemetery Commission, Energy Conservation/Alternative Energy Committee, Inland Wetlands Agency, and Water Pollution Control Authority, each passing unanimously.

Mon Oct 6, 2025

Local Emergency Coordinating Committee

Oct 6 local emergency committee meeting canceled

The Town of Coventry’s Local Emergency Coordinating Committee meeting scheduled for Monday, October 6, 2025 at 6:00 PM has been canceled. A special meeting will instead be held on Thursday, October 2, 2025 at 5:00 PM. The agenda for that special meeting will be published separately.

emergencymeetingscancellation
Thu Oct 2, 2025

Local Emergency Coordinating Committee

Coventry Emergency Coordinating Committee to review upcoming town events

The Local Emergency Coordinating Committee will hold a special meeting to debrief the Arts on Main event and plan for upcoming activities. The body will discuss the Halloween on Main and Veterans Day Road Race events.

public-safetycommunity-eventstrafficemergency-planning
✓ Decided: Deputy Emergency Management Director Mike Heimer appointed

The committee unanimously accepted the September 4, 2025 minutes. A Deputy Emergency Management Director, Mike Heimer, was appointed. The meeting was adjourned at 5:58 PM by unanimous consent.

Thu Oct 2, 2025

School Energy & Building Efficiency Building Committee

Committee reviews school HVAC and roof project reports and invoices

The School Energy & Building Efficiency Building Committee will approve the September 4 minutes, review financial statements, and examine several project status reports. Items include the HVAC status report, school construction project status, CHS roof project review, and the unit ventilator/HVAC project review. The committee will also consider the QA+M invoice dated August 31, 2025, the Pro‑Mech payment application 19, and an Aramark invoice.

school-energyhvacrooffinancebuilding
✓ Decided: Committee approved $297,088.41 payment to Pro-Mech

The committee unanimously approved the minutes from the September 4, 2025 meeting. It authorized a $481.25 QA+M invoice, a $297,088.41 payment to Pro‑Mech, and an $18,270.00 invoice to Aramark for HVAC commissioning services. The board also announced a ribbon‑cutting ceremony for the CHS HVAC project on October 29 at 10 AM.

Wed Oct 1, 2025

Charter Revision Commission

Coventry Charter Revision Commission holds inaugural meeting

The Charter Revision Commission held its first meeting to organize and discuss its charge. The body elected officers and established a meeting schedule. Legal counsel will attend the next meeting to provide an overview of responsibilities.

charter-revisiongovernmenttown-hallcoventry
✓ Decided: Justin Murphy elected Vice Chair and Monica Gallegos‑Ramirez elected Secretary of Charter Revision Commission

The commission unanimously elected Justin Murphy as Vice Chair and Monica Gallegos‑Ramirez as Secretary. It adopted a regular meeting schedule for the first Wednesday of each month at 6:30 PM. A motion to add agenda item 7 on the commission’s process and information requests passed unanimously. The commission also approved an initial meeting date of October 15, 2025 with a backup of October 29, 2025.

Wed Oct 1, 2025

Conservation Commission

Commission reports $2,952.67 remaining in its budget.

The Coventry Conservation Commission will review the September 3rd, 2025 minutes and present a financial report showing $2,952.67 left in its budget. It will discuss new business items such as Vernal Pool Mapping and Mill Brook Park, and old business items including Patriots Park Woods Trail, Rose Williams Property, and Nip Bottle Money. The meeting also includes a citizen audience, members forum, and communications updates.

budgetenvironmentparksplanningcommunity
✓ Decided: Commission approved purchase of 20 compost bins

The Conservation Commission unanimously accepted the meeting minutes. A motion to buy 20 Soil Saver compost bins for the Department of Public Works was seconded and approved unanimously. The meeting was then adjourned with a unanimous vote.

Wed Oct 1, 2025

Energy Conservation / Alternative Energy Advisory Committee

Committee will approve minutes and consider old and new business

The Energy Conservation/Alternative Energy Advisory Committee will meet on October 1, 2025. The agenda includes approving the September 3rd minutes, reviewing any old business, and discussing new business items. No specific projects, contracts, or policy changes are listed in the agenda.

energyadvisory-committeemeetingprocedural
✓ Decided: Committee approved September 3, 2025 meeting minutes

The Energy Conservation/Alternative Energy Advisory Committee approved the September 3, 2025 minutes after a motion and second. The meeting noted that Coventry received a Sustainable CT silver award and assigned follow‑up tasks, but no additional formal actions were taken.

Tue Sep 30, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee reviews public comments and drafts a new firearms ordinance

The Firearms Safety/Home Shooting Range Study Committee will approve the minutes from its September 18 meeting, review written public comments, and examine a draft firearms ordinance. The group will also discuss scheduling for future meetings and address any other business.

firearmsordinancepublic-commentmeetingcommittee
✓ Decided: Committee unanimously approved September 18, 2025 meeting minutes

The Firearms Safety/Home Shooting Range Study Committee approved the minutes from the September 18, 2025 meeting by unanimous vote. The committee then reviewed public comments and discussed revisions to the draft firearms ordinance, but no formal motions or votes on ordinance changes were recorded.

Mon Sep 29, 2025

Town Council

Town Council Steering Committee to consider expanded veterans tax exemptions

The Town Council Steering Committee will meet to discuss potential changes to the Parks and Recreation Commission ordinance and expanded residential property tax exemptions for veterans. The committee will also review board resignations and new appointments.

taxesveteransparks-and-recreationappointmentsordinances
✓ Decided: Town Council unanimously appointed four new members to commissions

The council accepted the August 25 minutes by consensus. It unanimously recognized the resignation of Planning and Zoning Commission member Polsky, creating a vacancy. It then unanimously approved appointments of Anne Vieten to the Cemetery Commission, Matthew Hannon to the Energy Conservation/Alternative Energy Committee, Stefanie Wierszchalek to the Inland Wetlands Agency, and Richard Brand to the Water Pollution Control Authority.

Mon Sep 29, 2025

Planning & Zoning Commission

September 29 Planning & Zoning Commission meeting cancelled

The regular meeting scheduled for September 29, 2025, has been cancelled. A public hearing for a special permit application has been rescheduled for October 14, 2025.

meeting-cancellationzoningspecial-permitresidential
Thu Sep 25, 2025

Economic Development Commission

Economic Development Commission to review business visitation and communications

The Economic Development Commission will hold a special meeting to discuss business visitations and updates on local initiatives. The body will review reports from the planner and manager and discuss social media and communications.

economic-developmentbusinesscommunicationsfarmers-market
✓ Decided: Adoption of meeting minutes postponed to next meeting

The Economic Development Commission voted to table the adoption of these minutes until the next meeting. No other actions were approved, denied, or voted on. The remainder of the meeting consisted of updates on business visits, planning reports, and upcoming projects.

Wed Sep 24, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee will award the senior and affordable housing study RFP.

The Senior and Affordable Housing Alternatives Study Committee will adopt meeting minutes, award the request for proposal for the study, provide an update on two‑family housing regulations, and discuss a story‑map website for affordable housing information.

senior-housingaffordable-housinghousing-regulationsRFPwebsite
✓ Decided: Committee awarded Double B Design for conceptual senior housing plan

The committee reached consensus to award Double B Design the conceptual plan contract and will finalize the contract at the next meeting. A public hearing on updated two‑family housing regulations was scheduled for October 27, 2025. Members agreed to prepare affordable‑housing content for the upcoming town newsletter. The Sustainable CT program did not award the $25,000 affordable‑housing points to Coventry.

Wed Sep 24, 2025

Inland Wetlands Agency

Review of WP-25-25 agricultural application for 89 Flanders Road wetlands

The Inland Wetlands Agency will consider old business items WP-25-22 (underwater aerator at 124 Lake St) and WP-25-23 (driveway culvert replacement at 131 Woodland Road). New business includes WP-25-25, an agricultural as‑of‑right application for 89 Flanders Road, and WP-25-26, a permeable‑paver patio and driveway project at 29 Shore Drive. The meeting will also address enforcement at 77 Tall Oak Drive, adopt August 27 minutes, and discuss a Low Impact Development working group update.

wetlandsdrainageagriculturedevelopmentenforcement
✓ Decided: IWA unanimously approves three wetland permit applications

The Inland Wetlands Agency approved the WP-25-22 permit for 124 Lake St, Patriots Park, the WP-25-23 permit for 131 Woodland Rd, and the WP-25-25 determination for 89 Flanders Rd as agricultural as‑of‑right. All motions passed with unanimous or near‑unanimous votes. No other substantive actions were taken.

Tue Sep 23, 2025

America 250 | Coventry CT Committee

Town forms new subcommittees for events, finance, and projects

The Coventry Town Committee will consider the distribution of flyers for the Farmer’s Market, including locations such as the Town Newsletter, email blast, Parks 06238‑Emily, and the Visitor’s Center at 10/4 Main St. It will also discuss sharing a family‑history post about Mary Ann on Facebook. Finally, the committee will vote to create subcommittees for events, finance/fundraising, and projects such as VIS signs and Loomis Boulder work with Jana Robeson.

communitycommunicationseventsfinanceprojects
✓ Decided: Committee established finance, projects, and events subcommittees

The committee considered a motion to accept the previous minutes, noting an abstention by Mary Ann Hansen. Subcommittees for finance/fundraising, projects, and events were designated with specific members. The meeting was adjourned unanimously.

Thu Sep 18, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee reviews draft firearms ordinance and public feedback

The Firearms Safety/Home Shooting Range Study Committee will review the draft firearms ordinance language and related background materials. Members will discuss written feedback received from residents (Glenney, Milkovic, Pace, Swift). The meeting includes a public comment period for additional input. No formal decisions are noted on the agenda.

firearmsordinancepublic-commentcommunity-feedback
✓ Decided: Committee approved prior meeting minutes; no ordinance decision taken

The committee approved the minutes from the August 21, 2025 meeting by unanimous vote. The meeting featured a presentation on the draft firearms ordinance and a public comment period in which several residents voiced opposition. No vote or decision was made on the ordinance itself.

Thu Sep 18, 2025

Cemetery Commission

Cemetery Commission reviews plot inventory and sale availability

The Coventry Cemetery Commission will hold a regular meeting on September 18, 2025 at 6:00 p.m. in the Department of Public Works Conference Room, 100 Olsen Farm Rd. The agenda includes reviewing and approving minutes from the previous meeting and the town’s financial statements. Commissioners will discuss garden‑bed maintenance, including boxwood pruning and spring mulching. They will also review an inventory update showing the number of single, double, and triple burial plots currently available for sale.

cemeteryinventorymaintenanceplotsfinancewreaths-across-america
Thu Sep 18, 2025

Board of Assessment Appeals

Board reviews appeals and approves prior meeting minutes

The Coventry Board of Assessment Appeals will meet on September 18, 2025 at 6:00 PM in Town Hall Conference Room B. The agenda includes approving the minutes from the April 30, 2025 meeting, deliberating and deciding on pending assessment appeals, and addressing any other business. No other items are detailed in the agenda.

assessment-appealsboard-meetingminuteslocal-governmentcoventry-ct
Tue Sep 16, 2025

Zoning Board of Appeals

Board will consider two variance requests for property additions and setbacks.

The Coventry Zoning Board of Appeals will hold a special meeting on September 16, 2025 at Town Hall Annex and via Zoom. The board will hear public testimony on two variance applications: ZBA-25-13 for a 6 × 11 ft addition 9 ft from the side property line at 39 Spring Trail in the LR Zone, and ZBA-25-14 for a 24 × 24 ft detached garage with reduced side and front yard setbacks at 167 Geraldine Drive in the GR‑80 Zone. The meeting will also include approval of the August 19, 2025 minutes and member updates.

zoningvariancespublic-hearingsland-usehousing
✓ Decided: ZBA approved two variances for property additions on Spring Trail and Geraldine Drive

The board approved a variance for a 6' × 11' bathroom addition at 39 Spring Trail in the LR Zone, voting 4‑0‑1. It also approved a variance for a 24' × 24' detached garage at 167 Geraldine Drive in the GR‑80 Zone, with a condition to obtain a wetlands letter, voting unanimously 5‑0. The August 19, 2025 meeting minutes were approved unanimously.

Mon Sep 15, 2025

Town Council

Council will consider a 42.2‑acre land donation and appoint a charter revision chair

The Coventry Town Council meeting will review and possibly accept a donation of a 42.2‑acre parcel that borders the Thornton Brook Preserve. Council members will also vote on appointing a chairperson for the Charter Revision Commission. Additional items on the agenda include the monthly financial report, an update from the Human Services Department, and the Board of Education’s agenda and minutes.

land-donationcharter-revisionfinancehuman-serviceseducationpolice-fire
✓ Decided: Council approved consent agenda and postponed September 2 minutes

The council moved to accept the consent agenda, which was approved by a 7‑0 vote. Acceptance of the September 2, 2025 minutes was deferred and will be reviewed at the next meeting.

Thu Sep 11, 2025

Parks & Recreation Commission

Commission will consider the UCONN Sailing Shed proposal

The Coventry Parks & Recreation Commission will meet on September 11, 2025. The commission will discuss three new business items: a proposal for a UCONN sailing shed, a rental request for the Junior Huskies at Patriots Park, and a STEAP grant for Patriots Park. Each item is listed as possible action or new business for consideration.

parksrecreationgrantsfacilitiescommunity
✓ Decided: Commission approved new gray UConn Sailing shed at Patriots Park

The commission seated McKenna Considine and Ashlee Pascarelli as full members. It approved the UConn Sailing shed at Patriots Park, requiring the shed be painted gray. Minutes from the June 19, 2025 meeting were approved, while the August 5, 2025 minutes were deferred to the October 9 meeting.

Thu Sep 11, 2025

Water Pollution Control Authority

Discussion and approval of the Sewer Assessment for 396 Main Street

The Coventry Water Pollution Control Authority will hold a public hearing and regular meeting on September 11, 2025. The agenda includes approval of minutes from the August 14, 2025 meeting and a discussion of the sewer assessment for 396 Main Street. Additional items are updates on WPCA regulations, sewer system capacity, the FY 2025 budget, and project reports such as the Western Route 44 Sewer Project.

watersewerbudgetregulationspublic-hearinginfrastructure
✓ Decided: WPCA approves $12,000 sewer assessment for 396 Main St

The Water Pollution Control Authority approved the minutes from the August 14, 2025 meeting. It also approved a $12,000 sewer assessment for 396 Main Street, payable over 20 years at 2% interest. A public hearing on proposed regulation updates was scheduled for October 9, 2025. The board noted a FY25 budget surplus of $63,000.

Thu Sep 11, 2025

Inland Wetlands Agency

Inland Wetlands Agency Low Impact Development Work Group to finalize work plan

The Low Impact Development (LID) Work Group is meeting to review site visits and UConn research follow-ups. The group intends to review and finalize a draft LID Work Plan Matrix and set future work assignments.

wetlandslow-impact-developmentenvironmental-planningwater-quality
✓ Decided: IWA LID Work Group approves meeting notes and plans lake survey

The group reached consensus to approve the draft August 12, 2025 meeting notes. Members agreed to draft a lake‑watershed survey and aim to send it by the end of September. The work group also approved updating its mission to focus on lake protection strategies and updating its web resources. Future monthly meetings were scheduled through February 2026.

Tue Sep 9, 2025

Housing Authority

Housing Authority will review expenditures and discuss Orchard Hill update

The Coventry Housing Authority monthly meeting on September 9, 2025 will consider approval of expenditures and hear the director’s report, which includes an update on the Orchard Hill Estates project at 1630 Main Street. The agenda also lists items for new business and old business. The meeting is open to the public.

housingfinancecommunityupdatespublic-meeting
✓ Decided: Housing Authority approved August minutes, treasurer's report, and expenditures

The board unanimously approved the August 12, 2025 meeting minutes. It also unanimously approved the August treasurer's report. Finally, the board unanimously approved the August expenditures as presented.

Tue Sep 9, 2025

Veterans Memorial & Events Commission

Veterans Memorial & Events Commission reviews upcoming September and November events

The commission is meeting to discuss a schedule of upcoming veterans events and recognition days. The body will also review old business regarding new veterans monuments.

veteranscommunity-eventsmonuments
✓ Decided: Commission approved May 2025 minutes and set joint committee meetings

The commission approved the minutes from the May 13, 2025 meeting. The Gulf War and Post‑9/11 War Monuments committees agreed to hold joint meetings until the monument committee obtains nonprofit status and can begin recruiting working groups. No other actions were taken.

Mon Sep 8, 2025

Coventry Lake Advisory & Monitoring Committee

Lake Committee to discuss enhanced wake boats and September forum

The Coventry Lake Advisory & Monitoring Committee will meet to review updates on the lake gate, hydrilla, and water quality. The committee will finalize plans for a September forum featuring an IWA Low Impact Development panel and discuss information regarding enhanced wake boats.

environmentwater-qualitylake-managementpublic-forum
✓ Decided: Committee unanimously approved August 11 meeting minutes

The committee voted unanimously to approve the minutes from the August 11, 2025 regular meeting. Other agenda items were informational updates on lake water level, herbicide treatments, water quality sampling, and upcoming events. No substantive actions were taken on new business items.

Mon Sep 8, 2025

Planning & Zoning Commission

Commission to review subdivision and zoning changes for two-family dwellings

The Planning and Zoning Commission will hold a public hearing regarding a three-lot subdivision on Boston Turnpike. The body will also discuss modifications to zoning regulations for two-family dwellings and a special permit for a large residential garage.

zoningsubdivisionland-useresidential-housing
✓ Decided: Planning Commission unanimously approves three‑lot subdivision on Boston Turnpike

The commission moved to approve application PZC‑25‑6 for a three‑lot subdivision on the south side of Boston Turnpike, adding conditions such as a 0.62‑acre conservation easement, driveway agreement, pre‑construction notifications, and stone‑wall preservation. The motion was approved unanimously (For: Pollansky, Polsky, Thomas, Reviczky, Murray; Against: none; Abstain: none). The commission also approved the minutes from June, July and August 2025 with a minor amendment, also unanimously (For: Pollansky, Polsky, Thomas, Murray; Against: none; Abstain: Reviczky).

Mon Sep 8, 2025

Town Council

Coventry finance committees to discuss shared services and preschool funding

The Coventry Town Council Finance Committee and Board of Education Fiscal Committee will meet jointly to discuss shared services, potential bonding projects, and preschool funding allocations. Separate finance committee meetings will review monthly financial reports, spending of NIPS funds, and fiscal guardrails for project expenditures.

coventryfinance-committeeeducationpreschool-fundingbonding-projectsshared-servicesfiscal-policy
✓ Decided: Council discussed shared services, ECHIP, and preschool funding

The joint Finance Committee and Board of Education meeting was used to discuss shared services between the town and BOE, the timeline for a decision on the ECHIP health‑insurance partnership, potential bonding projects, and the preschool memorandum of agreement and expense allocation. No formal approvals, denials, or votes were recorded during the session. The meeting concluded without any substantive decisions being made.

Thu Sep 4, 2025

Ad-Hoc Protected Spaces Stewardship Committee

Protected Spaces Stewardship Committee to discuss trail projects and signage

The committee will meet to review financial reports and discuss the 'Young Lungs at Play' signage project. Members will provide updates on various trail maintenance projects and review a draft revised ordinance from Parks and Recreation.

parkstrailsconservationordinancespublic-spaces
✓ Decided: Committee approved $1,000 LOCIP grant for Mill Brook bog bridge materials

The committee accepted the April 22, 2025 meeting minutes as written. It approved a $100 purchase order for invasive water chestnut basket collection and unanimously approved an additional $100 for trail‑maintenance supplies, with Eric Thomas to attend the Conservation Commission meeting to request the funds. The committee granted a $1,000 LOCIP grant for a vendor purchase order for Mill Brook bog bridge construction materials and appointed Keith Miller as a new committee member.

Thu Sep 4, 2025

School Energy & Building Efficiency Building Committee

Coventry committee reviews HVAC, roof projects and invoices

The School Energy and Building Efficiency Building Committee will review financial statements, discuss the CHS roof project closeout, and review the unit ventilator/HVAC project schedule and payments. They will also consider invoices from QA+M, Pro-Mech, and Aramark.

schoolenergybuildingroofhvacfinances
✓ Decided: Committee authorized $380,180.78 payment to Pro‑Mech for HVAC work

The School Energy & Building Efficiency Committee approved several financial items, including a $380,180.78 payment to Pro‑Mech and a $14,000 Aramark invoice, both unanimously. The QA+M roof invoice for $137.50 and the CHS Roof Closeout Documents were also accepted unanimously. The August 7 minutes were approved with two votes in favor and one abstention, and the meeting was adjourned unanimously.

Thu Sep 4, 2025

Local Emergency Coordinating Committee

Coventry emergency committee to review pedestrian safety concerns and upcoming town events

The Coventry Local Emergency Coordinating Committee will meet to accept minutes from its August 7 meeting, review pedestrian safety concerns, and discuss agency updates. The committee will also consider road closures for upcoming town events like Arts on Main and Halloween on Main.

emergency-managementpedestrian-safetyroad-closurestown-eventscoventry-ct
✓ Decided: LECC unanimously accepted August minutes and adjourned the session

The committee approved the minutes from the August 7, 2025 meeting after a motion by Bill Watkins, seconded by James Drumm, with a unanimous vote. The meeting was then adjourned at 5:32 PM following a motion by Jon Hand, seconded by Bill Watkins, also approved unanimously.

Wed Sep 3, 2025

Conservation Commission

Conservation Commission to discuss vernal pool mapping and Mill Brook Park

The Conservation Commission will meet to review new business regarding vernal pool mapping and Mill Brook Park. The body will also address old business concerning the Rose Williams Property, Nip Bottle money, and the Patriots Park Woods Trail.

conservationenvironmentparksland-use
✓ Decided: Commission unanimously approved $100 pre‑approval for Eric’s expenses

The commission voted to pre‑approve small expenditures of up to $100 for Eric’s work, with the motion seconded by Art and approved unanimously. A motion to adjourn the meeting was also made by Brian, seconded by Art, and passed unanimously. No other substantive actions were decided at this meeting.

Tue Sep 2, 2025

Town Council

Council considers bonding debt transfer for CHS HVAC project

The Coventry Town Council will discuss transferring unused bonding debt to the CHS HVAC project and potential expanded property tax exemptions for veterans. The body will also consider additional funding for the Swamp Road/South Street roadway project and ratify the Town Treasurer/Finance Director appointment.

budgethvacveteransroadsappointments
✓ Decided: Council approved August minutes and consent agenda

The council accepted the August 18, 2025 meeting minutes after minor wording edits, with all six members voting for and none against. The council also approved the consent agenda, after a request to remove item 9.C., again with a unanimous 6‑0 vote. No other substantive actions were recorded.

Thu Aug 28, 2025

Economic Development Commission

Economic Development Commission to discuss communications and local updates

The Economic Development Commission is holding a special meeting to review social media and communications. The body will also receive updates regarding CT Countryside and the Farmers’ Market.

economic-developmentcommunicationsfarmers-marketbusiness-opening
✓ Decided: Commission approved motion to explore signage on major routes

The Economic Development Commission voted on a motion to explore signage on major routes. The motion was moved by Edmondson, seconded by Mitchell, and approved unanimously. All six voting members—Liptrap, Murphy, Neal, Barry, Mitchell, and Edmondson—voted in favor. No members voted against or abstained.

Thu Aug 28, 2025

Economic Development Commission

Farmers’ Market Operating Committee to discuss 2025 season and wifi upgrades

The Ad-Hoc Farmers’ Market Operating Committee is meeting to review the 2025 season. The body will also discuss wifi upgrade work.

farmers-marketinfrastructureeconomic-development
✓ Decided: Dog day t‑shirts ordered and red carpet purchased for market contests

The commission approved the minutes from the May 1, 2025 meeting. It decided to order short‑ and long‑sleeve Dog Day t‑shirts and to purchase a red carpet for the dog contests. Jana will investigate the cost of adding Spectrum internet for guests.

Wed Aug 27, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee reviews zoning proposals and submissions for senior housing study

The Coventry Senior and Affordable Housing Alternatives Study Committee will meet to review submitted proposals, discuss a zoning regulation update, and adopt minutes from its June 23, 2025 meeting. The session is procedural with no formal decisions scheduled.

coventryhousingsenior-housingzoningmeeting-procedural
✓ Decided: Committee narrows design proposals and will email top two to Planning Director

The committee decided to narrow the design proposals to the two lowest‑cost options and will email those preferences to Director Jana Roberson. Roberson will forward the Request for Proposals (RFP) to the committee and inform Penney of the group discussion. The committee was asked to complete a score sheet over the week, and the adoption of June minutes was tabled to the next meeting. No public hearing date has been set for the zoning regulation proposal.

Wed Aug 27, 2025

Inland Wetlands Agency

Coventry Inland Wetlands Agency to review subdivision and lake projects

The Inland Wetlands Agency will discuss several land-use applications, including a subdivision on Route 44 and stone wall construction at Coventry Lake. The body will also consider a town proposal for an underwater aerator at Patriots Park.

wetlandszoningenvironmentpublic-worksland-use
✓ Decided: IWA approves 3‑lot subdivision at Route 44 with town‑review conditions

The Inland Wetlands Agency approved application WP-25-15 for a three‑lot subdivision on CT Route 44, adding conditions that the town must review and approve the conservation easement and the ownership/maintenance agreements for stormwater structures. The agency also approved application WP-25-19 for stone walls at 211 Maple Drive with an annual inspection requirement and a recommendation for a vegetative buffer. An extension was granted for WP-25-13, moving its decision deadline to November 2, 2025. No vote was taken on the Patriots Park aerator and playscape project.

Tue Aug 26, 2025

Town Council

Town Council to consider funding for Swamp Road improvements

The Town Council Finance Committee will review financial reports and consider a request for additional funding for the Swamp Road/South Street roadway improvement project. The committee will also discuss expanded veterans property tax exemptions and a resolution to transfer bonding funds for an HVAC project.

financebudgetroadstaxesveteranshvacbondingspending
✓ Decided: Finance Committee votes to continue July 14 minutes, accepts June 9 minutes

The committee approved the June 9, 2025 Finance Meeting minutes with recommended edits, with two votes in favor and one abstention. A motion to continue the July 14, 2025 Finance Meeting minutes so the clerk can review the video and add omitted comments was passed unanimously. No other formal actions were taken.

Tue Aug 26, 2025

America 250 | Coventry CT Committee

Coventry CT Committee discusses America 250 planning and subcommittees

The America 250 | Coventry CT Committee is meeting to discuss promotional materials and event planning. The body is reviewing the distribution of flyers and the creation of subcommittees for finance, parades, and projects.

community-eventsamerica-250local-governmentplanning
✓ Decided: Town accepted prior minutes and adjourned the meeting

The committee unanimously approved the previous meeting's minutes. A motion to adjourn the meeting was also passed unanimously. No substantive policy or project decisions were made.

Mon Aug 25, 2025

Planning & Zoning Commission

Planning & Zoning Commission to hear three public land-use cases

The Coventry Planning and Zoning Commission will conduct public hearings on three development proposals: a three-lot subdivision on Boston Turnpike, a tear-down/rebuild on Squirrel Trail, and a large motor-vehicle garage on Merrow Road. The commission will also consider zoning-regulation changes for two-family dwellings and a lot-line revision on South Street Extension.

zoningsubdivisionrezoningpublic-hearingcoventry-ct
✓ Decided: Planning Commission approves subdivision waivers and special permit for 84 Squirrel Trail

The Coventry Planning & Zoning Commission unanimously approved four waiver requests related to a three‑lot subdivision on Boston Turnpike, covering map, plant/animal survey, hydraulic study, and open‑space plan. The commission also unanimously approved a special permit for a new single‑family dwelling on the undersized lot at 84 Squirrel Trail, adding access and sightline easements and other conditions. All motions were adopted without opposition.

Mon Aug 25, 2025

Town Council

Steering Committee to recommend candidates for Charter Revision Commission

The Town Council Steering Committee will review candidates and recommend appointments for the Charter Revision Commission. The committee will also consider appointments for the Cemetery Commission and Inland Wetlands Agency.

appointmentscharter-revisiontown-governmentparks-and-recreation
✓ Decided: Steering Committee recommends eight new members for town commissions

The committee approved Kevin Arpin's appointment to the Cemetery Commission. It unanimously recommended Cheryl Resha, Monica Gallegos Ramirez, Justin Murphy, Mike Petro, and Timothy Liptrap for life‑term seats on the Charter Revision Commission. Lori Mathieu was also appointed to the Inland Wetlands Agency. All motions recorded as passed were approved by unanimous vote.

Thu Aug 21, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee to discuss draft firearms ordinance and home shooting ranges

The Firearms Safety/Home Shooting Range Study Committee is meeting to review a draft firearms ordinance and an extension resolution. The committee will also plan for public feedback and a public presentation.

firearmspublic-safetyordinanceshooting-ranges
✓ Decided: Committee’s term extended to Dec 1 2025 by Town Council approval

The committee unanimously approved the June 19, 2025 minutes. The Town Council approved an extension of the Firearms Safety/Home Shooting Range Study Committee through Dec 1 2025, allowing four additional regular meetings. The committee scheduled a public comment meeting for Sep 18 2025 at 6:30 PM in the annex and outlined procedures for additional comments.

Thu Aug 21, 2025

Cemetery Commission

Coventry Cemetery Commission to meet August 21

The Coventry Cemetery Commission will hold a regular meeting to review financial statements and receive reports from Public Works and the Sexton. The commission will also discuss responses to family letters and Wreaths Across America.

cemeterypublic-workstown-administration
✓ Decided: Cemetery Commission approves placement of three new grave markers

The commission approved the minutes from the July 17, 2025 meeting by a 5‑0 vote. It also approved a motion to place three future markers at the heads of graves in Grant Hill Cemetery, Lot 32, with all markers aligned, passing 5‑0. No other substantive actions were taken.

Tue Aug 19, 2025

Zoning Board of Appeals

ZBA to hear variance request for garden shed at 730 Pucker Street

The Zoning Board of Appeals will hold a public hearing regarding a variance request for a garden shed. The board will also consider the approval of meeting minutes from July 15, 2025.

zoningvarianceland-use
✓ Decided: Zoning Board approves garden shed variance and July minutes

The Zoning Board of Appeals unanimously approved a variance allowing a 12' × 16' garden shed to be built 38 feet from the front property line at 730 Pucker Street in the GR‑80 zone. The board also unanimously approved the minutes from the July 15, 2025 meeting. All votes were in favor with no objections or abstentions. The meeting was adjourned at 7:12 p.m.

Tue Aug 19, 2025

Veterans Memorial & Events Commission

Coventry commission to review new veteran monuments proposal

The Veterans Memorial and Events Commission will hold a special meeting to discuss a proposal for new veteran monuments. The agenda includes reviewing minutes, upcoming events, and old and new business items.

veteransmonumentslocal-governmentcoventry
Mon Aug 18, 2025

Town Council

Council considers utility easement for Coventry High School HVAC improvements

The Town Council will consider approving an Eversource electrical utility easement at 78 Ripley Hill Road. The meeting also includes updates on summer roads, current engineering projects, and a Town Manager performance evaluation in executive session.

utilitiesschoolsroadsinfrastructuregovernment-administration
✓ Decided: Town Council approves Eversource easement for high school HVAC

The council accepted the July 21, 2025 meeting minutes with suggested edits (5‑1‑1). It also approved the consent agenda (6‑0‑1). Finally, the council authorized the Town Manager to execute an electrical utility easement for HVAC improvements at Coventry High School (7‑0‑0).

Thu Aug 14, 2025

Town Council

BOE Fiscal and Town Finance Committees hold joint meeting

The BOE Fiscal Committee and Town Finance Committee are meeting to review the FY2025 end of year figures. The body will also receive updates on federal funding and shared services between the town and the board of education.

budgetfinanceeducationfederal-funding
✓ Decided: Board of Education and Town Finance Committee set meeting schedule, adjourned

The committee agreed to hold joint meetings every two months, scheduled to occur before the regular board meeting during the fiscal off‑week. A motion to adjourn the meeting at 6:07 p.m. was made and passed unanimously. No other formal actions were recorded.

Thu Aug 14, 2025

Water Pollution Control Authority

Coventry WPCA meets Aug 14 to review sewer fees, regulations, and system updates

The Coventry Water Pollution Control Authority will hold its regular meeting on August 14, 2025, via Zoom. The agenda includes approval of prior meeting minutes, a proposed sewer use fee adjustment at 1047 Main Street, updates to WPCA regulations, and ongoing discussions about sewer system capacity and grinder pump ownership transfers. Staff will provide updates on the Wastewater Management Plan, the Western Route 44 Sewer Project, and operations. The meeting also includes correspondence reports and sets a public hearing for September 11, 2025, regarding 396 Main Street.

sewer-feeswastewaterzoningpublic-hearingcoventry-ct
✓ Decided: WPCA adjusts sewer use fee for 1047 Main St to 11.75 EDUs

The board approved the minutes from the June 12, 2025 meeting. It also approved adjusting the sewer use fee for 1047 Main Street to a total of 11.75 EDUs effective July 1, 2025. WPCA staff will continue reviewing draft regulation updates, with another review scheduled for the September 11 meeting. A public hearing on the Sewer Assessment for 396 Main Street was set for that September meeting.

Tue Aug 12, 2025

Housing Authority

Monthly Coventry Housing Authority meeting to review finances and Orchard Hill updates

The Coventry Housing Authority will hold its monthly meeting to approve expenditures, review year-end financial reports, and discuss solar documentation from the CT Green Bank. The director will provide updates on Orchard Hill Estates phases I and II.

housingfinancesolarorchard-hill-estatesmonthly-meeting
✓ Decided: Housing Authority approved August minutes, treasurer's report, and expenditures

The board unanimously approved the August 12, 2025 meeting minutes as amended. It also unanimously approved the August treasurer's report. Finally, the board unanimously approved the August expenditures as presented.

Tue Aug 12, 2025

Inland Wetlands Agency

Inland Wetlands Agency LID Work Group to finalize work plan matrix

The Low Impact Development (LID) Work Group is meeting to review site visit notes and finalize a draft work plan matrix. The group will also determine work assignments and the Fall 2025 meeting schedule.

wetlandslow-impact-developmentenvironmental-planningwork-plan
✓ Decided: IWA LID Work Group approves meeting notes and adds new member

The Inland Wetlands Agency Low Impact Development Work Group voted to approve the draft meeting notes from the June 18 and June 24, 2025 meetings. The group also approved adding Darby Pollansky as a representative of the Planning & Zoning and Economic & Community Development Commissions. Members agreed to develop a Work Plan Matrix and to share updates with the email list. Future monthly meetings for fall 2025 will be scheduled by the chair.

Mon Aug 11, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Advisory & Monitoring Committee to hold working session on management plan

The committee will meet to discuss updates on the lake gate, hydrilla, and water quality. Members will hold a working session regarding the January 2016 Coventry Lake Management Plan and plan for a September Forum featuring an IWA Low Impact Development panel.

environmentwater-qualitylake-managementpublic-forum
✓ Decided: Committee unanimously approved July 14 meeting minutes

The Coventry Lake Advisory & Monitoring Committee approved the minutes from the July 14, 2025 meeting by a unanimous vote. No other substantive actions were decided; the committee provided updates on lake water level, hydrilla treatment, water quality sampling, and upcoming events. Future work on the Lake Management Plan will be discussed at a special meeting in October.

Mon Aug 11, 2025

Planning & Zoning Commission

August 11 Planning & Zoning Commission meeting cancelled

The regular meeting scheduled for August 11, 2025, has been cancelled. A public hearing for a subdivision application has been postponed to August 25, 2025.

planning-and-zoningsubdivisionmeeting-cancellation
Mon Aug 11, 2025

Town Council

Finance Committee meeting canceled, rescheduled for August 26

The joint Town Council Finance Committee meeting scheduled for August 11, 2025, is canceled. A special meeting is rescheduled for August 26, 2025, at 7:00 PM in Conference Room B at Town Hall.

financecancellationrescheduletown-hall
Thu Aug 7, 2025

School Energy & Building Efficiency Building Committee

Committee to review CHS roof and HVAC projects

The School Energy and Building Efficiency Building Committee will review financial statements and project schedules. The body will discuss the CHS roof project and unit ventilator/HVAC project.

schoolshvacbuilding-efficiencyinfrastructure
✓ Decided: Committee approved $213,837.04 payment to Pro-Mech

The committee unanimously approved the minutes from the July 3, 2025 meeting and a payment of $213,837.04 to Pro-Mech for its invoice. The HVAC reimbursement request was denied. The agenda item on the Building Committee Cost Breakdown was tabled until the next meeting, and the meeting was adjourned at 7:16 PM.

Thu Aug 7, 2025

Local Emergency Coordinating Committee

Coventry Local Emergency Coordinating Committee to debrief recent town events

The committee will meet to review the coordination of past events and discuss upcoming activities. The agenda includes agency updates and a review of the May 1, 2025, meeting minutes.

public-safetyemergency-coordinationtown-eventscoventry
✓ Decided: LECC unanimously accepts May 1 minutes and plans future agenda topics

The committee accepted the May 1, 2025 minutes by unanimous vote. Members agreed to add the Traffic Authority topic to future LECC agendas. A schedule was set for the Human Services prevention council to give an update at an upcoming Town Council meeting. The group also discussed creating a policy for event staffing costs, but no decision was made.

Wed Aug 6, 2025

Conservation Commission

Coventry Conservation Commission to discuss vernal pool mapping and park projects

The Conservation Commission will meet to review financial reports and discuss several land and park projects. The body is scheduled to address new business regarding vernal pool mapping and Mill Brook Park.

conservationparksenvironmentland-use
✓ Decided: Commission approved motion to adjourn the meeting

The Conservation Commission met on August 6, 2025, reviewed minutes with two corrections, and reported a balance of $3,170.67 after a purchase for weed removal. No public audience or referrals were noted. New business included plans for a work party at Eagleville Lake, and old business covered a letter about tower hazards, vernal pool mapping, a proposed brush‑clearing field trip, and a pending preserve plan. A motion to adjourn was made and approved by all members.

Tue Aug 5, 2025

Parks & Recreation Commission

Parks & Recreation Commission to review updated ordinance

The Parks & Recreation Commission will hold a special meeting to hear a presentation on an updated Parks and Recreation Ordinance. The presentation will be delivered by Special Projects Coordinator Alex Taylor.

parks-and-recreationordinancelocal-government
✓ Decided: Commission debated draft ordinance and park issues, but took no formal action

The Parks & Recreation Commission discussed a draft ordinance that would change the commission's voting authority and expressed concerns about its impact. Members also talked about the Patriots Park master plan, a proposed UCONN boathouse, and long‑term contract involvement. No votes, approvals, or other formal actions were recorded during the meeting.

Tue Aug 5, 2025

Energy Conservation / Alternative Energy Advisory Committee

Energy Conservation/Alternative Energy Advisory Committee meets August 5

The committee will meet to approve minutes from June 4 and discuss old and new business. No specific topics or proposals are listed on the agenda.

energy-conservationalternative-energy
Mon Aug 4, 2025

Town Council

Town Council to consider establishing a Charter Revision Commission

The Coventry Town Council will meet to discuss the establishment of a Charter Revision Commission and a memorandum of agreement with the State of Connecticut's DEMHS. The body will also consider an extension for the Firearms Safety Home Shooting Range Study Committee and review several board appointments.

charter-revisionpublic-safetyappointmentsgovernment-administration
✓ Decided: Council approved four new appointments to town committees and boards

The Town Council accepted the July 7 and July 21 meeting minutes and approved the consent agenda. It then voted to appoint Keith Miller, John Elsesser, Ashlee Pascarelli, and Shawn Fillmore to designated committees and districts. All votes were unanimous.

Fri Aug 1, 2025

Planning & Zoning Commission

Planning & Zoning Commission to conduct site walk for Boston Turnpike subdivision

The Planning and Zoning Commission is holding a special meeting for a site walk. The commission will review a proposal to create a three-lot subdivision on the south side of Boston Turnpike.

zoningsubdivisionland-useboston-turnpike
Mon Jul 28, 2025

Planning & Zoning Commission

Commission to review subdivision and special permit applications

The Planning & Zoning Commission will hold a public hearing and discuss a three-lot subdivision on Boston Turnpike. The body will also consider a lot line revision and a special permit for a home rebuild on a non-conforming lot.

zoningsubdivisionhousingland-usespecial-permits
✓ Decided: Commission unanimously approved lot line revision for parcels at 253 Parker Bridge Road

The Planning & Zoning Commission approved two agenda additions, including a high‑school HVAC easement referral and an Oswa LLC special permit notice. It also approved a lot line revision for parcels 3 and 4 at 253 Parker Bridge Road, finding the reconfigured lots meet zoning requirements. The commission postponed further discussion of waivers for the three‑lot subdivision and scheduled a continuation meeting on August 11.

Mon Jul 28, 2025

Town Council

Town Council Steering Committee to review town charter and local ordinances

The Town Council Steering Committee will discuss potential changes to the Parks and Recreation Commission ordinance and the Town Charter. The committee will also consider an extension for the Firearms Safety-Home Shooting Range Study Committee and review several board appointments.

town-charterparks-and-recreationappointmentsfirearms-safetyordinances
✓ Decided: Council approved several appointments and debated extending the firearms safety committee.

The council unanimously accepted the June 23, 2025 minutes. It agreed to continue the Parks and Recreation ordinance review at a future meeting. Several appointments were approved, while one failed due to lack of a second. A motion to extend the Firearms Safety/Home Shooting Range Study Committee term was presented, but the outcome was not recorded.

Mon Jul 28, 2025

Inland Wetlands Agency

Coventry Inland Wetlands Agency to hold special meeting on July 28

The Inland Wetlands Agency will hold a special meeting via Zoom. The agenda consists of procedural boilerplate, primarily focusing on the adoption of previous meeting minutes.

proceduralwetlandspublic-meeting
✓ Decided: Agency approved the June 25, 2025 meeting minutes with amendments

The Inland Wetlands Agency adopted the May 28, 2025, June 25, 2025, and July 23, 2025 meeting minutes after making listed corrections. All three adoption motions passed unanimously with no votes against. A proposal to remove Ken Slater from attendance received no action.

Thu Jul 24, 2025

Economic Development Commission

Economic Development Commission to discuss communications and local markets

The Economic Development Commission will hold a special meeting to review updates on the Farmers’ Market and CT Countryside. The body will also discuss social media and communications.

economic-developmentcommunicationsfarmers-marketagriculture
Wed Jul 23, 2025

Senior and Affordable Housing Alternatives Study Committee

July 23 Senior and Affordable Housing Alternatives Study Committee meeting cancelled

The July meeting of the Ad-Hoc Senior & Affordable Housing Alternatives Study Committee is cancelled. The next regular meeting is scheduled for August 27, 2025.

housingsenior-housingaffordable-housing
Wed Jul 23, 2025

Inland Wetlands Agency

Inland Wetlands Agency to review subdivision and construction permits

The Inland Wetlands Agency will discuss several land-use applications involving construction in upland review areas. The body will also address an enforcement matter regarding material deposition at a residential property.

wetlandszoningland-useconstructionenvironment
✓ Decided: IWA approved enforcement action for 77 Tall Oak Drive and a driveway permit on Brewster St

The agency voted unanimously to direct staff to work with the town attorney on enforcement for 77 Tall Oak Drive. It also unanimously approved the Brewster Street driveway permit (WP‑25‑16) with standard conditions and a reduced apron width.

Wed Jul 23, 2025

Inland Wetlands Agency

Inland Wetlands Agency to discuss violation at 77 Tall Oak Drive

The Inland Wetlands Agency is holding a special meeting to conduct an executive session. The body will discuss an ongoing violation at 77 Tall Oak Drive.

wetlandsenvironmental-regulationcode-violation
✓ Decided: Agency approved executive session to discuss Tall Oak Drive violation

The Inland Wetlands Agency moved to enter an executive session to discuss an ongoing violation at 77 Tall Oak Drive. The motion was seconded and unanimously approved by the members present. The session began at 6:30 p.m. and concluded at 7:24 p.m.

Tue Jul 22, 2025

Zoning Board of Appeals

Zoning Board to conduct site walk for 9 Wolf Hill Road variance request

The Zoning Board of Appeals is holding a special meeting for a site walk at 9 Wolf Hill Road. This is an informational visit; no formal discussion or decisions will occur until the next public hearing.

zoningvarianceland-usesetback
Tue Jul 22, 2025

America 250 | Coventry CT Committee

Coventry Committee discusses planning for America 250 celebrations

The America 250 | Coventry CT Committee is meeting to discuss event planning and community outreach. The body will review progress on parade coordination, a history scavenger hunt, and an encampment.

community-eventsamerica-250local-historyfundraising
✓ Decided: Town meeting approved minutes and adjourned without substantive decisions

The committee unanimously accepted the previous meeting minutes. The meeting was then unanimously adjourned. No other substantive actions were approved, denied, or tabled.

Mon Jul 21, 2025

Town Council

Town Council to consider Town Manager performance survey

The Coventry Town Council will meet to discuss administrative updates and potential changes to meeting start times. The body is considering the adoption of a staff survey for the Town Manager's annual performance evaluation.

town-managerbudgetadministrationeducationlegislation
✓ Decided: Council unanimously approves 7 PM meeting start and adopts consent agenda

The Town Council voted to accept the consent agenda, with all six members present voting in favor. The Council also amended its Standing Rules of Procedure to set the regular meeting start time at 7:00 PM, again with unanimous approval. No other substantive actions were decided at this meeting.

Thu Jul 17, 2025

Firearms Safety/Home Shooting Range Study Committee

Firearms Safety/Home Shooting Range Study Committee meeting cancelled

The regular meeting scheduled for July 17, 2025, was cancelled. The Town Manager cited a lack of agenda items as the reason for the cancellation.

firearms-safetyshooting-rangecancelled-meeting
Thu Jul 17, 2025

Cemetery Commission

Coventry Cemetery Commission to review tree maintenance and family correspondence

The Cemetery Commission will meet to review financial statements and receive reports from Public Works and the Sexton. The body will discuss tree maintenance at NHC and the Chapman lot, as well as draft letters to families.

cemeterieslandscapingpublic-worksmaintenance
✓ Decided: Commission approves June minutes and multiple cemetery lot sales

The Cemetery Commission approved the minutes from the June 19, 2025 meeting by a 4‑0 vote. It approved two cemetery lot sales, issuing permits for Lot 7 to the Duvals and Boothroyd ($150) and for Lot 119 to the Gitsis family and Hart ($800). The commission also recorded several cremains and casket interments that took place in July. No other substantive actions were taken.

Tue Jul 15, 2025

Zoning Board of Appeals

Zoning Board of Appeals to hear variance requests for two properties

The Zoning Board of Appeals will hold public hearings for two variance requests. The board will determine if these properties can deviate from standard zoning regulations regarding setbacks and lot coverage.

zoningvariancesland-usesetbacks
✓ Decided: ZBA approves shed variance for 207 Lakeview Drive and tables other application

The Zoning Board of Appeals unanimously approved a variance allowing a 10' × 10' × 9' wooden shed at 207 Lakeview Drive with an 18.45% lot coverage. The board tabled the variance request for 9 Wolf Hill Road (ZBA‑25‑9) and scheduled a special site‑walk meeting, continuing the discussion at the August 19 2025 meeting.

Mon Jul 14, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Committee to hold working session on 2016 Lake Management Plan

The Coventry Lake Advisory & Monitoring Committee will meet to discuss lake maintenance and planning. The body will hold a working session regarding the January 2016 Coventry Lake Management Plan.

environmentlake-managementwater-qualitypublic-planning
✓ Decided: Committee approved June 9, 2025 meeting minutes

The Coventry Lake Advisory & Monitoring Committee approved the minutes from the June 9, 2025 meeting. The motion was made by Chair Zeppa, seconded by Ken Staten, and passed with votes in favor from Charles Brown, Ken Staten, Richard Pearson, and Debby Zeppa; Amanda L’Etoile abstained. No other decisions were made at this meeting.

Mon Jul 14, 2025

Town Council

Finance Committee to review HVAC project and veterans' tax exemptions

The Town Council Finance Committee will review the school HVAC project and consider adding a ballot question to transfer energy project funds to that project. The committee will also discuss expanded residential property tax exemptions for veterans and conduct a historical review of the preschool account.

hvactaxesveteransschoolsbudget
✓ Decided: Finance Committee unanimously approves June 9 minutes; HVAC funding debated

The committee voted unanimously to accept the June 9, 2025 Finance Committee minutes. Members discussed concerns about property‑tax assessment rounding and the ongoing HVAC project, including cost overruns, transformer changes, and possible use of energy‑bond funds. No formal action or authorization on the HVAC funding was taken, leaving the matter for future consideration.

Mon Jul 14, 2025

Planning & Zoning Commission

Coventry Planning and Zoning Commission meeting cancelled

The regular meeting scheduled for July 14, 2025, has been cancelled. The cancellation is due to a lack of business.

planning-and-zoningmeeting-cancellation
Thu Jul 10, 2025

Human Rights Commission

Human Rights Commission to discuss DEI executive orders and volunteer policies

The Human Rights Commission will meet to discuss the impact of federal Executive Orders concerning DEI on town policies. The body will also review the Volunteer Handbook regarding the new Town Ethics Ordinance and attendance policy.

human-rightsdeiethicstown-policyvolunteers
Thu Jul 10, 2025

Town Council

Joint Town Council Finance and Board of Education Fiscal Committee meeting canceled

The joint meeting scheduled for July 10, 2025, has been canceled. A special Finance Committee meeting is now scheduled for July 14, 2025.

town-councilboard-of-educationfinance
Tue Jul 8, 2025

Housing Authority

Coventry Housing Authority meeting canceled

The Coventry Housing Authority monthly meeting scheduled for Tuesday, July 8, 2025, has been canceled.

housing
Mon Jul 7, 2025

Town Council

Town Council to consider pollinator-friendly and native plant resolution

The Coventry Town Council will meet to discuss a resolution regarding native plants and pollinator-friendly landscaping. The body will also consider several board appointments and a request to move unexpended Board of Education funds into a reserve fund.

environmentappointmentseducation-budgetgovernment-administration
✓ Decided: Council appoints three land‑use officials and approves consent agenda

The council unanimously accepted the May 27, June 16 and June 23 Town Council meeting minutes with the listed edits. The consent agenda was approved after a member requested item 9.A be removed for discussion. The council appointed Richard Mannarino to the Building Code Board of Appeals and appointed Kathleen Krider and Keith Miller as alternates to the Planning & Zoning Commission. The review of the Parks and Recreation Commission ordinance was continued to the next steering committee meeting.

Thu Jul 3, 2025

School Energy & Building Efficiency Building Committee

Committee to review school HVAC and roof projects

The School Energy and Building Efficiency Building Committee will review financial statements and project schedules. The body will discuss the CHS Roof and Unit Ventilator/HVAC projects and review several payment applications and change orders from Pro-Mech.

schoolshvacenergy-efficiencyconstructionbudget
✓ Decided: Committee approved $365,132.32 Pro‑Mech payment and several change orders

The School Energy & Building Efficiency Committee authorized a $365,132.32 payment to Pro‑Mech and approved four additional change orders ranging from $5,165.10 to $17,233.31. The minutes from the June 18, 2025 meeting were accepted, and the meeting was adjourned at 7:38 PM. All actions were approved unanimously.

Wed Jul 2, 2025

Conservation Commission

Conservation Commission to review Boston Turnpike Subdivision site plan

The Conservation Commission will meet to discuss a site plan referral for the Boston Turnpike Subdivision. The body will also address vernal pool mapping and a land use forum.

conservationland-usezoningenvironmentsite-plan
✓ Decided: Conservation Commission adjourned meeting unanimously

The commission voted to adjourn the July 2 meeting at 9:03 p.m. with all members in favor. A motion to approve the June minutes was made and seconded, but the record does not state the vote outcome. No other substantive actions were decided.

Mon Jun 30, 2025

Parks & Recreation Commission

Parks & Recreation Commission to discuss facility use and ordinances

The Parks & Recreation Commission will hold a special meeting to discuss a Board of Education facility use policy change and a commission ordinance. The body will also review a request for special use of Creaser Park.

parks-and-recreationfacility-useordinancescreaser-park
✓ Decided: Commission approved special use of Creaser Park on Aug 30, 2025

The commission voted to allow Katelyn Mastroianni special use of Creaser Park on August 30, 2025. The motion was made by Beverly Carlson, seconded by Pam Miller, and affirmed by Jennifer Rodgers, Jillian Miner, Beverly Carlson, and Pam Miller. No vote was taken on the Vale Sports Club agreement, and the pending revisions to the Parks & Recreation ordinance were discussed without a formal decision.

Thu Jun 26, 2025

Economic Development Commission

June 26 Economic Development Commission meeting cancelled

The Economic Development Commission meeting scheduled for June 26, 2025, has been cancelled. This allows members to attend the Community Land Use Forum on June 30.

meeting-cancellationeconomic-developmentland-use
Wed Jun 25, 2025

Senior and Affordable Housing Alternatives Study Committee

June 25 Senior and Affordable Housing Alternatives Study Committee meeting cancelled

The regular meeting of the Ad-Hoc Senior & Affordable Housing Alternatives Study Committee scheduled for June 25, 2025, was cancelled. The cancellation was due to a lack of quorum.

housingsenior-housingaffordable-housing
Wed Jun 25, 2025

Inland Wetlands Agency

Inland Wetlands Agency to review water main and subdivision applications

The Inland Wetlands Agency will discuss several land-use applications, including a town water main extension and a 3-lot subdivision. The body will also address an enforcement matter regarding material deposition at 77 Tall Oak Drive.

wetlandszoningwater-infrastructuresubdivisionland-use
✓ Decided: Inland Wetlands Agency unanimously approved water main extension and driveway projects

The agency approved the Plains Road and South Street Extension water‑main project (item #25‑11) after a unanimous vote. It also approved the CT Route 44/Boston Turnpike driveway and storm‑water control project (item #25‑12) by unanimous vote. Both motions passed with all members voting in favor and no opposition.

Tue Jun 24, 2025

Inland Wetlands Agency

Inland Wetlands Agency conducts Low Impact Development site visit at UCONN

The Low Impact Development Work Group is meeting at the UCONN Storrs Campus for a technical site review. The group will examine residential LID installations and discuss design, maintenance, and tracking criteria.

wetlandslow-impact-developmentstormwatertraininguconn
✓ Decided: Inland Wetlands Agency held an informal LID work group meeting

On June 24, 2025 the Coventry Inland Wetlands Agency LID Work Group met informally at the UConn Storrs Campus. Participants introduced themselves and outlined the group’s vision, mission, and goals. The discussion covered stakeholder outreach, LID policy, design criteria, education, and a review of existing LID structures. No formal actions, approvals, or votes were recorded.

Tue Jun 24, 2025

America 250 | Coventry CT Committee

Coventry Committee discusses planning for America 250 celebrations

The America 250 committee is meeting to coordinate various commemorative events and outreach. Members will discuss parade planning, historical sites, and community activities.

community-eventshistoryamerica-250tourism
✓ Decided: Committee accepted minutes and adjourned; no substantive actions taken

The committee unanimously approved the prior meeting minutes and then unanimously voted to adjourn the meeting at 7:56 p.m. No other decisions, approvals, or denials were recorded.

Mon Jun 23, 2025

Planning & Zoning Commission

Commission to consider veterinary hospital permit at 2208 Boston Turnpike

The Planning & Zoning Commission will hold a public hearing and discuss a special permit for a veterinary hospital. The body will also review a site plan waiver and two land subdivision requests.

zoningland-usesubdivisioncommercial-development
✓ Decided: Commission unanimously approves special permit for veterinary hospital

The Planning & Zoning Commission approved the special permit application (PZC-25-5) for Eterna Veterinary Wellness and Urgent Care at 2208 Boston Turnpike, finding it meets commercial‑zone criteria and listed conditions. The commission also approved a site‑plan waiver for Andrew Ladyga’s 2812 Boston Turnpike project (first phase of Special Permit 10‑02S), allowing implementation without additional site work. Both motions were adopted unanimously with all five voting members in favor and none against or abstaining.

Mon Jun 23, 2025

Town Council

Town Council Steering Committee to review Parks and Recreation ordinance

The Town Council Steering Committee will consider changes to the Parks and Recreation Commission ordinance. The body will also discuss a resolution regarding pollinator-friendly and native plants on town-owned property.

parks-and-recreationordinancesenvironmentappointments
✓ Decided: Council appointed Richard Mannarino to Building Code Board of Appeals

The council unanimously accepted the minutes from May 27 and June 2, 2025. Valrie Peters announced her resignation from the Conservation Commission. The council unanimously appointed Richard Mannarino to the Building Code Board of Appeals and appointed Kathleen Krider and Keith Miller as alternates to the Planning & Zoning Commission. The council also unanimously voted to review the proposed Parks & Recreation ordinance changes.

Mon Jun 23, 2025

Town Council

Town Council to consider mill rate and COVRRA rates for FY 2025/26

The Town Council is holding a special budget meeting to determine the mill rate for the 2025/26 fiscal year. The council will also consider the establishment of COVRRA rates for the same period.

budgettaxesmill-ratefinance
✓ Decided: Council sets FY2026 mill rate and keeps waste fees unchanged

The Town Council approved a FY2026 mill rate of 23.76 mil for real estate, personal property and motor vehicle taxes. It also approved COVRRA tipper barrel rates of $382 for 95‑gallon, $332 for 60‑gallon and $302 for 35‑gallon containers. Finally, the council voted to maintain the current transfer station fee schedule for FY2026. All three motions passed unanimously (7‑0).

Thu Jun 19, 2025

Parks & Recreation Commission

Parks & Recreation Commission to consider Veteran’s Memorial proposal

The commission will meet to discuss a proposal for a Veteran’s Memorial presented by Peter DePaola. The body will also review a Board of Education request regarding the design of Patriots Park.

parks-and-recreationveterans-memorialpatriots-parkpublic-facilities
✓ Decided: Commission approved the Veterans Memorial proposal

The Parks & Recreation Commission approved a request to amplify sound for a free concert in Creaser Park on June 27, 2025. The commission also approved the minutes from the May 8, 2025 meeting. A special commission meeting was scheduled for June 30, 2025 via Zoom. Finally, the Veterans Memorial presented by Peter DePaola was approved.

Thu Jun 19, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee reviews draft firearms ordinance and council presentation

The Firearms Safety/Home Shooting Range Study Committee is reviewing a draft firearms ordinance and a presentation for the council. The committee will also discuss the redaction of shooter names and updates to the volunteer handbook.

firearmsordinancepublic-safetyshooting-range
✓ Decided: Committee votes to send draft firearms ordinance to Town Council

The Firearms Safety/Home Shooting Range Study Committee unanimously approved the minutes from the May 15, 2025 meeting. It also voted unanimously to present the draft firearms ordinance to the Town Council for review, with a report to be submitted by July 3 and the agenda set for the July 7 council meeting. The committee plans a public comment meeting in August if the council moves forward.

Thu Jun 19, 2025

Cemetery Commission

Coventry Cemetery Commission to meet June 19

The Cemetery Commission will meet to review financial statements and receive reports from Public Works and the Sexton. The body will also discuss Wreaths Across America and a Facebook update.

cemeteriespublic-workscommunity-events
✓ Decided: Commission approves monument markers and adopts new ethics policy

The Cemetery Commission approved the meeting minutes with a 5‑0 vote. It approved three monument marker applications for Grant Hill Cemetery and Coventry Cemetery. Commissioners signed the town's new Ethics Policy for serving on committees. The commission plans to move its online presence from Facebook to the DPW website.

Wed Jun 18, 2025

Inland Wetlands Agency

Inland Wetlands Agency Work Group to review Low Impact Development plans

The Coventry IWA LID Work Group is meeting to review an updated work plan and FAQ document. The group will discuss a presentation for the June 30, 2025 Land Use Forum and coordinate a site visit to UCONN on June 24.

wetlandsstormwaterland-useenvironmental-planning
✓ Decided: Work group reviewed drafts and set timelines; no formal approvals made

The Inland Wetlands Agency LID Work Group reviewed and accepted the draft May 19 meeting notes. Members continued editing the Work Plan and FAQ draft, aiming to post a final draft online by June 23. They also revised the PowerPoint slide deck, targeting a final version online by June 27. The group scheduled a UConn LID site visit for June 24 and indicated the next meeting will occur in August, date to be determined.

Wed Jun 18, 2025

School Energy & Building Efficiency Building Committee

Committee to review school roof and HVAC project progress

The School Energy and Building Efficiency Building Committee will review financial statements and project updates. The meeting focuses on the CHS roof project and unit ventilator/HVAC installations.

schoolshvacenergy-efficiencyinfrastructurebudget
✓ Decided: Approved $676,497.42 Pro‑Mech payment application 15

The committee approved the May 1, 2025 meeting minutes and unanimously voted to table the June financial statements until the next meeting. It authorized a $1,517.75 payment to QA+M for a roof inspection and a $676,497.42 payment to Pro‑Mech for its application 15. The meeting was then adjourned.

Tue Jun 17, 2025

Zoning Board of Appeals

Zoning Board to consider front yard setback variance for 861 Main Street

The Zoning Board of Appeals will hold a public hearing regarding a requested variance for a property in the GR-40 Zone. The board will also review meeting minutes and a handbook for officials.

zoningvariancepublic-hearingland-use
✓ Decided: ZBA approves variance to reduce front yard setback at 861 Main St

The board unanimously approved a variance allowing the front‑yard setback on the Armstrong Road side of 861 Main Street to be reduced from 50 feet to 30 feet for an above‑ground pool. The May 20, 2025 meeting minutes were also approved without opposition. Members signed the acknowledgment page for the April 7, 2025 handbook for elected and appointed officials.

Mon Jun 16, 2025

Town Council

Town Council to hold public hearing on 2025 Neighborhood Assistance Act

The Town Council will conduct a public hearing and consider applications for the 2025 Neighborhood Assistance Act. The body will also review year-end budget transfers for FY 24/25 and a transfer to support the FY 25/26 proposed budget.

budgetneighborhood-assistance-acttaxespublic-hearing
✓ Decided: Council approved prior meeting minutes and consent agenda

The Town Council voted to accept the April 14, 2025 and June 2, 2025 meeting minutes. The consent agenda was also approved. No other substantive actions were taken during this meeting.

Thu Jun 12, 2025

Parks & Recreation Commission

June 12 Parks & Recreation Commission meeting canceled

The regular meeting scheduled for June 12, 2025, has been canceled. A special meeting is scheduled for June 19, 2025.

parks-and-recreationscheduling
Thu Jun 12, 2025

Water Pollution Control Authority

WPCA to discuss sewer capacity for 28/30 Mason Street Mills

The Water Pollution Control Authority will review sewer capacity and septic construction for 28/30 Mason Street Mills. The body will also discuss sewer system capacity, budget review, and a sewer assessment and rate increase.

sewerinfrastructurebudgetwater-pollution
✓ Decided: WPCA approved minutes from the May 8, 2025 meeting

The Authority voted to approve the minutes of the May 8, 2025 public hearing and regular meeting. All three members present voted in favor, with no votes against or abstentions. No other substantive actions were decided at this meeting.

Tue Jun 10, 2025

Housing Authority

Coventry Housing Authority to review expenditures and new town policies

The Housing Authority will meet to review and approve expenditures and discuss new policies adopted by the Town Council. The meeting includes updates on Orchard Hill and Orchard Hill II.

housingbudgetpolicyorchard-hill
✓ Decided: Housing Authority approved May minutes, treasurer's report and expenditures unanimously

The board approved the May 13, 2025 meeting minutes, the amended May treasurer’s report, and the May expenditures without discussion. All approvals were passed unanimously. The meeting was then adjourned unanimously.

Mon Jun 9, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Committee to discuss management plan and lake maintenance

The Coventry Lake Advisory & Monitoring Committee will meet to provide updates on lake maintenance and budget items. The group will hold a working session regarding the January 2016 Coventry Lake Management Plan.

lake-managementwater-qualityenvironmentpublic-planning
✓ Decided: Committee approved May 12 meeting minutes

The Coventry Lake Advisory & Monitoring Committee approved the minutes from the May 12, 2025 regular meeting. The motion passed with five votes in favor and none against. Members also signed acknowledgment forms for the town handbook on ethics and attendance policies.

Mon Jun 9, 2025

Planning & Zoning Commission

Commission reviews veterinary hospital permit and Boston Turnpike developments

The Planning & Zoning Commission will discuss a special permit for a veterinary hospital and two proposed developments on Boston Turnpike. The body will also address a subdivision plan extension for Kings Rd.

zoningcommercial-developmentveterinary-servicesland-usesubdivisions
✓ Decided: PZC approves 90-day extension for Kings Rd subdivision plans

The Coventry Planning and Zoning Commission unanimously approved a 90-day extension for filing record subdivision plans for PZC-24-12 (Kings Rd), with a new deadline of September 24, 2025. The commission also unanimously approved a waiver of the site plan requirement for a proposed veterinary hospital at 2208 Boston Turnpike. Two preliminary discussions were held but no decisions were made on those items.

Mon Jun 9, 2025

Town Council

Finance Committee to consider FY 24/25 year-end and budget transfers

The Town Council Finance Committee will review monthly financial reports and Board of Education fiscal reports from April 2025. The committee may take action on year-end transfers for FY 24/25 and a transfer request to support the proposed FY 25/26 budget.

budgetfinanceeducationtown-council
✓ Decided: Finance Committee approves FY 24/25 transfers and budget recommendations

The committee accepted the May 12, 2025 Finance Committee minutes. It unanimously approved the FY 24/25 Year End Transfers and the FY 24/25 Transfer Requests to support the FY 25/26 proposed budget. The meeting was then adjourned at 7:56 PM.

Thu Jun 5, 2025

School Energy & Building Efficiency Building Committee

School Energy and Building Efficiency Building Committee meeting cancelled

The regular meeting scheduled for June 5, 2025, was cancelled. The cancellation was due to a lack of quorum.

cancelled-meetingschool-buildingsenergy-efficiency
Thu Jun 5, 2025

Local Emergency Coordinating Committee

Local Emergency Coordinating Committee meeting canceled

The Local Emergency Coordinating Committee meeting scheduled for June 5, 2025, has been canceled.

emergency-managementmeeting-cancellation
Wed Jun 4, 2025

Conservation Commission

Coventry Conservation Commission to discuss vernal pool mapping and tree planting

The Conservation Commission will meet to review new business including vernal pool mapping, tree planting, and a land use forum. The body will also address ongoing projects regarding the Rose Williams property and Patriots Park Woods Trail.

conservationenvironmentland-usemapping
✓ Decided: Commission approved meeting minutes and adjourned unanimously

The commission reviewed the June 4 minutes and a motion to approve them was made and seconded, though no vote result was recorded. Members discussed recent trail projects, a pending resignation, and upcoming events. A motion to adjourn was made, seconded and approved by all members at 8:03 PM.

Wed Jun 4, 2025

Energy Conservation / Alternative Energy Advisory Committee

Energy Conservation/Alternative Energy Advisory Committee meets June 4

The committee will meet to approve previous meeting minutes and address old and new business. No specific topics or proposals are listed on the agenda.

energy-conservationalternative-energy
✓ Decided: Town will replace the free-to-charge EV charger at Town Hall using grant funds

The committee approved the October 2, 2024 and May 7, 2025 meeting minutes. Members signed the revised ethics policy. The free-to-charge EV charger at Town Hall will be replaced tomorrow with funding from the IES Amp Up grant program. The committee also agreed to submit a DCFC grant application with Titan Energy and to apply for a DEEP air‑sensor loan for the library and farmers market.

Mon Jun 2, 2025

Town Council

Town Council Steering Committee to review board appointments and resignations

The Town Council Steering Committee will meet to process several board and commission appointments and resignations. The committee will also receive an update on the Human Rights Commission and discuss a potential ordinance change for the Parks and Recreation Commission.

appointmentsboards-and-commissionsparks-and-recreationzoning
✓ Decided: Town Council appoints three members to key committees, all unanimously

The council unanimously accepted the minutes from the April 28, 2025 meeting. It acknowledged the resignation of a School Energy/Building Efficiency Committee member. The council unanimously approved appointments of William Bailey to the Farmers' Market Operating Committee, Tim Liptrap to the Economic Development Commission, and Kayla Chamberlain to the Human Services Advisory Board.

Mon Jun 2, 2025

Town Council

Town Council to consider Community Development Block Grant and Fair Housing plan

The Coventry Town Council will consider a resolution to execute an assistance agreement for a Community Development Block Grant and a Fair Housing Action Plan. The council will also review recommended appointments for town committees and a legal notice for a special budget meeting.

grantshousingappointmentsbudget
✓ Decided: Town Council appointed Tim Liptrap to the Economic Development Commission

The council approved the minutes from the May 12 and May 19 meetings and accepted the consent agenda. It appointed William Bailey to the Farmers' Market Operating Committee, Tim Liptrap to the Economic Development Commission, and Kayla Chamberlain to the Human Services Advisory Committee. All appointments were approved unanimously.

Wed May 28, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee reviews zoning and housing proposals for seniors and affordable housing

The Coventry Senior and Affordable Housing Alternatives Study Committee meets to review draft zoning regulations for two-family residences and a draft request for proposals for a Housing Authority property. The meeting also includes routine procedural items such as roll call and adoption of prior minutes.

zoninghousingsenior-housingaffordable-housingcoventry
✓ Decided: Adoption of April 23 minutes was postponed

The committee did not adopt the April 23, 2025 meeting minutes, tabling them for consideration at the next meeting. Members discussed a draft zoning definition and a draft RFP for the Housing Authority property, but no formal actions were approved.

Wed May 28, 2025

Inland Wetlands Agency

Coventry Inland Wetlands Agency to review water main extension and driveway construction

The Coventry Inland Wetlands Agency will hold a hybrid meeting to discuss new business items, including a water main extension along Plains Road and South Street and a driveway construction project on CT Route 44. The agency will also review enforcement actions, adopt meeting minutes, and discuss policy updates and quarterly reports.

wetlandswater-mainstormwaterenforcementpolicyhybrid-meeting
✓ Decided: Inland Wetlands Agency approved the Plains Road water‑main project

The agency accepted project #25-11 to install a six‑inch water main from Upton Drive along South Street Extension to 225 Plains Road, serving five homes with contaminated wells. Funding will come from a Department of Public Health grant, a loan‑forgiveness program, and a $300,000‑$750,000 federal grant. No decision was made on the Route 44 driveway project (#25-12), which was asked to return with a full site plan.

Tue May 27, 2025

Planning & Zoning Commission

Coventry Planning and Zoning Commission meeting cancelled

The regular meeting scheduled for May 27, 2025, has been cancelled. The agenda states this is due to a lack of business.

planning-and-zoningmeeting-cancellation
Tue May 27, 2025

Town Council

Town Council Steering Committee to review board appointments and resignations

The Town Council Steering Committee will meet to process several board appointments and a resignation. The committee will also discuss a potential change to the Parks and Recreation Commission ordinance, though it is noted as not ready for action.

appointmentsgovernmentparks-and-recreationzoning
✓ Decided: Council unanimously postponed all agenda items to a future special meeting

The council voted to continue all agenda items to a future special meeting, with all members present voting in favor. A motion to adjourn the meeting was also passed unanimously. No other actions were taken.

Tue May 27, 2025

Town Council

Town Council to deliberate 2025/2026 budget

The Town Council is holding a special meeting to deliberate the 2025/2026 budget. The council will review revenue and expenditure projections and call for a public hearing on June 5, 2025.

budgetpublic-hearingeducationfinance
✓ Decided: Town Council discussed budget options but took no formal action

The council reviewed three proposed budget options, examined police staffing and overtime issues, and considered interest income and grant adjustments. No votes or formal approvals were recorded. The meeting remained a discussion of potential cuts and revenue projections.

Tue May 27, 2025

America 250 | Coventry CT Committee

Coventry committee plans 250th-anniversary events for June 24 meeting

The Coventry, CT America 250 committee will meet on May 27 at the Nathan Hale Homestead to review past minutes, hear reports, and brainstorm ideas for the town’s 250th-anniversary events. The group will also discuss social media outreach and community involvement.

america-250coventrycommunity-eventsplanninglocal-committee
✓ Decided: Committee unanimously accepted minutes and adjourned the meeting

The council unanimously approved the previous meeting minutes. The meeting was then adjourned at 8:01 p.m. by unanimous vote. No other substantive actions were decided.

Thu May 22, 2025

Economic Development Commission

Coventry Economic Development Commission to elect officers and discuss communications

The Economic Development Commission will hold a special meeting to elect its officers. The body will also discuss social media, communications, and updates regarding the Farmers' Market and CT Countryside.

economic-developmentfarmers-marketcommunicationsgovernment-administration
✓ Decided: Tim Liptrap elected Chairman and Justin Murphy Vice Chairman of the EDC

The commission unanimously approved the minutes from the February 27, 2025 meeting. Tim Liptrap was unanimously elected Chairman of the Economic Development Commission. Justin Murphy was unanimously elected Vice Chairman. No other substantive actions were decided.

Thu May 22, 2025

Economic Development Commission

Coventry’s Economic Development Commission plans 2025 Farmers’ Market season and WiFi upgrade

The Coventry Economic Development Commission will hold a special meeting to finalize the 2025 Farmers’ Market season schedule, discuss a WiFi upgrade for the market area, and adopt a handbook for elected and appointed officials and volunteers. The meeting will also include routine items such as roll call, adoption of minutes, and setting the next meeting date.

farmers-marketwifieconomic-developmentcoventry-ctplanning
✓ Decided: Commission approved May 1, 2025 meeting minutes

The Economic Development Commission approved the minutes from the May 1, 2025 meeting. CT Landmarks approved placement of the historic wooden sign near the market barn. No other motions were recorded.

Tue May 20, 2025

Zoning Board of Appeals

Zoning Board of Appeals to hear variance requests for two properties

The Zoning Board of Appeals will hold public hearings regarding two variance requests. The board will also consider the approval of meeting minutes from April 15, 2025.

zoningvarianceland-use
✓ Decided: ZBA approves two variances for 5 John Hand Drive and 96 Avery Shores

The Zoning Board of Appeals unanimously approved a variance to allow a vertical expansion at 5 John Hand Drive in the LR Zone. It also unanimously approved a variance to increase lot coverage to 16.81% at 96 Avery Shores in the LR Zone. Additionally, the board approved the minutes from the April 15, 2025 regular meeting.

Mon May 19, 2025

Inland Wetlands Agency

Inland Wetlands Agency Work Group to review Coventry Lake water quality

The Low Impact Development Work Group is meeting to finalize its organizational structure, vision, and work plan. The group will discuss water quality at Coventry Lake and plan a site visit to UCONN. Members will also determine the group's role in the June 30, 2025, Land Use Forum.

wetlandswater-qualityenvironmental-planningstormwater-management
✓ Decided: Meeting reviewed notes, accepted draft edits, and assigned outreach tasks

The work group accepted the April 29 meeting notes with a spelling correction and approved proposed edits to the draft work plan and mission. Action items were assigned for outreach, site visits, and a June 24 UConn visit. The next meeting was scheduled for June 18 at 10:00 am. No formal votes were recorded.

Mon May 19, 2025

Town Council

Town Council to deliberate 2025/2026 budget and consider audit acceptance

The Coventry Town Council will deliberate the proposed 2025/2026 budget as unfinished business and consider accepting the 2024/2025 audit. They will also vote on a proposal for audit services for the current fiscal year and review applications under the Neighborhood Assistance Act, scheduling a public hearing for June 16. The meeting includes monthly financial and department statistics reports.

budgetaudittown-councilneighborhood-assistance-actpublic-hearingpolicefire-emsfinance
✓ Decided: Council unanimously approved moving Agenda Item 3.A up the agenda

The council voted unanimously to move Agenda Item 3.A ahead of the Audience of Citizens. No other motions or votes were recorded. The remainder of the meeting consisted of public comments on education funding and the town budget.

Thu May 15, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee reviews draft firearms ordinance language

The Firearms Safety/Home Shooting Range Study Committee will review draft language for a proposed firearms ordinance, approve minutes from past meetings, and review questions for Chief Peterson. The committee will also discuss progress on an ordinance background presentation and future citizen feedback.

firearms-safetyhome-shooting-rangeordinancepublic-safetystudy-committeecoventry
✓ Decided: Committee unanimously approved April 17 meeting minutes

The Firearms Safety/Home Shooting Range Study Committee approved the minutes from the April 17, 2025 meeting by unanimous vote. The committee reviewed a draft firearms ordinance, noted attorney approval, and discussed distance and safety provisions but took no formal vote on the ordinance itself. They set a timeline to finish the draft ordinance and a presentation for the Town Council meeting on July 7, 2025, with the next committee meeting scheduled for June 19, 2025.

Thu May 15, 2025

Cemetery Commission

Coventry Cemetery Commission holds routine meeting May 15

The Coventry Cemetery Commission will convene a regular meeting on May 15, 2025, at 6:00 P.M. in the Department of Public Works Conference Room, 100 Olsen Farm Rd. The agenda includes standard procedural items, financial review, and reports from Public Works and the Sexton.

cemeteryproceduralpublic-worksfinance
Tue May 13, 2025

Housing Authority

Housing Authority to consider CDBG architect agreement and solar options

The Coventry Housing Authority will hold its monthly meeting to review and approve expenditures, discuss solar energy options, and vote on signing a CDBG architect agreement. The director will also provide updates on Orchard Hill Estates. The meeting includes standard items such as roll call, minutes approval, and public comment.

housingauthoritysolarcdbgorchard-hillexpendituresmeeting
✓ Decided: Housing Authority approves $43,500 CDBG contract and solar project deposit

The board unanimously approved the April meeting minutes, the April treasurer's report, and the April expenditures. It also approved a $1,500 deposit to move forward with the Earthlight solar project, with reimbursement contingent on installation. Finally, the board authorized Laurie Bradley to sign the CDBG architect agreement and approve $43,500 in preliminary engineering costs.

Tue May 13, 2025

Veterans Memorial & Events Commission

Commission discusses Memorial Day Parade and veteran monuments

The Veterans Memorial and Events Commission is meeting to coordinate the Memorial Day Parade. The body will also review a proposal for new veteran monuments previously presented to the TC Steering Committee.

veterans-affairspublic-eventsmonuments
✓ Decided: Commission approved March 11 meeting minutes by a 3‑0 vote

The Veterans Memorial & Events Commission approved the minutes from the March 11, 2025 meeting with a unanimous 3‑0 vote. Members reviewed the May 3 clean‑up of Veterans Memorial Park and recommended using a power washer for future clean‑ups. They noted the Town Council’s general approval of monument proposals for Desert Storm and the Global War on Terror, with further action to be taken at the next commission meeting. No new business was discussed.

Mon May 12, 2025

Coventry Lake Advisory & Monitoring Committee

Committee to review lake management plan, discuss hydrilla and water quality updates

The Coventry Lake Advisory & Monitoring Committee will hold a regular meeting to hear updates on lake gate, budget, the IWA Low Impact Development Work Group, hydrilla, and water quality. A working session on the 2016 Coventry Lake Management Plan is planned. New business includes discussion of a July Lake Awareness activity.

lake-managementhydrillawater-qualitybudgetcommunity-engagement
✓ Decided: Committee approved April 14, 2025 meeting minutes

The Coventry Lake Advisory & Monitoring Committee approved the minutes from the April 14, 2025 meeting. The motion was made by Chair Debby Zeppa, seconded by Ken Staten, and passed with three votes in favor and one abstention. No other actions were decided at this meeting.

Mon May 12, 2025

Town Council

Coventry Finance and Education committees to discuss 2025/26 budget

The Town Council Finance Committee and Board of Education Fiscal Committee will meet jointly to review an audit and March 2025 fiscal reports. The Finance Committee will also discuss HVAC project finances and the FY 2025/26 budget.

budgetauditeducationfinancehvac
✓ Decided: Finance Committee unanimously approves March 14 minutes

The committee voted unanimously to accept the March 14, 2025 Finance Committee minutes. The board discussed the upcoming audit services proposal for CLA and agreed the Finance Committee will recommend acceptance to the Town Council, but no vote was taken. Ongoing legal and ethical discussions were noted regarding financing of the HVAC project.

Mon May 12, 2025

Town Council

Town Council deliberates 2025/2026 budget and sets referendum timeline

The Coventry Town Council is holding a special budget meeting to deliberate the 2025/2026 budget and provide direction to the town manager. The council will also discuss a timeline for new budget meetings and a potential referendum.

budgettown-councilreferendumpublic-meeting
✓ Decided: Council discussed FY 25/26 budget but made no formal budget decisions

The council reviewed the proposed FY 25/26 budget, including a spending‑increase range of 2.25%‑3.1% and possible cuts such as pausing summer road work. Members exchanged views on revenue, expenses, and shared‑service options, and set a May 27 deadline for the final budget. No motions to approve or reject budget items were recorded; only a motion to adjourn was passed.

Mon May 12, 2025

Planning & Zoning Commission

Zoning map change proposed for 1409 Main Street; veterinary hospital discussed

The Planning and Zoning Commission will hold a public hearing (none scheduled) and consider a proposed modification of the Zoning Map to reclassify a 2.05-acre parcel at 1409 Main Street as Village Gateway Zone. They will also discuss a proposed veterinary hospital at 2208 Boston Turnpike with the applicants. Other business includes adoption of minutes and staff reports.

zoningplanningveterinarymap-amendmentmain-streetboston-turnpike
✓ Decided: Planning & Zoning Commission denied zoning change for 1409 Main St parcel

The commission withdrew the earlier motion to modify and approve the Village Gateway Zone change for 1409 Main Street. A new motion to deny the proposal was moved, seconded, and approved unanimously. The denial cites concerns about proximity to Coventry Lake, lot‑coverage limits, and impact on nearby residential areas.

Thu May 8, 2025

Parks & Recreation Commission

Possible action on beach sticker pricing; volunteer handbook and ordinance updates

The Coventry Parks & Recreation Commission will hold a regular meeting on May 8, 2025, to discuss and possibly act on several items. New business includes policy updates to the Volunteer Handbook, review of the Parks and Rec Commission Ordinance, and possible action on Beach Sticker Pricing. The commission will also hear staff reports on facilities, programs, and monthly finances, and address correspondence from two residents.

parksrecreationbeach-stickersvolunteer-handbookordinancefinancial-reportcommission-meeting
✓ Decided: Commission approved corrected April 10 meeting minutes

The Parks & Recreation Commission approved the minutes from the April 10, 2025 meeting with listed corrections, with all four present members voting yes. The newly adapted volunteer handbook was distributed to members, but no vote was taken. Discussion of beach sticker pricing resulted in no action; the item was tabled. No other substantive decisions were made.

Thu May 8, 2025

Water Pollution Control Authority

Coventry WPCA to hold public hearing on Fiscal Year 2026 sewer use rate increase

The Water Pollution Control Authority will hold a public hearing and meeting to discuss a sewer use rate increase for Fiscal Year 2026. The body will also consider sewer assessments for two specific properties and review sewer system capacity.

sewerratespublic-hearinginfrastructurebudget
✓ Decided: No actions taken; public comment on sewer rate increase

The Coventry Water Pollution Control Authority meeting on May 8, 2025 consisted of a public statement supporting a sewer use rate increase. No motions, votes, or approvals were recorded in the minutes. The minutes also noted the May 6, 2025 budget referendum results, showing the overall budget was rejected and the water line extension passed. No decisions were made by the Authority.

Wed May 7, 2025

Conservation Commission

Coventry Conservation Commission reviews $1,645.92 budget, trail, property

The Conservation Commission will hold its regular meeting on May 7, 2025, to discuss financial status, ongoing projects, and new initiatives. Items include a review of the remaining $1,645.92 budget, updates on the Patriots Park Woods Trail and Rose Williams Property, and new business such as vernal pool mapping, Earth Day plans, and a Land Use Forum.

conservationbudgettrailspropertyvernal-poolsearth-day
✓ Decided: Commission approved meeting minutes and adjourned the session

The commission voted to approve the meeting minutes. The meeting was then adjourned with all members voting to approve. The financial report noted $1,333.45 remaining in the budget. New business included discussion of Earth Day clean‑up results and possible use of remaining funds for compost bins, but no formal actions were taken.

Wed May 7, 2025

Energy Conservation / Alternative Energy Advisory Committee

Committee to approve minutes from two prior meetings

The Coventry Energy Conservation/Alternative Energy Advisory Committee is meeting on May 7, 2025. The agenda consists of routine procedural items: calling the meeting to order, receiving public comment, approving minutes from October 2, 2024 and April 2, 2025, and addressing old and new business. No specific substantive items are listed for discussion or decision.

energy-conservationalternative-energycommittee-meetingminutesproceduralcoventry
✓ Decided: Committee approved the April 2 2025 meeting minutes

The Energy Conservation/Alternative Energy Advisory Committee met online on May 7, 2025. After a brief call to order, members approved the April 2, 2025 minutes. No new business was considered and the meeting adjourned at 7:10 p.m.

Mon May 5, 2025

Town Council

Council to consider war memorials siting and composting facility grant

The Coventry Town Council will consider two proposals: siting new war memorials on Veterans Memorial Green and authorizing the town manager to execute a contract with the CT Department of Energy and Environmental Protection for a composting facility at the Transfer Station. The council will also recognize Officer Wayne Greener with a Senate Citation and hold an executive session to evaluate the town manager.

veteransparkscompostinggrantspublic-workstown-councilrecognition
✓ Decided: Town Council approved April minutes and accepted the consent agenda

The council voted to accept the April 21, 2025 meeting minutes after minor wording edits. A motion to adopt the consent agenda was also approved. Both actions received support from all voting members and faced no opposition.

Thu May 1, 2025

School Energy & Building Efficiency Building Committee

School energy committee to review CHS roof and HVAC projects, change orders

The School Energy and Building Efficiency Building Committee will review financial statements, discuss the Coventry High School roof and unit ventilator/HVAC projects, and consider Pro-Mech payment application 14 as well as change orders 2 and 3. They will also review project schedules and progress meeting notes from April 16 and 30. The meeting includes approval of April 3 minutes and other business.

school-energybuilding-efficiencychs-roofhvaccoventrychange-orderscapital-projects
✓ Decided: Committee authorized $602,219.25 payment to Pro‑Mech

The School Energy & Building Efficiency Committee approved the Pro‑Mech Payment Application 14 for $602,219.25. It also unanimously authorized two change orders—$90,036.55 for roof curb rails and $74,658.75 for wiring upgrades. The April 3 minutes were accepted and the meeting was adjourned at 7:20 PM.

Thu May 1, 2025

Economic Development Commission

Farmers' Market Committee plans 2025 season, wifi upgrade

The Ad-Hoc Farmers’ Market Operating Committee will hold a special meeting to plan for the 2025 season and discuss wifi upgrade work. Other items include adoption of minutes and scheduling future meetings.

farmers-marketplanningwificoventry
✓ Decided: Commission approved April 17 meeting minutes

The Economic Development Commission adopted the minutes from the April 17, 2025 meeting after a motion was made and carried. No other motions or votes were recorded; the remainder of the meeting consisted of reports and planning updates.

Thu May 1, 2025

Local Emergency Coordinating Committee

Committee to discuss Memorial Day Parade and Prevention Day in the Park events

The Local Emergency Coordinating Committee is meeting to approve minutes from April 3, 2025, and to discuss two upcoming community events: the Memorial Day Parade on May 26 and Prevention Day in the Park on May 29. Agency updates and other business will also be addressed.

emergency-managementcommunity-eventsmemorial-day-paradeprevention-dayminutescommittee
✓ Decided: Committee unanimously accepted April minutes and adjourned

The Local Emergency Coordinating Committee unanimously accepted the April 3, 2025 minutes. The meeting was then adjourned by unanimous vote. No other policy actions or approvals were decided during the session.

Wed Apr 30, 2025

Board of Assessment Appeals

Board to deliberate and decide on remaining property tax appeals

The Board of Assessment Appeals will meet to deliberate and render decisions on the remaining property tax appeals. The agenda also includes approval of prior minutes and other routine business. No specific properties or amounts are listed on the agenda.

board-of-assessment-appealsproperty-taxappealsdeliberation
✓ Decided: Board reduces assessed values for several properties, all approved

The Board of Assessment Appeals accepted the minutes from the April 23 meeting with a spelling correction. It approved reductions in assessed values for several properties, including those of Stephanie Knutson, 201 N. School Road, 35 Morin Avenue, 57 Morin Avenue, Michael & Lori Bushnell, Allen Semprobon, and Roger Pelkey. The board denied reductions for the appeals of Laura Heemskerk and Thomas Archambault, leaving their values unchanged. All motions passed unanimously.

Tue Apr 29, 2025

Inland Wetlands Agency

Inland Wetlands Agency LID Work Group to review draft work plan

The LID Work Group is meeting to establish its meeting structure and review a draft work plan. The group will discuss current lake water quality and existing Low Impact Design (LID) efforts. Members will also coordinate for a Land Use Forum scheduled for June 30, 2025.

wetlandswater-qualityland-uselow-impact-design
✓ Decided: Work group discusses plans, adopts no formal actions

The Inland Wetlands Agency LID Work Group met to review its mission, discuss upcoming tasks, and set a schedule for future meetings. Members were asked to review a draft statement, consider adding communication to the plan, and identify potential partners. No formal decisions or votes were recorded.

Mon Apr 28, 2025

Planning & Zoning Commission

Commission to consider zoning map change for 1409 Main Street

The Planning and Zoning Commission will hold a public hearing and discuss a proposal to modify the Zoning Map. The request involves reclassifying a 2.05-acre parcel near 1409 Main Street as Village Gateway Zone.

zoningland-usemain-street
✓ Decided: Commission discussed zoning change for 1409 Main St but made no decision

The Planning & Zoning Commission heard testimony from attorney Timothy Herbst and staff about a proposed modification of the zoning map for 1409 Main Street, seeking to reclassify the 2.05‑acre parcel as Village Gateway Zone. Commissioners asked detailed questions about access, the residential tail, and the commission’s authority. No vote or formal decision was recorded, leaving the proposal pending.

Mon Apr 28, 2025

Town Council

Council to review changes to Parks & Rec ordinance

The Town Council Steering Committee will consider possible changes to the ordinance governing the Parks and Recreation Commission. The agenda also includes a report from the Veterans Memorial and Events Commission, appointments to several town boards, and a discussion on tracking compliance with the new attendance policy for board members.

parks-and-recreationordinanceveteransappointmentsattendance-policyhuman-rightsschool-readiness
✓ Decided: Steering Committee asked Town Manager to put veterans monument proposal on Council agenda

The council unanimously accepted the March 24 minutes. The Steering Committee reached full consensus to have Town Manager Jim Drumm develop an agenda item and recommend that the Town Council consider adding Desert Storm and Afghanistan/Iraq War monuments to the Veterans Memorial. The proposed monuments are estimated to cost $100,000‑$150,000 and would be funded through fundraising.

Thu Apr 24, 2025

Economic Development Commission

Economic Development Commission to elect officers and discuss communications

The Economic Development Commission will meet to elect its officers. The body will also discuss social media, communications, and updates regarding CT Countryside and the Farmers’ Market.

economic-developmentcommunicationsfarmers-marketlocal-government
Thu Apr 24, 2025

Cemetery Commission

Cemetery Commission to discuss clean-up, headstone repair, and Wreaths Across America

This special meeting of the Coventry Cemetery Commission will review cemetery clean-up efforts, consider a quote for resetting a fallen headstone in the GHC section, and discuss participation in Wreaths Across America. The meeting also includes standard reports from the Public Works director and sexton, as well as approval of prior minutes and financial statements.

cemeterypublic-workssextonheadstonewreaths-across-america
✓ Decided: Commission approved $1,800 estimate for headstone repairs and several burial permits

The commission approved the minutes from the March 20, 2025 meeting (5‑0). It approved two lot‑sale permits and two headstone monument requests, issuing permits in April. The commission also accepted a $1,800 estimate to repair two headstones in the GHC (vote 4‑0).

Wed Apr 23, 2025

Board of Assessment Appeals

✓ Decided: Board reduces values for two properties, approves no-change motions

The Board of Assessment Appeals approved the minutes from the April 22 meeting. It approved no‑change actions for several properties and reduced the assessed values for two properties. All motions passed with unanimous support.

Wed Apr 23, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee discusses two-family residences and housing authority RFP information

The Senior and Affordable Housing Alternatives Study Committee will discuss two-family residences and review collected information related to a Housing Authority RFP. The meeting also includes adoption of previous minutes and routine procedural items.

housingsenior-housingaffordable-housingstudy-committee
✓ Decided: Committee approved March 26 minutes with corrected spelling of Pattee

The Senior and Affordable Housing Alternatives Study Committee adopted the minutes from the March 26, 2025 meeting, correcting the spelling of Christine Pattee’s name. No other motions were voted on; the remainder of the meeting consisted of discussion on two‑family dwellings, affordable housing, sewer capacity, and newsletter planning.

Wed Apr 23, 2025

Inland Wetlands Agency

Inland Wetlands Agency to consider cease and desist enforcement and road improvements

The Coventry Inland Wetlands Agency will hold a regular meeting on April 23, 2025. Old business includes alignment, sightline, and stormwater improvements to Swamp Road and South Street, with a new deadline of June 1, 2025. The agency will also address an enforcement matter at 77 Tall Oak Drive involving material deposition in a regulated area, where a cease and desist order was previously issued. Discussion items include a burn weeding plan, a policy on incomplete applications, and a wetlands quarterly report.

wetlandsenforcementroadsstormwaterland-usecoventry-ct
✓ Decided: Inland Wetlands Agency unanimously approves Swamp Road alignment project

The agency moved enforcement item 6A up the agenda and granted a 65‑day deadline extension for the Swamp Road application, setting a new deadline of June 1 2025. It then approved the Swamp Road and South Street alignment project with standard conditions. No formal decisions were made on the demolition of 85 Standish Road.

Wed Apr 23, 2025

Inland Wetlands Agency

Executive session on violation at 89 Flanders Road

The Coventry Inland Wetlands Agency is holding a special meeting primarily to discuss an ongoing litigation update regarding a violation at 89 Flanders Road in executive session. No other substantive business is on the agenda.

wetlandslitigationenforcementexecutive-session
✓ Decided: Agency entered then exited executive session on 89 Flanders Rd litigation

The Inland Wetlands Agency voted to enter executive session to discuss ongoing litigation regarding a violation at 89 Flanders Road. The motion was approved unanimously. After discussion, the agency voted to come out of executive session, also approved unanimously.

Tue Apr 22, 2025

Board of Assessment Appeals

Board hears property assessment appeals, then deliberates

The Board of Assessment Appeals will hold a hearing for pending appeals at 6:15 PM, followed by deliberation and decisions on those cases. The meeting also includes approval of prior minutes and any new business. No specific property values or appeal details are listed in the agenda.

assessment-appealsproperty-taxboard-of-assessment-appealspublic-hearingcoventry
✓ Decided: Board approved minutes and several assessment appeals, and tabled one appeal

The Board approved the minutes from the April 14 and April 12, 2025 meetings and added the April 12 minutes to the agenda. It approved no‑change assessments for Judith Meyers, Joanie Herman, and Luxury Lake Life Property LLC, and reduced Jose Martinez's assessment to $98,000. The appeal for 201 North School Rd was tabled pending additional information.

Tue Apr 22, 2025

Ad-Hoc Protected Spaces Stewardship Committee

Committee to review Wolf Land Donation and Inland Wetlands proposal

The Protected Spaces Stewardship Committee will review a request for feedback from the Town Council regarding the Wolf Land Donation. The body will also discuss a working group proposal for the Coventry Inland Wetlands Agency and the June 30 Land Use Forum.

conservationland-usewetlandspublic-landsbudget
✓ Decided: Approved purchase order for stain for Williams Preserve bog walkway

The committee accepted the minutes from the three prior meetings with all members in favor. A purchase order for stain for the Williams Preserve bog walkway was drafted and approved. Members expressed strong support for the Wolf Land Donation, but no formal vote was recorded.

Tue Apr 22, 2025

America 250 | Coventry CT Committee

Coventry America 250 Committee to brainstorm event ideas

The America 250 committee will meet to discuss community involvement and social media presence. The body will also brainstorm ideas for upcoming events.

community-eventscelebrationspublic-engagement
Mon Apr 21, 2025

Town Council

Town Council to consider tax collector appointment and job descriptions

The Coventry Town Council will meet to ratify the appointment of the Tax Collector and evaluate the Town Manager. The body will also consider approving job descriptions for a Wetlands Agent and WPCA Operators.

appointmentspersonnelbudgetcharterpublic-safety
✓ Decided: Council approved prior meeting minutes and the consent agenda

The Town Council unanimously accepted the minutes from the March 31, April 3, April 5, and April 7 special meetings. The consent agenda was also approved. No new policy actions or budget items were decided.

Thu Apr 17, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee to discuss draft firearms ordinance and safety presentation

The Firearms Safety/Home Shooting Range Study Committee will review a draft firearms ordinance (two versions), discuss a shooting range safety presentation, and elect a vice chair. They will also approve prior minutes and plan future agendas.

firearmsshooting-rangeordinancesafetycommittee
✓ Decided: Committee unanimously approved the March 20, 2025 minutes

The committee voted unanimously to accept the March 20, 2025 meeting minutes. Members reviewed a revised draft firearms ordinance but took no vote on its adoption. The group agreed to finalize the draft and present it to the Town Council at the June meeting. The election for Vice Chair was postponed until the vacant seat is filled.

Thu Apr 17, 2025

Economic Development Commission

Farmers’ market committee plans 2025 season, discusses wifi upgrade

The Ad-Hoc Farmers’ Market Operating Committee is holding a special meeting to plan the 2025 farmers’ market season and discuss upgrading wifi equipment. The meeting also includes adoption of minutes from a previous meeting and setting the next meeting date.

farmers-marketplanningwifieconomic-developmentcoventry
✓ Decided: Commission approved March minutes and tabled tree‑stump removal discussion

The commission approved the minutes from the March 20, 2025 meeting. The committee discussed the town’s request that the market pay to remove a tree stump in the Holy Grove, but the discussion was tabled. The meeting also covered vendor updates, sponsorships, and upcoming projects, and set the next meeting for May 2 at 4:30 pm.

Tue Apr 15, 2025

Zoning Board of Appeals

ZBA to hear two variance requests for rear yard setbacks

The Coventry Zoning Board of Appeals will hold public hearings on two variance requests: one to eliminate a 20-foot rear yard setback at 4 Avery Shores along Coventry Lake, and another to reduce the rear yard setback from 50 to 41 feet at 287 Root Rd. The board will also vote on approving the minutes from its February 18, 2025 meeting.

zoningvariancespublic-hearingssetbackscoventry-lake
✓ Decided: Zoning Board unanimously approves two rear‑yard setback variances

The board approved a variance at 4 Avery Shores to reduce the rear yard setback to the property line. It also approved a variance at 287 Root Rd to reduce the rear yard setback by 9 feet. Both motions passed unanimously. The board also approved the minutes from the February 18, 2025 meeting.

Mon Apr 14, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Committee to discuss budget, management plan, and hydrilla

The Coventry Lake Advisory & Monitoring Committee will hold a regular meeting to discuss updates on the lake gate, budget, hydrilla (invasive plant), water quality, and conduct a working session on the 2016 Coventry Lake Management Plan. The meeting also includes approval of prior minutes and audience comments.

lake-managementwater-qualityinvasive-speciesbudgetcivic-committee
✓ Decided: Committee unanimously approved March 10 meeting minutes

The Coventry Lake Advisory & Monitoring Committee voted unanimously to approve the minutes from the March 10, 2025 regular meeting. No other actions were approved, denied, or tabled. The meeting adjourned at 8:51 p.m.

Mon Apr 14, 2025

Town Council

Town Council to consider $2.7 million water line project

The Town Council will consider a resolution to appropriate funds for a water line construction project. The meeting includes a potential decision on a project funding agreement with the State of Connecticut and the issuance of bonds and notes to finance the work.

infrastructurewater-linebondspublic-worksfunding
✓ Decided: Council adopted $2.722M water line funding resolution

The Coventry Town Council adopted Resolution 2025-5, appropriating up to $2,722,500 for the construction of a water line on South Street Extension and Plains Road. The resolution authorizes a project funding agreement with the State of Connecticut and the issuance of bonds and notes to finance the appropriation. The motion passed with six votes in favor and no votes against or abstentions. The council then adjourned the meeting at 7:24 PM.

Mon Apr 14, 2025

Town Council

Finance Committee to review year-end transfers and audit proposal

The Coventry Town Council Finance Committee will review monthly financial reports and Board of Education fiscal reports for January and February 2025. They will discuss the timeline for another budget vote and consider possible action on FY24/25 year-end transfers and an audit services proposal. Preparation for a Town Meeting presentation is also on the agenda.

financebudgetauditboard-of-educationtown-councilcoventry
✓ Decided: Finance Committee accepted minutes and added charter amendment agenda item

The committee unanimously approved the February 10, 2025 Finance Committee minutes. It also unanimously approved adding agenda item 9 to discuss amending the town charter’s budget provisions. The meeting was adjourned at 8:23 PM. No other formal actions were taken.

Mon Apr 14, 2025

Planning & Zoning Commission

Public hearing on rezoning 2.05-acre parcel at 1409 Main St to Village Gateway Zone

The Planning and Zoning Commission will hold public hearings on a proposed zoning map amendment for 1409 Main Street to create a Village Gateway Zone, and on two special permit applications for new single-family homes on undersized lots at 90 Avery Shores and 272 Pine Lake Drive. The commission will also consider an 8-24 referral for a composting facility at the Department of Public Works and elect officers for the coming term.

planning-and-zoningzoning-map-amendmentvillage-gateway-zonespecial-permitsingle-family-dwellingcomposting-facilitypublic-hearingcoventry
✓ Decided: Commission added possible zone change for 83 Mason St to agenda

The Planning & Zoning Commission unanimously approved a motion to add a possible zone change for Ben Funk's property at 83 Mason Street to the New Business agenda. No final decisions were made on the proposed zoning map modification for 1409 Main Street or the special permit for 90 Avery Shores; both items were continued to the April 28, 2025 meeting.

Mon Apr 14, 2025

Board of Assessment Appeals

Board to hear property assessment appeals and deliberate decisions

The Board of Assessment Appeals will hold a hearing for property assessment appeals at 6:15 PM, followed by deliberation and decision-making. The agenda also includes approval of prior meeting minutes and new business.

assessment-appealspropertyboardpublic-hearing
✓ Decided: Board approves minutes and changes one property assessment

The board unanimously approved the minutes from the April 7, 2025 meeting. It approved changing Cory Anderson's assessment to $180,600 and confirmed no change for Wendy Lemieux. Decisions on the remaining appeals were tabled pending further information.

Sat Apr 12, 2025

Board of Assessment Appeals

Board of Assessment Appeals to hear appeals and deliberate

The Board of Assessment Appeals is meeting to hear property assessment appeals at 9:15 AM and then deliberate and decide on them. The agenda is mostly procedural, with no specific appeals or amounts listed in the provided text.

assessment-appealsboard-of-assessment-appealsproperty-taxescoventry
✓ Decided: Board tables one appeal and reduces assessments for five contaminated-well properties

The board withdrew the motion to approve the April 7 minutes and instead tabled that approval until the next meeting. It also tabled a decision on Appeal #1 (Judith Meyers) pending further discussion. The board approved reducing the assessments of four appealed properties (appeals 2‑5) and a fifth property at 225 Plains Road to their October 1, 2019 values, keeping those values until the next assessment date. All votes on the assessment reductions were unanimous.

Fri Apr 11, 2025

Ad-Hoc Protected Spaces Stewardship Committee

Committee to plan Williams Preserve footbridge project

The Protected Spaces Stewardship Committee is holding a special meeting to discuss new business. The primary focus of the meeting is the planning for the Williams Preserve Footbridge Project.

parksinfrastructureconservation
✓ Decided: Committee assigned tasks to move forward with the Williams Preserve footbridge project

The committee reviewed the Williams Preserve footbridge project, confirming the inland wetland permit and that the vendor invoice has been paid with additional grant funds available. Members assigned outreach to the Inland Wetland Agent and the North Central Conservation District, and delegated volunteer coordination, material marking, and transport planning for early June.

Thu Apr 10, 2025

Parks & Recreation Commission

Parks commission to consider new ordinance and Patriots Park master plan

The Coventry Parks & Recreation Commission will hold a regular meeting to discuss the Patriots Park Master Plan under old business and consider a proposed Parks and Recreation Commission Ordinance under new business. Staff reports on facilities, programs, and monthly finances will also be presented. The meeting includes time for public comment.

parksrecreationordinancemaster-planpatriots-parkcommission-meeting
✓ Decided: Commission moved Patriots Park Master Site Plan to agenda and approved meeting minutes

The commission approved the minutes from the March 20 special meeting. It voted to place New Business on the agenda, and then moved the Patriots Park Master Site Plan discussion to the Old Business portion of the agenda. No vote was taken on the proposed ordinance change; the discussion was tabled for later review.

Thu Apr 10, 2025

Water Pollution Control Authority

Water Pollution Control Authority to discuss sewer use rate increase

The Water Pollution Control Authority will meet to discuss a sewer use rate increase and review the budget. The body will also receive updates on the Wastewater Management Plan and the Western Route 44 Sewer Project.

sewerratesbudgetinfrastructurepublic-works
✓ Decided: WPCA approved March minutes and reduced sewer fee at 157 Woodland Rd

The Water Pollution Control Authority approved the minutes from the March 13, 2025 meeting with a unanimous vote. It also approved a motion to lower the sewer use fee for 157 Woodland Road from 2 EDUs to 1 EDU, effective March 4, 2025, and to refund any overpayment to the property owner.

Tue Apr 8, 2025

Housing Authority

Housing Authority to act on CDBG upfront costs

The Coventry Housing Authority will meet to discuss and potentially take action on approving management plans, 2025 income limits, expenditures, and CDBG upfront costs. They will also receive an updated discussion on solar options and hear the director's report on Orchard Hill I and II updates. Routine matters include roll call, audience comments, and approval of previous minutes.

housing-authoritycdbgsolarincome-limitsorchard-hillmanagement-planscoventry-ct
✓ Decided: Board authorizes up to $65,000 for CDBG grant engineering costs

The Housing Authority approved the March meeting minutes, treasurer's report, management plans, a 5% salary increase for the Executive Director, the 2025 HUD income limits, and March expenditures, all unanimously. It also authorized the Executive Director to spend up to $65,000 on upfront engineering costs for a $2.5 million CDBG grant application. No other business was taken up.

Mon Apr 7, 2025

Town Council

Coventry Town Council to continue 2025/2026 budget deliberations

The Town Council will hold deliberations regarding the 2025/2026 budget. The body will also consider job descriptions for several town positions and review recommended committee appointments.

budgetpersonnelappointmentsgovernment
✓ Decided: Council moved the 2025/2026 budget agenda item ahead of schedule

The Town Council approved the minutes from the March 10, March 17, and March 24 meetings, reopened and amended the March 24 minutes, and accepted the consent agenda after removing agenda item 8.C. The council also voted to move agenda item 7.A (2025/2026 Budget) to follow agenda item 6.B. All motions passed with the listed votes.

Mon Apr 7, 2025

Board of Assessment Appeals

Board to hear property assessment appeals at 6:15 PM

The Board of Assessment Appeals will hold a public hearing for property assessment appeals at 6:15 PM, followed by deliberation and decisions. The meeting also includes approval of prior minutes and new business.

assessment-appealsproperty-taxpublic-hearingboard-of-assessment-appeals
✓ Decided: Board tables all five assessment appeals until April 12

The board approved the minutes from the April 5, 2025 meeting, with all members present voting in favor. It then decided to table each of the five pending assessment appeals—appeals by Joanie C. Herman, Roger Pelkey, Jose Martinez, Luxury Lake Life Properties LLC/Lonnie Doros, and Allen L. Semprobon—until Saturday, April 12. For the Pelkey appeal, the board recalled an initial motion (all opposed) and passed a second motion to table (all in favor). The meeting was then adjourned.

Sat Apr 5, 2025

Board of Assessment Appeals

Board to hear 11 property assessment appeals

The Coventry Board of Assessment Appeals will convene to hear 11 property assessment appeals, deliberate, and render decisions. The agenda also includes approval of prior meeting minutes and any new business.

assessment-appealsproperty-taxboard-of-assessment-appealscoventry
✓ Decided: Board accepted April 1 minutes, set values for Reinhardt appeal, tabled others

The Board of Assessment Appeals unanimously accepted the minutes from the April 1, 2025 meeting. It set the appraised value at $317,600 and the assessed value at $222,300 for Albert & Caroline Reinhardt’s property. The appeal for Stephanie Knutson was rescheduled, and appeals #3 through #10 were tabled until Monday, April 7.

Sat Apr 5, 2025

Town Council

Coventry Town Council holds budget deliberations for 2025/2026

This is a special budget meeting where the Town Council will deliberate on the 2025/2026 budget. The agenda lists unfinished business for budget deliberations and references a document of budget motions. No other items are scheduled.

budgettown-councilspecial-meeting
✓ Decided: Council approved putting FY 25/26 budget, with $765K education cut, on referendum

The Town Council reached consensus to place the FY 25/26 budget on the upcoming voter referendum, keeping a $765,000 cut to the Board of Education. They also decided not to adopt a 2‑ or 4‑year phase‑in for motor‑vehicle depreciation or other budget items. A Plains Road bonding question will be added to the Town Meeting ballot. The meeting was adjourned at 12:52 PM.

Thu Apr 3, 2025

School Energy & Building Efficiency Building Committee

School Energy Committee reviews CHS roof, HVAC projects, and payment applications

The Coventry School Energy and Building Efficiency Building Committee will hold a regular meeting to discuss ongoing projects at Coventry High School. Items include review of financial statements for energy, HVAC, and roof projects, a cost breakdown for reimbursable projects, and updates on the CHS roof and unit ventilator/HVAC projects. The committee will also consider payment application 13 from Pro-Mech and a boiler room change diagram.

school-energybuilding-efficiencyhvacroofcoventryfinancial-statementsprojects
✓ Decided: Committee authorized $743,470 payment to Pro-Mech

The committee approved the minutes from the March 6, 2025 meeting by unanimous vote. It also authorized a payment of $743,470 to the contractor Pro‑Mech for work on the HVAC project, again unanimously. No other motions were adopted at this meeting.

Thu Apr 3, 2025

Local Emergency Coordinating Committee

Coventry LECC to discuss child safety and 'stranger danger' education

The Local Emergency Coordinating Committee will meet to review agency updates and minutes from March 6, 2025. The body will discuss how the police department and schools address 'stranger danger' education for children.

public-safetyeducationpolicechild-safety
✓ Decided: LECC accepted March 6 minutes and adjourned the meeting

The committee approved the minutes from the March 6, 2025 meeting. Bud Meyers moved to accept them, Eric Peterson seconded, and the motion carried with Jon Hand abstaining and all other members in favor. The meeting was then adjourned at 5:32 PM after a unanimous motion by Bud Meyers, seconded by Jon Hand.

Thu Apr 3, 2025

Town Council

Town Council to hold special budget meeting for 2025/2026 cycle

The Town Council will meet for a special session to conduct budget deliberations for the 2025/2026 fiscal year. The meeting includes a period for citizen comments and a review of the 2025 Capital Improvement Plan (CIP) memo.

budgetfinancecapital-improvements
✓ Decided: Council decides to keep motor‑vehicle assessment at 85% and rejects phase‑in plans

The Town Council reached consensus to retain the motor‑vehicle assessment at 85% and not adopt the proposed adjustment schedule. Council also agreed not to implement a 4‑year phase‑in of tax changes, while the 2‑year phase‑in remains under consideration. A series of budget cuts totaling $245,206 were approved, including a $25,000 allocation for tree‑removal and adding $33,090 to the Town Administration budget for the Special Projects Coordinator salary.

Wed Apr 2, 2025

Conservation Commission

Coventry Conservation Commission to review trail, property, and mapping projects

The commission will discuss vernal pool mapping, Earth Day activities, and bat houses under new business. Old business includes updates on Patriots Park Woods Trail, Rose Williams Property, and Nip Bottle Money. The financial report shows $1,645.92 remaining in the budget. All items are for discussion only; no formal decisions are expected.

conservationtrailspropertybudgetearth-daybat-housesnip-bottle
✓ Decided: Patty Cortez hired as new Zoning Enforcement Officer

The commission recorded a motion to approve the meeting minutes, though no vote result was noted. Patty Cortez was hired to fill the vacant Zoning Enforcement Officer position. The meeting was adjourned after a unanimous vote to approve the motion to adjourn.

Wed Apr 2, 2025

Energy Conservation / Alternative Energy Advisory Committee

Coventry energy committee to approve past minutes and general business

The Energy Conservation/Alternative Energy Advisory Committee is holding a routine meeting. The agenda includes approval of minutes from October 2024 and March 2024, along with old and new business items. No specific proposals or decisions are listed in the agenda.

energy-conservationalternative-energycommittee-meetingprocedural
✓ Decided: Committee approved the March 5, 2025 meeting minutes

The Energy Conservation/Alternative Energy Advisory Committee approved the minutes from the March 5, 2025 meeting. No other actions were formally decided; the committee discussed updates on EV chargers, compost, grant applications, and upcoming events. The meeting was adjourned at 7:30 p.m.

Tue Apr 1, 2025

Board of Assessment Appeals

✓ Decided: Board set assessed values for five property appeals

The Board of Assessment Appeals accepted the March 25 minutes and approved the assessed values for five appeals. Each appeal’s appraised and assessed amounts were recorded and the motions were passed unanimously.

Mon Mar 31, 2025

Town Council

Town Council to hold budget deliberations for 2025/2026

The Town Council is meeting to deliberate on the 2025/2026 budget. The body will also hold a discussion and Q&A session regarding the revaluation process and a possible phase-in.

budgettaxesrevaluation
✓ Decided: Council discussed 2025‑26 budget and revaluation phase‑in options

The Town Council held a budget deliberation for FY 2025‑26, reviewing potential spending cuts and error corrections. Council members also examined three revaluation phase‑in scenarios presented by the Assessor and a consultant. No formal approvals, denials, or votes were recorded during the meeting.

Thu Mar 27, 2025

Economic Development Commission

Commission to hear from M&M Realty Capital LLC on Coventry Laundromat

The Economic Development Commission will hold a special meeting to consider a business visitation from M&M Realty Capital LLC regarding the Coventry Laundromat. The agenda also includes adoption of minutes, planner reports, member updates, and discussions on social media, CT Countryside, and Farmers' Market updates. Officers will be elected.

economic-developmentbusiness-visitationcoventry-laundromatcommission-meetingelectionsfarmers-market
Wed Mar 26, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee discusses two-family residences and housing authority RFP

The Senior and Affordable Housing Alternatives Study Committee is meeting to discuss two-family residences and a Request for Proposals (RFP) for a Housing Authority property. The committee will also review website updates and correspondence regarding the Northwest Connecticut Affordable Housing and Conservation Strategy.

affordable-housingsenior-housingzoninghousing-authority
✓ Decided: Committee unanimously approves Jan 22, 2025 meeting minutes with corrections

The Senior and Affordable Housing Alternatives Study Committee approved the minutes from the January 22, 2025 regular meeting, correcting the diocese reference and a spelling error. The motion was moved by Pattee, seconded by Martin, and passed with five votes in favor and none against. No other formal motions were adopted; the committee discussed two‑family residence regulations, website content, and a potential RFP for a housing‑authority parcel, assigning follow‑up tasks to staff and members.

Wed Mar 26, 2025

Inland Wetlands Agency

Inland Wetlands Agency faces deadline on Swamp Road improvements

The Coventry Inland Wetlands Agency will consider two old business items with approaching deadlines: alignment and stormwater improvements on Swamp Road and South Street (deadline March 28) and emergency culvert repairs on Brigham Tavern Road (deadline May 2). New business includes an after-the-fact permit for illegal filling at 77 Tall Oak Drive and a related enforcement case. The agency will also discuss a violation update on 89 Flanders Road and a general wetlands permit proposal from the Department of Public Works.

inland-wetlandsenforcementpermitsroadsstormwaterillegal-fillingculvert-repairs
✓ Decided: Inland Wetlands Agency unanimously approves Brigham Tavern Road permit

The agency accepted permit #25-3 (R30061) for emergency repairs on Brigham Tavern Road with standard permit conditions 1 and 2. The motion was seconded by Mathieu and approved unanimously by five members (Johnson, Glenney, Mathieu, Wierszchalek, Epstein). The agenda was amended to move item 9a to after item 3. No decision was made on the 77 Tall Oak Drive application.

Tue Mar 25, 2025

Board of Assessment Appeals

Board of Assessment Appeals to hear tax assessment appeals

The Board of Assessment Appeals will hold a routine meeting to approve minutes from March 4, 2025, hear tax assessment appeals at 6:20 PM, deliberate and make decisions, and discuss any new business. No specific appeals or details were listed in the agenda.

assessment-appealstaxesboard-meetingcoventry
✓ Decided: Board adds April 1 meeting to handle pending property and vehicle appeals

The board elected Joan Lewis as chair, Jil Wood Reviczky as vice‑chair, and Mary Jo Lewis as secretary for the remainder of the year. It scheduled an extra meeting on April 1, 2025 at 5:30 pm to discuss appeals that could not be heard at the March 25 session. Appeals for five property owners were tabled until that meeting, and the board reduced the vehicle assessments for Kamil Laskowski to $13,050 and for Thomas Morgart to $14,000. The minutes from the March 4, 2025 and September 16, 2024 meetings were approved.

Tue Mar 25, 2025

America 250 | Coventry CT Committee

Coventry America 250 Committee holds initial meeting to organize and plan events

This is the first meeting of the newly formed America 250 | Coventry CT Committee. Members will review their charge, elect officers, and discuss planning for upcoming events including a rally. No binding decisions or financial actions are on the agenda.

america250committeeorganizationaleventscoventry
✓ Decided: Emily Kennedy appointed secretary and Jim Murphy named Vice Chair

The committee elected Emily Kennedy as secretary and Jim Murphy as vice chair, both unanimously approved. A motion to shift future meeting start time to 6:30 p.m. also passed unanimously. The meeting was adjourned at 7:32 p.m. by unanimous vote.

Mon Mar 24, 2025

Planning & Zoning Commission

Commission to consider rezoning 2.05 acres at 1409 Main Street to Village Gateway Zone

The Planning & Zoning Commission will hold public hearings on a zoning map amendment for 1409 Main Street and a special permit for a teardown/rebuild at 90 Avery Shores. The commission will also finalize comments on the Capital Improvement Program proposed budget for FY 25-26 and schedule a future hearing for a special permit at 272 Pine Lake Drive. Procedural items include adoption of minutes and reports.

zoningpublic-hearingspecial-permitsingle-family-dwellingundersized-lotcapital-improvement-budgetplanning
✓ Decided: Commission opens hearing on 1409 Main St zoning change, continues to April

The Planning & Zoning Commission opened the public hearing on the proposed zoning map modification for 1409 Main Street and decided to continue the hearing at the April 14 meeting. No vote was taken and no final decision on the zoning change was made.

Mon Mar 24, 2025

Town Council

Town Council Steering Committee to review Parks and Recreation ordinance

The Town Council Steering Committee will consider changes to the Parks and Recreation Commission ordinance. The body will also review job descriptions for an Environmental Planner and WPCA Operators. Additionally, the committee will consider several appointments to town boards and study committees.

appointmentsordinancesparks-and-recreationjob-descriptionsgovernment-administration
✓ Decided: Steering Committee approved multiple appointments and new staff job descriptions

The committee unanimously accepted the February 24, 2025 minutes and approved several new appointments, including Donna Titus to the Farmers' Market committee, Michael Mangiafico to the Firearms Safety study committee, Laura Heemskerk as an alternate on the Inland Wetlands Agency, and John Elsesser to the Pension and Retirement Committee. It also adopted job descriptions for WPCA Operator 1, Operator 2, and an Environmental Planner. All actions were approved by unanimous or majority vote.

Mon Mar 24, 2025

Town Council

Town Council holds budget meeting for 2025/2026 fiscal year

The Coventry Town Council is meeting to discuss the 2025/2026 budget. Presentations are scheduled from Parks & Recreation, Human Services, and the Registrar of Voters, followed by Council deliberations. No votes are indicated on the agenda.

budgetparks-and-recreationhuman-servicesregistrar-of-voterstown-council
✓ Decided: Council unanimously moved Registrar of Voters agenda item to 7:30 PM

The Town Council voted unanimously to place the Registrar of Voters budget presentation on the agenda at 7:30 PM. No other substantive actions were taken and the meeting was adjourned at 9:00 PM.

Thu Mar 20, 2025

Parks & Recreation Commission

Parks & Recreation Commission to consider 2025 beach sticker prices

The Parks & Recreation Commission will meet to review staff reports and the Patriots Park Master Plan progress. The body may take action on 2025 beach sticker prices and a matter involving Meg Mark of Wilder Moon.

parks-and-recreationbeach-stickerspublic-spacesmaster-plan
✓ Decided: Commission adopts Patriots Park Master Site Plan

The Parks & Recreation Commission approved the Schematic Concept Master Site Plan for Patriots Park, with members to submit comments by the April 10 meeting. It also granted Meg Mark permission to amplify noise and charge admission for events in the Creaser Park pavilion. A discounted senior beach pass ($10 per car) was approved, and the minutes from the February 13 meeting were accepted.

Thu Mar 20, 2025

Firearms Safety/Home Shooting Range Study Committee

Firearms Safety Committee reviews draft ordinance on home shooting ranges

The Coventry Firearms Safety/Home Shooting Range Study Committee will review a draft firearms ordinance and finalize questions for the police chief. The committee will also approve minutes from February 20 and discuss future agendas and citizen feedback.

firearmshome-shooting-rangeordinancepublic-safetystudy-committee
✓ Decided: Committee unanimously approved February 20 meeting minutes

The Firearms Safety/Home Shooting Range Study Committee approved the February 20, 2025 minutes with a unanimous vote. The committee reviewed a draft firearms ordinance and agreed to refine it at the April 17 meeting, after which public comment will be solicited. No other actions were voted on.

Thu Mar 20, 2025

Cemetery Commission

Cemetery Commission to discuss monument modifications and headstone repairs

The Coventry Cemetery Commission will meet to review financial statements and reports from Public Works and the Sexton. The body will discuss the process for approving monument modifications and addressing a fallen headstone in GHC.

cemeteriespublic-worksmonumentsmaintenance
✓ Decided: Approved December 19, 2024 meeting minutes (5‑0)

The Coventry Cemetery Commission approved the minutes from the December 19, 2024 meeting by a unanimous 5‑0 vote. No other formal actions, approvals, or denials were recorded; the commission discussed tree removal, website updates, and headstone repairs.

Thu Mar 20, 2025

Economic Development Commission

Farmers' market committee to plan 2025 season and discuss wifi upgrade

The Ad-Hoc Farmers' Market Operating Committee will hold a special meeting to plan the 2025 season and discuss a wifi upgrade for the market area. The committee will also consider adopting previous meeting minutes and set the next meeting date.

farmers-marketplanningwifitechnology
✓ Decided: Commission approved the February 27, 2025 meeting minutes

The Economic Development Commission approved the minutes from the February 27, 2025 meeting. The committee reviewed vendor changes, a proposed $8,000 Wi‑Fi upgrade, and upcoming sponsorship outreach, but no additional actions were formally approved or denied.

Tue Mar 18, 2025

Zoning Board of Appeals

Coventry Zoning Board of Appeals meeting cancelled due to lack of business

The March 18, 2025, Zoning Board of Appeals meeting has been cancelled because there were no items to address. The next regular meeting is scheduled for April 15, 2025.

cancellationzoning-board-of-appealscoventry
Mon Mar 17, 2025

Town Council

Council to deliberate 2025/2026 budget, hear from police and fire departments

The Town Council will hold budget deliberations for the 2025/2026 fiscal year, including presentations from the Police Department at 7:30 PM and Fire/EMS at 8:00 PM. The council will also consider a proclamation for World Autism Awareness Day, accept meeting minutes, and receive reports on finances, projects, and proposed budget meeting dates. An executive session is scheduled for public works and supervisors union negotiations.

budgetpolicefire-emsautism-awarenesspublic-worksunionstown-councilproclamations
✓ Decided: Council reviews police and fire budgets for 2025-26, no final vote

The Coventry Town Council held a budget workshop, hearing presentations from the Police and Fire/EMS departments for the 2025-26 fiscal year. No formal budget decisions were made; the council discussed specific requests, including new patrol vehicles, dashboard cameras, and a fire apparatus replacement. The meeting also included acceptance of prior minutes and a consent agenda, plus an executive session on personnel.

Thu Mar 13, 2025

Water Pollution Control Authority

Coventry Water Pollution Control Authority to discuss sewer planning and budget

The Water Pollution Control Authority will review the wastewater management plan and sewer system capacity. The body is discussing a fees proposal for the Western route 44 sewer planning area and conducting a budget review.

sewerbudgetinfrastructurewater-pollution
✓ Decided: WPCA awards CEPA environmental review to SLR International (3-0)

The Coventry WPCA awarded the CEPA environmental review work to SLR International Corporation after interviews and scoring; one member abstained due to a conflict of interest. The board also approved the February 13, 2025 meeting minutes. Staff reported on grant reimbursement, sewer project fees, and staff turnover concerns.

Tue Mar 11, 2025

Housing Authority

Coventry Housing Authority to hold annual meeting March 11

The Housing Authority of the Town of Coventry will conduct its annual meeting. The body will review expenditures and receive updates on Orchard Hill I and Orchard Hill IH.

housingexpendituresannual-meeting
✓ Decided: Coventry Housing Authority approves rent increase for Orchard Hill Estates II

The Coventry Housing Authority voted unanimously to raise base rents in Orchard Hill Estates II by $50 for efficiency and one-bedroom units, effective for new tenants only. The board also approved the February minutes, January expenditures, and clarified the town's role in a $25,000 housing viability study.

Tue Mar 11, 2025

Veterans Memorial & Events Commission

Veterans commission to discuss new monuments and upcoming events

The Veterans Memorial and Events Commission will review minutes, discuss upcoming events including Vietnam War Veterans Day on March 29 and Veterans Park Cleanup on May 3, consider old business on veterans parking signs, and hear a new proposal for veteran monuments. The next meeting is scheduled for May 13.

veteranseventsmonumentsparkscleanupparkingcommission
✓ Decided: Commission plans new Desert Storm and Global War on Terror monuments

The Coventry Veterans Memorial & Events Commission discussed adding two new monuments to Veterans Memorial Park for Desert Storm and Global War on Terror veterans. They reviewed guidance from Lisa Thomas on the approval process, which requires a presentation to the Town Council and review by the P&R Commission before fundraising. No formal decisions were made on the monuments; the commission agreed to visit other memorial parks for design ideas. The next meetings are scheduled for May 13, September 9, and October 14, 2025.

Mon Mar 10, 2025

Coventry Lake Advisory & Monitoring Committee

Hydrilla update and lake management plan working session on agenda

The Coventry Lake Advisory & Monitoring Committee will hold a regular meeting with updates on the lake gate, budget, hydrilla, and water quality. A working session on the 2016 Coventry Lake Management Plan is also scheduled. The committee will take action on minutes from the previous meeting and hear public comment.

covenntry-lakehydrillainvasive-specieswater-qualitybudgetmanagement-planlake-advisory-committee
✓ Decided: Coventry Lake committee approves February minutes, discusses lake gate and budget

The Coventry Lake Advisory & Monitoring Committee unanimously approved the minutes from its February 10, 2025 meeting. Members discussed the lake gate, which will be closed as ice breaks up to raise the water level to 93 feet by mid-April, and noted the town received a $75,000 state grant for hydrilla treatment requiring a town match. No new business or public comment was presented, and the meeting adjourned at 8:55 p.m.

Mon Mar 10, 2025

Town Council

Town Council-Finance Committee meeting cancelled

The Town Council-Finance Committee meeting scheduled for Monday, March 10, 2025, has been cancelled.

town-councilfinance-committee
Mon Mar 10, 2025

Planning & Zoning Commission

Planning & Zoning to set effective date for new Accessory Dwelling Unit regulations

The Commission will set an effective date for proposed changes to ADU regulations (PZC-25-1) and review draft comments on the Capital Improvement Program budget. Public hearings are scheduled for March 24 on a zoning map change at 1409 Main Street and a special permit for a rebuild at 90 Avery Shores. New business includes discussions on tree care, land protection methods, and affordable housing and conservation.

zoningaccessory-dwelling-unitsland-usepublic-hearinghousingbudgetconservation
✓ Decided: PZC sets ADU regulation effective date, prioritizes CIP items

The Coventry Planning and Zoning Commission set an effective date for the amended Accessory Dwelling Unit regulations (15 days after publication of legal notice) and finalized a prioritized list of capital improvement program recommendations for the Town Council. The commission also discussed a potential zoning text amendment to allow arborist businesses in the commercial/agricultural zone, but took no formal action.

Mon Mar 10, 2025

Town Council

Town Council to deliberate 2025/2026 budget

The Coventry Town Council will hold a budget meeting on March 10, 2025, to continue deliberations on the 2025/2026 fiscal year budget. The agenda includes discussion of the Board of Education budget and general budget deliberations. A public comment period is provided at the start of the meeting.

budgetboard-of-educationtown-councilfiscal-year-2025-2026
✓ Decided: Coventry Town Council holds budget meeting, no final decisions

The Town Council met to discuss the FY 2025/2026 budget, hearing from the Board of Education and deliberating on tax matters. No formal votes or final budget decisions were made; the council reached consensus not to increase motor vehicle taxes by the state-allowed 5% this year. The next meeting will include budget presentations from Police and Fire/EMS departments.

Thu Mar 6, 2025

School Energy & Building Efficiency Building Committee

Coventry school energy/building committee to review CHS roof and HVAC updates

The School Energy and Building Efficiency Building Committee will review financial statements, discuss the Coventry High School roof project and a related QA+M invoice, and receive updates on the unit ventilator/HVAC project. The HVAC update includes a project schedule, recent progress meeting notes, and a payment application from Pro-Mech. The committee will also review an Eversource contribution.

schoolenergybuildingconstructionroofhvaccoventry
✓ Decided: Committee approves $205,774.75 HVAC payment and $9,819.03 Eversource fee

The committee unanimously approved Pro-Mech Payment Application 12 for $205,774.75 and an Eversource contribution in aid of construction payment of $9,819.03 for transformer preparation. They also approved a $1,626.75 invoice from QA+M for roof work. No financial statements were available for review, and the roof defect solution from Greenwood Industries remains pending.

Thu Mar 6, 2025

Local Emergency Coordinating Committee

Coventry LECC to discuss Christmas in the Village event, approve minutes

The Local Emergency Coordinating Committee will consider approving minutes from its February 6, 2025 meeting. The committee will also receive an update on the Christmas in the Village event, with representatives from the Lions Club of Coventry present. Agency updates and other business will follow.

emergency-managementmeetingminutescommunity-eventspublic-safety
✓ Decided: Committee reviews Christmas in the Village traffic and food truck safety

The committee discussed safety and traffic flow issues from the Christmas in the Village event, including pedestrian visibility at the community center entrance and food truck parking. Lions Club representative Barbara Barry acknowledged the issues and said they would be addressed, with possible shuttle service from GHR school. The committee also approved the minutes from the February 6, 2025 meeting.

Wed Mar 5, 2025

Conservation Commission

Conservation Commission reviews Wolf Property site plan and $2,465.92 budget

The Coventry Conservation Commission will discuss the Wolf Property site plan referral, vernal pool mapping, Earth Day activities, and updates on Patriots Park Woods Trail, Rose Williams Property, and Nip Bottle Money. The commission has $2,465.92 remaining in its budget.

conservationsite-planbudgettrailsvernal-poolsearth-daynip-bottles
✓ Decided: Commission approves Wolf property donation for conservation

The Coventry Conservation Commission unanimously approved the acceptance of the Wolf property donation, which will expand trails near Thornton Brook Preserve. The commission also discussed vernal pool mapping, Earth Day activities, and ongoing projects, but no other formal votes were taken.

Wed Mar 5, 2025

Energy Conservation / Alternative Energy Advisory Committee

Energy committee to approve minutes from two prior meetings.

The Energy Conservation/Alternative Energy Advisory Committee is meeting to approve minutes from October 2024 and February 2025 meetings. The agenda includes standard procedural items such as call to order, audience of citizens, old business, and new business. No specific substantive items are listed for discussion under old or new business.

energyminutesadvisory-committeeproceduralcoventry
✓ Decided: Committee approves Feb. 5 minutes, discusses EV chargers and grants

The Energy Conservation/Alternative Energy Advisory Committee met via Zoom and approved the February 5, 2025 meeting minutes. They discussed several ongoing items, including EV charger applications, a compost grant, and a potential wood collection program for low-income heating, but took no major votes or decisions beyond the minutes approval.

Tue Mar 4, 2025

Board of Assessment Appeals

Board of Assessment Appeals to set April 2025 hearing dates

The Board of Assessment Appeals will meet to approve previous minutes and establish the schedule for hearings in April 2025.

assessmenthearingstown-administration
✓ Decided: Board sets 2025 appeal hearing dates, approves prior minutes

The Coventry Board of Assessment Appeals met on March 4, 2025, and took two substantive actions: it scheduled seven special meeting dates for Real Estate and Personal Property appeals (March 25, April 5, 7, 12, 14, 22, and 23), and it unanimously approved the minutes from the December 12, 2024 meeting. The board also appointed Mary Jo Lewis as chair for the meeting in Joan Lewis's absence. No other substantive decisions were made.

Mon Mar 3, 2025

Town Council

Public hearing on ethics code and 2025/2026 budget talks

The Council will hold a public hearing on adopting a new Code of Ethics (Resolution #265). They will also begin deliberations on the 2025/2026 budget with presentations from the Registrar of Voters, Booth & Dimock Memorial Library, and Department of Public Works. Other items include adoption of a revised volunteer handbook, appointments to various committees, and job description changes for Fire Officer/Emergency Management Director and Assistant to Assessor.

ethicsbudgetvolunteer-handbookappointmentsjob-descriptionspublic-hearing
✓ Decided: Council adopts ethics ordinance and revised volunteer handbook

The Coventry Town Council adopted Resolution #265, a new ethics ordinance, and a revised Volunteer Handbook, both unanimously. It also approved several appointments, including Victoria Phillips to the America 250 committee, and approved a proclamation for World Autism Awareness Day. A motion to approve a new full-time Fire Officer/Emergency Management Director position failed in a 4-2 vote.

Thu Feb 27, 2025

Economic Development Commission

Coventry EDC to discuss social media, CT Countryside, and Farmers' Market

The Coventry Economic Development Commission is holding a special meeting to adopt minutes, receive planner and manager reports, and discuss new business items. The new business includes social media and communications, CT Countryside updates, and Farmers' Market updates. No major decisions or financial actions are on the agenda.

economic-developmentcoventrysocial-mediafarmers-marketcountryside-updatesmeeting
✓ Decided: Coventry EDC discusses new businesses, ribbon cuttings, and market plans

The Coventry Economic Development Commission met on February 27, 2025, and approved the minutes from the October 24, 2024 meeting. The commission discussed several new and potential businesses, including a possible veterinary hospital at 2208 Boston Turnpike, and planned ribbon cuttings and certificates for businesses like Coventry Laundromat and VP Landscaping. Updates were given on the Farmers Market, including a 5% attendance increase and plans for a $16,000 wifi project. No formal votes were taken on these items; the only action was the unanimous approval of the previous minutes.

Thu Feb 27, 2025

Economic Development Commission

Farmers' Market Committee plans 2025 season and WiFi upgrades

The Ad-Hoc Farmers’ Market Operating Committee is holding a special meeting to plan the 2025 market season and discuss WiFi upgrade work at the market site. The committee will also adopt the minutes from its February 6, 2025 meeting and set the next meeting date.

farmers-marketplanningwifitown-committee
✓ Decided: Coventry Farmers' Market hires North River Landscaping for mowing

The Coventry Farmers' Market Operating Committee approved hiring North River Landscaping for mowing the market field and parking lot at a cost comparable to last year. They also approved the minutes from the February 6 meeting and discussed vendor applications, website updates, sponsorships, and WiFi plans. No other substantive decisions were made.

Thu Feb 27, 2025

Town Council

Town Council to hear 2025/2026 budget presentation and deliberate

The Coventry Town Council is holding a special meeting to receive the 2025/2026 budget presentation from Town Manager James Drumm and to conduct budget deliberations. No other business is on the agenda.

budgettown-councilpublic-hearingfinance
✓ Decided: Coventry Town Council reviews proposed FY2025-26 budget, finds errors

The Town Council held a special meeting to review the proposed 2025/2026 budget but took no formal votes. Council members identified several discrepancies in the budget, including a miscalculated reserves line item, a mismatch in the Board of Education's budget increase percentage, and an incorrect appropriations figure used by the BOE. These issues are to be corrected before the public budget presentation.

Wed Feb 26, 2025

Senior and Affordable Housing Alternatives Study Committee

February 26 Senior and Affordable Housing Alternatives Study Committee meeting cancelled

The February meeting of the Ad-Hoc Senior & Affordable Housing Alternatives Study Committee is cancelled. The next regular meeting is scheduled for March 26, 2025.

housingsenior-housingaffordable-housing
Wed Feb 26, 2025

Inland Wetlands Agency

Emergency culvert repair, two enforcement cases, and road improvements on agenda

The Inland Wetlands Agency will consider an emergency repair to a 60-inch culvert on Brigham Tavern Road, continue review of stormwater and sightline improvements on Swamp Road and South Street, and address two enforcement actions for unauthorized work in regulated areas. The meeting also includes updates on a Low Impact Development working group and a proposal for a general wetlands permit for public works.

wetlandsenforcementemergency-repairculvertstormwaterlow-impact-developmentpublic-works
✓ Decided: Coventry wetlands board approves outfall repair, permit modifications

The Coventry Inland Wetlands Agency approved a permit for the Gerald Park outfall repair with conditions to relocate the pipe inland and conduct annual inspections, and approved a modification to a wetlands permit for 276 Woodland Road requiring removal of millings and installation of a rain garden. The board also voted to have the town attorney file a motion for contempt against a property owner for failing to comply with a court order. Several other items were discussed or continued to the next meeting.

Mon Feb 24, 2025

Town Council

Council to consider job descriptions for fire officer/EM director and assistant assessor

The Coventry Town Council Steering Committee will consider adopting job descriptions for a Fire Officer/Emergency Management Director and modifying the Assistant to Assessor position. The committee will also accept resignations from the Economic Development Commission and the Firearms Safety Committee, and vote on appointments to several town boards and commissions.

town-councilpersonnelappointmentsresignationsemergency-managementpublic-safetyboards-and-commissions
✓ Decided: Steering Committee recommends appointments and job description changes

The Coventry Town Council Steering Committee met on February 24, 2025, and made several recommendations to the full Town Council. They unanimously recommended appointing Torrie Phillips to the America 250 Committee, Arthur Hall to the CT Water Advisory Committee, Pam Miller to full member of Parks & Recreation, and Mindy Gosselin as an alternate to Planning & Zoning. They also recommended adopting revised job descriptions for Fire Officer/Emergency Management Director and Assistant to Assessor. The committee acknowledged resignations from the Economic Development Commission and Firearms Safety Committee, and continued several items for future discussion.

Mon Feb 24, 2025

Planning & Zoning Commission

Coventry PZC to consider zoning changes for accessory dwelling units

The Planning and Zoning Commission will hold a public hearing and discuss modifications to regulations for Accessory Dwelling Units. The body will also review a zoning map change and a special permit for a home rebuild.

zoninghousingland-usebudgetpublic-hearing
✓ Decided: Coventry PZC approves ADU regulation changes and subdivision condition modification

The Coventry Planning and Zoning Commission unanimously approved modified language for Section 5.15.05 of the Zoning Regulations concerning Accessory Dwelling Units (ADUs), finding it consistent with the Plan of Conservation and Development 2020 and the Housing Affordability Plan 2022. The commission also unanimously approved a motion to modify conditions of the approved 3-lot subdivision on Kings Road, striking the requirement to convey land within 25 feet of the road centerline to the town. Additionally, the commission recommended the acquisition of the Wolf Property (42.2 acres) as town land and approved using the open space fund to cover survey and related costs. The minutes from January 27, 2025, were not approved and will be discussed at the next meeting.

Thu Feb 20, 2025

Firearms Safety/Home Shooting Range Study Committee

Committee discusses solutions for home shooting range regulations and report to Town Council

The Firearms Safety/Home Shooting Range Study Committee will review additional ordinances from Avon, Cromwell, Hartford, Middletown, and South Windsor. The committee will then discuss preferred solutions to identified problems and consider a report to the Town Council on study progress.

firearmshome-shooting-rangesstudy-committeeordinancestown-councilpublic-safetyzoning
✓ Decided: Committee agrees on 250-ft setback for draft home range ordinance

The committee reviewed ordinances from other towns and agreed on key components for a draft home shooting range ordinance, including a 250-foot distance from structures, a 10 AM start time, and a backstop requirement. No ordinance was adopted; staff will draft language for future review. The committee also approved minutes and a correction to prior minutes.

Tue Feb 18, 2025

Zoning Board of Appeals

ZBA to hear two variance requests for setback reductions

The Coventry Zoning Board of Appeals will hold a special meeting on February 18, 2025, to conduct two public hearings. The board will consider a variance to reduce the front yard setback at 43 John Hand Drive from 20 feet to no less than 10 feet from the pavement. Another hearing will consider reducing the side yard setback at 237 Woodland Road from 15 feet to 9 feet. The board will also approve previous meeting minutes and set 2025 meeting dates.

zoningboard-of-appealsvariancessetbackspublic-hearings
✓ Decided: ZBA approves two setback variances for sheds and porch

The Coventry Zoning Board of Appeals unanimously approved two variance requests. The first allows a reduced front yard setback for a shed at 43 John Hand Drive, and the second allows a reduced side yard setback for a front porch at 237 Woodland Road. The board also approved the September 17, 2024 meeting minutes and the 2025 meeting dates.

Tue Feb 18, 2025

Town Council

Council to consider 42.2-acre land donation, $26,000 water line permit

The Coventry Town Council will discuss and possibly vote on a revised attendance policy for volunteer boards, a request for up to $26,000 for permitting the Plains Road water line extension, and acceptance of a 42.2-acre private land donation. The council will also receive a presentation on Connecticut economic development, consider an appointment to the America 250 committee, and hear reports on transit-oriented communities and proposed state cuts to education and health district funding.

town-councilland-donationwaterattendance-policybudgeteducation-fundinghealth-districttransit-oriented-communities
✓ Decided: Council funds $26K for Plains Road water line permits

The Coventry Town Council approved funding up to $26,000 for engineering consulting services related to the Plains Road Water Line Extension project, with Councilor Blanchard abstaining. The council also adopted a revised attendance policy for volunteer boards and commissions, referred a 42.2-acre land donation to land use boards for review, and appointed Emily Kennedy to the America 250 committee. No other substantive decisions were made; the meeting included reports and an executive session.

Thu Feb 13, 2025

Water Pollution Control Authority

Coventry Water Pollution Control Authority to review sewer planning and budget

The Water Pollution Control Authority will discuss updates to the wastewater management plan and sewer planning for Western Route 44. The body will also review sewer system capacity and a budget involving $90K in debt service and ARPA funds.

sewerwastewaterbudgetinfrastructureplanning
✓ Decided: WPCA approves December minutes, discusses sewer project costs

The Coventry Water Pollution Control Authority met via Zoom on February 13, 2025, with three members present. The only formal vote was to approve the December 12, 2024 meeting minutes, which passed unanimously. The board discussed the Bolton Gateway sewer project, noting concerns about higher use fees for Coventry residents and a request to contribute to a capital repair fund, and agreed to seek professional help from Tighe & Bond. Staff also reported on budget status, pump clogging issues, and plans for a public hearing on sewer use rates.

Thu Feb 13, 2025

Parks & Recreation Commission

Parks & Recreation Commission to review Patriots Park Master Plan progress

The commission will receive a presentation from FHI regarding the progress of the Patriots Park Master Plan. The meeting also includes staff reports on facilities, projects, programs, and finances.

parksrecreationmaster-planpublic-facilities
✓ Decided: Parks Commission hears Patriots Park master plan, no vote taken

The Coventry Parks & Recreation Commission held a public hearing on the Patriots Park Master Site Plan, receiving extensive community feedback on boating facilities, the basketball court, and other amenities. No formal action was taken on the plan; the consultant will incorporate input into a revised draft. The commission also approved minutes, seated an alternate member, and rescheduled the March meeting.

Tue Feb 11, 2025

Veterans Memorial & Events Commission

VMEC discusses name change to Veterans Commission and upcoming ceremonies

The Veterans Memorial and Events Commission will review minutes, discuss a steering committee report on renaming to Veterans Commission, and address veterans parking signs and Purple Heart Town signs. Two upcoming ceremonies are noted: the Iwo Jima 80th Anniversary on Feb 22 and Vietnam War Veterans Day on March 29.

veteranseventsceremoniessignsname-changecommission
✓ Decided: Commission denied name change; kept officers, approved parking signs

The Coventry Veterans Memorial & Events Commission denied a request to rename itself to 'Coventry Veterans Commission' and to change its mission statement. The commission approved 9 Veterans Parking Signs, kept its current officers, and discussed several upcoming events and maintenance items.

Tue Feb 11, 2025

Inland Wetlands Agency

Inland Wetlands Agency to address enforcement at 77 Tall Oak Drive

The Inland Wetlands Agency will hold a special remote meeting to discuss an enforcement matter. The agency is reviewing a case regarding material deposition in a regulated area.

wetlandsenforcementland-use
✓ Decided: Coventry wetlands board directs owner to file permit by March 26

The Inland Wetlands Agency discussed a plan to resolve a violation at 77 Tall Oak Drive involving material deposition in a regulated area. The board directed the property owner to submit a formal after-the-fact permit application by the March 26, 2025 meeting, and to provide a topographic survey showing the extent of activity relative to wetland boundaries. The board also required the owner to grant the wetlands agent property access within 2-3 days of a request. No formal decision was made; the matter was continued.

Tue Feb 11, 2025

Housing Authority

Coventry Housing Authority to hold annual meeting on February 11

The Housing Authority will conduct its annual meeting to elect officers and review expenditures. The body will also discuss a Town Council money award to test site suitability for future development.

housingdevelopmentbudgetgovernance
✓ Decided: Coventry Housing Authority accepts town funding for site suitability test

The Coventry Housing Authority met on February 11, 2025, and approved several routine items, including the January minutes, treasurer's report, and expenditures. They also accepted a town funding award to test site suitability for possible future development. Officers were re-elected, and no new or old business was discussed.

Mon Feb 10, 2025

Coventry Lake Advisory & Monitoring Committee

Coventry Lake Committee to discuss budget and lake management

The Coventry Lake Advisory & Monitoring Committee will meet to review the 2016 Lake Management Plan and discuss the budget. The committee will also receive updates on the lake gate and hydrilla.

environmentlake-managementbudgetpublic-works
✓ Decided: Coventry Lake committee gets $75K state grant for hydrilla treatment

The Coventry Lake Advisory & Monitoring Committee approved the January 13, 2025 meeting minutes. Chair Debby Zeppa confirmed that the town's hydrilla treatment proposal was awarded a $75,000 grant from the DEEP Aquatic Invasive Species Program. The committee discussed priorities for the updated lake management plan, to continue in March. No other substantive decisions were made.

Mon Feb 10, 2025

Town Council

Joint finance committees discuss building reimbursement process and potential referendum items

The Coventry Town Council Finance Committee meets jointly with the Board of Education Fiscal Committee to discuss the process for submitting building reimbursement requests, including roof project reimbursements, and to consider items for a potential referendum. The regular Finance Committee meeting will also review monthly financial reports and consider a job description for a Fire Officer/Emergency Management Director.

financeboard-of-educationcapital-improvementreferendumfire-departmentemergency-managementbudgetschools
✓ Decided: Finance Committee reviews CHS HVAC reimbursement process, CIP items

The joint Town Council Finance Committee and Board of Education Fiscal Committee meeting on February 10, 2025, focused on discussions rather than formal votes. They reviewed the reimbursement process for the CHS HVAC project, discussed delays due to a roof defect, and considered CIP items for a potential bond referendum. The committee also reviewed financial reports and discussed a new Fire Officer/Emergency Management Director position, but no formal action was taken on these items.

Mon Feb 10, 2025

Planning & Zoning Commission

Coventry Planning & Zoning Commission meeting cancelled for Feb 10

The regular meeting of the Coventry Planning and Zoning Commission scheduled for Monday, February 10, 2025, has been cancelled due to lack of business. No items were considered or discussed.

meeting-cancellationplanningzoning
Thu Feb 6, 2025

School Energy & Building Efficiency Building Committee

Coventry school energy committee to review CHS roof project, HVAC updates

The School Energy and Building Efficiency Building Committee will hold a regular meeting on February 6, 2025, to review financial statements, discuss the CHS roof project (including a payment application and field report), and receive updates on the unit ventilator/HVAC project and transformer status. The committee will also elect officers.

school-energybuilding-efficiencyroof-projecthvactransformercoventryschool-committee
✓ Decided: Committee approves $983,993 HVAC payment and $10K survey change order

The Coventry School Energy and Building Efficiency Building Committee approved a $983,993.37 payment to Pro-Mech for HVAC work and a change order of up to $10,000 to ICDS for an A2 level survey. They also approved a $15,200 payment to Greenwood Industries for roof work, with the check held until a roof seam issue is resolved. Officers were elected: Mary Kortmann as Chair, Mike Soucy as Vice-Chair, and Jen Reilly as Secretary. The committee noted a manufacturer's recall on roof seams affecting CHS and GHR, with repairs covered at no cost to the town.

Thu Feb 6, 2025

Local Emergency Coordinating Committee

Committee to review TRIP grant and Bunker Hill Road bridge project

The Coventry Local Emergency Coordinating Committee will meet to approve minutes from January 2, 2025, hear agency updates, and receive status reports on the TRIP grant and construction on the Bunker Hill Road Bridge over Hop River. The meeting includes an audience of citizens and other business.

emergency-managementgrantsbridgesconstructiontown-meeting
✓ Decided: Committee discusses snow ops, police staffing, and bridge closure plans

The Local Emergency Coordinating Committee met on February 6, 2025, and accepted the January 2, 2025 minutes. Members discussed winter road operations, including plans to rent a bucket truck for tree work, and reviewed Fire/EMS call statistics. The committee also addressed police staffing shortages, state legislation on sick leave, and upcoming construction on the Bunker Hill Road Bridge over the Hop River, with plans to inform residents. No formal votes were taken on these items.

Thu Feb 6, 2025

Economic Development Commission

Farmers’ Market Operating Committee to plan 2025 season

The Ad-Hoc Farmers’ Market Operating Committee is meeting to discuss planning for the 2025 season. The committee will also address wifi upgrade work.

farmers-marketeconomic-developmentinfrastructure
✓ Decided: Coventry Farmers' Market approves website redesign and port-a-potty contract

The Coventry Farmers' Market Operating Committee approved a website redesign, hosting, and maintenance contract with BizTech, and continued port-a-potty service with A Royal Flush. Vendor updates noted Shenstone Gardens will not vend this season, and Ydanis Macarons declined a full-time spot. The committee also tabled WFSB advertising discussions and planned outreach to potential vendors.

Wed Feb 5, 2025

Conservation Commission

Conservation Commission reviews budget, trails, and vernal pool mapping

The Coventry Conservation Commission will hold its regular meeting to review minutes from December and January, discuss a financial report showing $2,465.92 remaining in the budget, and consider several items including vernal pool mapping, the Land Use Forum, and updates on Patriots Park Woods Trail, Nip Bottle money, and the Rose Williams Property. The meeting includes an audience of citizens period and members forum.

conservationbudgettrailsvernal-poolsland-useproperty
✓ Decided: Conservation Commission plans vernal pool mapping, land use forum

The Coventry Conservation Commission discussed plans for a vernal pool mapping project, proposing to divide the town into sections and record coordinates in GIS maps. They also discussed hosting an annual land use forum tentatively scheduled for June 30, 2025, at Patriots Park Lodge. No formal decisions were made; the meeting was primarily discussion and planning.

Wed Feb 5, 2025

Energy Conservation / Alternative Energy Advisory Committee

Energy Advisory Committee holds routine meeting with no specific agenda items

The Energy Conservation/Alternative Energy Advisory Committee is holding a standard monthly meeting with neither specific proposals nor public hearings listed. The agenda consists of call to order, citizen audience, approval of prior minutes, and general old/new business items.

energy-conservationalternative-energycommittee-meetingprocedural
✓ Decided: Committee approves Jan. 8 minutes, elects secretary

The committee approved the January 8, 2025 meeting minutes and elected Allison Pilcher as secretary. No other formal decisions were made; most items were updates or discussions, including EV charger updates, a pending DEEP compost grant, and planning for a Going Green event.

Wed Feb 5, 2025

Economic Development Commission

Economic Development Commission hosts AI business workshop at UConn

This special meeting is an AI business workshop for local businesses, featuring a tour of the UConn Innovation Partnership Building, a meet and greet, and a presentation by Dr. Tim Liptrap on AI tools like ChatGPT, Google Gemini, and SORA. No formal decisions or votes are scheduled.

economic-developmentaiworkshopbusinessuconntechnology
Mon Feb 3, 2025

Town Council

Town Council to discuss property revaluation and water line permitting

The Coventry Town Council will receive an update on the impact of property revaluation from the Town Assessor. The body will also consider a funding request for a water line extension and discuss a revised Code of Ethics policy.

budgetinfrastructureethicsappointmentstaxeswater-lines
✓ Decided: Council tables $26K Plains Road water line permitting request pending legal opinion

The Coventry Town Council voted unanimously to table a request for up to $26,000 from the Council's 1.5% fund for the permitting phase of the Plains Road Water Line Extension Project. The decision was made to allow the Town Manager to obtain a legal opinion on whether additional spending would exceed the previously approved $99,999 funding threshold, which would require a referendum. The council also approved multiple appointments to various boards and committees, and called for a public hearing on a revised Ethics Ordinance.

Tue Jan 28, 2025

Ad-Hoc Protected Spaces Stewardship Committee

Protected Spaces Committee to discuss Williams Preserve footbridge order and storage

The Protected Spaces Stewardship Committee will hold a regular meeting to discuss trail mapping, 2025 projects, and the Williams Preserve footbridge order. The committee will also consider a working group proposal with the Coventry Inland Wetlands Agency and receive updates on maintenance, plaques, and social media.

protected-spacestrailsfootbridgewetlandsopen-spaceparkscommittees
✓ Decided: Committee plans Williams Preserve footbridge build for May

The committee reviewed and accepted the October 2024 minutes and discussed multiple trail projects. They planned the Williams Preserve footbridge construction for May, with materials to be ordered and prepped in April. No formal votes were taken; all items were discussion and planning only.

Mon Jan 27, 2025

Planning & Zoning Commission

Coventry P&Z to hold hearings on three subdivisions and ADU rule change

The Coventry Planning and Zoning Commission will hold public hearings on three subdivision/resubdivision applications, then discuss the same items under old business. The commission will also consider a proposal to modify zoning regulations regarding Accessory Dwelling Units (ADUs). The agenda includes standard procedural items like call to order, minutes, and reports.

zoningsubdivisionpublic-hearingaccessory-dwelling-unitsplanning
✓ Decided: Coventry P&Z approves three subdivisions, modifies one condition

The Coventry Planning and Zoning Commission approved three subdivision applications: a 1-lot resubdivision on Root Road (PZC-24-9), a 3-lot subdivision on Kings Road (PZC-24-12), and a 2-lot resubdivision on Stonehouse Road (PZC-24-14), all unanimously. The commission also revised a condition for a previously approved resubdivision (PZC-24-13) to allow boundary pins for lot 2 to be set later, and set a public hearing for February 24 on accessory dwelling unit regulation changes.

Mon Jan 27, 2025

Town Council

✓ Decided: Steering Committee recommends appointments to America 250 and other boards

The Coventry Town Council Steering Committee unanimously recommended appointments to the America 250 | Coventry CT Committee, Building Code Board of Appeals, Human Rights Commission, and Parks & Recreation Commission. They also voted to send a new Fire Officer/Emergency Management Director job description to the Finance Committee, and recommended adoption of a revised Attendance Policy, Ethics Ordinance, and Volunteer Handbook. Several agenda items were continued, including appointments to the Planning & Zoning Commission and the CT Water Advisory Committee.

Thu Jan 23, 2025

Economic Development Commission

Farmers' Market Committee plans 2025 season and Wi-Fi upgrades

The Ad-Hoc Farmers' Market Operating Committee is holding a special meeting to plan the 2025 season and discuss a Wi-Fi upgrade project. The committee will also consider adopting minutes from its December 2024 meeting.

farmers-marketwifiplanningspecial-meetingcoventry
✓ Decided: Coventry Farmers' Market plans 2025 season, raises vendor fee to $40

The Coventry Farmers' Market Operating Committee met on January 23, 2025, and made several decisions for the upcoming season. They approved a vendor fee increase to $40, selected a postcard photo, and planned opening day giveaways. The committee also discussed vendor changes, including making Nyam a guest vendor and inviting 860Kombucha as a full-time vendor, and reviewed sponsorship and event plans.

Thu Jan 23, 2025

Economic Development Commission

Economic Development Commission to discuss social media and local markets

The Economic Development Commission will meet to establish its 2025 meeting schedule. The body will also discuss social media communications, CT Countryside, and the Farmers’ Market.

economic-developmentsocial-mediafarmers-marketcommunications
Wed Jan 22, 2025

Senior and Affordable Housing Alternatives Study Committee

Committee to discuss two-family dwellings and ADU policy

The Senior & Affordable Housing Alternatives Study Committee will meet to discuss two-family dwellings, follow up on accessory dwelling unit (ADU) discussions with the Planning and Zoning Commission, and plan public outreach on affordable housing. The committee will also adopt minutes from the previous meeting.

affordable-housingadusenior-housingzoningpublic-outreach
✓ Decided: Committee approves Dec. minutes, advances ADU regulation change

The committee unanimously approved the December 11, 2024 meeting minutes with a correction. It discussed a draft memo and revised regulation on accessory dwelling units (ADUs) that was received by the Planning and Zoning Commission (PZC), with a public hearing scheduled for February 24, 2025. No other formal decisions were made; the rest of the meeting was discussion on public outreach and two-family dwellings.

Wed Jan 22, 2025

Inland Wetlands Agency

Agency to decide on 33 Cooper Lane subdivision with Jan 24 deadline

The Coventry Inland Wetlands Agency will hold a regular meeting to consider several pending wetland permit applications, including a deadline-sensitive re-subdivision at 33 Cooper Lane. Old business includes an extension for 77 Edgewater Drive and a renewed permit for 369 Stonehouse Road, while new applications cover drainage improvements at Gerald Park and Swamp Road/South Street. The board will also hold officer elections and discuss a low-impact development working group update.

wetlandspermitssubdivisiondrainageenforcementelectionspublic-hearinginland-wetlands
✓ Decided: Inland Wetlands Agency approves three wetland permits and elects new officers

The Coventry Inland Wetlands Agency approved three wetland permit applications: a house addition at 77 Edgewater Drive (4-0, Pearson abstaining), a new home and re-subdivision at 33 Cooper Lane (5-0), and a re-subdivision at 369 Stonehouse Road (5-0). The agency also elected William Glenney as Chair and Lori Mathieu as Vice Chair, and approved the December 18, 2024 meeting minutes with a correction. A drainage improvement application for Woodland Road was postponed, and a new application for Gerald Park outfall maintenance was discussed but not voted on.

Tue Jan 21, 2025

Building Code Board of Appeals

Building Code Board of Appeals holds annual organizational meeting

The Coventry Building Code Board of Appeals is meeting for its regular annual meeting to handle routine administrative business. The agenda includes approving the 2024 meeting minutes, setting the 2026 meeting date, and electing officers. No appeals or code-related disputes are scheduled for discussion.

building-codeboard-of-appealsannual-meetingproceduralelectionminutes
✓ Decided: Coventry building appeals board re-elects officers, sets 2026 meeting

The Building Code Board of Appeals held its annual meeting, approving prior minutes and setting the next annual meeting for January 13, 2026. Officers were re-elected, with Brian Canny as Chairman and Ben Funk as Vice Chairman. No substantive appeals or code decisions were made; the meeting was procedural only.

Tue Jan 21, 2025

Zoning Board of Appeals

Coventry Zoning Board of Appeals meeting cancelled due to lack of business

The January 21, 2025, meeting of the Coventry Zoning Board of Appeals has been cancelled because there is no business to conduct. The next regularly scheduled meeting will take place on February 18, 2025, at 7:00 p.m. at 1712 Main Street.

meeting-cancellationzoning-board-of-appealsprocedural
Tue Jan 21, 2025

Town Council

Council to consider $20,000 for water tower engineering, bonding projects

The Town Council will consider authorizing up to $20,000 from the CNREF for preliminary engineering on a water tower project, review a presentation on the Plains Road Water Line Extension, and discuss potential projects for bonding. Also on the agenda is a proposed name change for the Veterans Memorial & Events Commission to Veterans & Events Commission.

water-towerwater-linebondingveteransfinanceinfrastructuretown-council
✓ Decided: Council authorizes $20K water tower study, sets bond referendum projects

The Coventry Town Council authorized up to $20,000 from CNREF for preliminary engineering on the water tower project. They also approved a list of projects for a future bond referendum, including the Plains Road water line extension, CHS HVAC completion, fire alarms, intercoms, a quint fire truck, a streetsweeper, and an ambulance. The council sent the Veterans Commission name change back to Steering for further discussion.

Thu Jan 16, 2025

Firearms Safety/Home Shooting Range Study Committee

Coventry committee reviews home shooting range safety rules and ordinances

The Firearms Safety/Home Shooting Range Study Committee will discuss best practices for safe home shooting range design and review ordinances from other towns. Members will also consider acceptable noise limits and set a proposed meeting schedule for 2025.

firearmssafetyzoningnoise-regulationmunicipal-ordinances
✓ Decided: Coventry firearms committee reviews ordinances, approves 2025 meeting schedule

The Firearms Safety/Home Shooting Range Study Committee met on January 16, 2025, and approved the minutes from November 7, 2024, and the proposed 2025 meeting schedule. The committee discussed shooting range best practices and reviewed comparable municipal ordinances from Tolland and Newtown, but took no substantive action on regulations. The committee's charge expires in July 2025, and it must notify the Town Council by its June meeting if an extension is needed.

Tue Jan 14, 2025

Building Code Board of Appeals

Building Code Board of Appeals holds annual meeting to approve minutes, set 2026 date, elect officers

The Coventry Building Code Board of Appeals will hold its regular annual meeting on January 14, 2025. The agenda is entirely procedural: approval of minutes from January 2024, setting the next annual meeting date for January 13, 2026, and election of officers. No appeals or substantive code matters are scheduled for discussion.

building-codeboard-of-appealsproceduralannual-meetingcoventry
✓ Decided: Building Code Board of Appeals meeting canceled due to lack of quorum

The Building Code Board of Appeals meeting on January 14, 2025, did not have a quorum, so no business was conducted. The meeting will be rescheduled. Minutes are unofficial until approved at the next scheduled meeting.

Mon Jan 13, 2025

Housing Authority

Coventry Housing Authority to review 2025 meeting dates and financial reports

The Housing Authority will meet to approve the 2025 meeting schedule and review financial reports and expenditures. The Director will provide updates regarding Orchard Hill and Orchard Hill IT.

housingbudgetadministrationorchard-hill
✓ Decided: Coventry Housing Authority approves 2025 meeting dates, financial reports

The Coventry Housing Authority held its January 14, 2025 monthly meeting, approving the December 2024 minutes, treasurer's report, financial reports, and expenditures unanimously. The board also approved the 2025 meeting dates, moving the November meeting to November 18 due to Veterans Day. The director reported the 2024 audit was completed with no findings.

Mon Jan 13, 2025

Coventry Lake Advisory & Monitoring Committee

Committee to discuss hydrilla, lake gate, and management plan updates

The Coventry Lake Advisory & Monitoring Committee will hold a hybrid regular meeting to discuss updates on lake management issues, including hydrilla, the lake gate, and a survey review of the 2016 Coventry Lake Management Plan. They will also consider approving the minutes from December 9, 2024, and receive an update on the collaborative ad hoc inland wetlands agency.

lake-managementhydrillawater-qualityinland-wetlandsminutes-approvalsurveys
✓ Decided: Committee discusses lake access, hydrilla grant, eagle count

The Coventry Lake Advisory & Monitoring Committee approved the December 9, 2024 meeting minutes. They discussed a proposed collaborative subcommittee with the Inland Wetlands Agency, noted the town's $165,000 grant proposal to CT DEEP for aquatic invasive species, and heard reports on bald eagle sightings and lake access concerns. No formal decisions were made on these topics; several items were tabled to the February 10 meeting.

Mon Jan 13, 2025

Town Council

Committee to weigh bonding projects, up to $20K for water tower study

The Town Council Finance Committee will meet to review monthly financial reports and Board of Education fiscal updates, discuss potential capital projects that would require bonding, and consider a recommendation to authorize up to $20,000 for preliminary engineering on a water tower project. The committee will also receive updates on the Creaser Park cabin (hazmat issue/demolition) and the FY 2024/25 audit, and discuss the state reimbursement process for school building projects.

financebondingwater-towerparksschoolsbudgetauditpublic-works
✓ Decided: Finance Committee recommends $5.8M bond for town projects

The Finance Committee unanimously recommended the full Town Council include several projects in a bonding referendum, totaling approximately $5.8M. They also recommended authorizing up to $20,000 for a water tower preliminary engineering study. The committee accepted the December 9, 2024 minutes and discussed financial reports and other updates.

Mon Jan 13, 2025

Planning & Zoning Commission

Public hearing on 3-lot subdivision on Kings Road near Hop River

The Planning & Zoning Commission will hold public hearings on two subdivision applications: a 3-lot subdivision on 10 acres on Kings Road in the River/Aquifer Zone and a 1-lot resubdivision on 31.67 acres on Babcock Hill Road. The commission will also discuss old business on these and another resubdivision on Root Road, and consider a new 2-lot resubdivision on Stonehouse Road.

zoningsubdivisionspublic-hearingsresidential-developmentplanning-commissioncoventry-ct
✓ Decided: Coventry PZC approves 1-lot resubdivision on Babcock Hill Road

The Coventry Planning and Zoning Commission unanimously approved a 1-lot resubdivision on 31.67 acres at Babcock Hill Road (PZC-24-13), with conditions including health district and wetlands approvals, road right-of-way conveyance, and tree protection. A public hearing for a 3-lot subdivision on Kings Road (PZC-24-12) was continued to January 27, 2025, pending a site walk. The commission also discussed but took no action on an ADU zoning text amendment proposal.

Thu Jan 9, 2025

Parks & Recreation Commission

Parks & Recreation Commission to elect officers, review park plans

The Parks & Recreation Commission will hold officer elections for the new year. They will also receive progress updates on the Miller Richardson site plan/design and the Patriots Park Master Plan. Staff reports on facilities, programs, and monthly finances will be presented, along with a public audience period.

parksrecreationmaster-planelectionsfacilitiesfinancial-report
✓ Decided: Commission re-elects officers, hears Creaser Park oil spill update

The Coventry Parks & Recreation Commission approved the December 5, 2024 minutes with corrections, and re-elected Jennifer Rodgers as Chair, Jillian Minor as Vice Chair, and Bob Martin as Secretary. They also received updates on the Creaser Park oil spill cleanup, Patriots Park Master Site Plan, and Miller Richardson construction. No other substantive decisions were made.

Wed Jan 8, 2025

Conservation Commission

Coventry Conservation Commission to discuss wetlands permits and open space markers

The Conservation Commission will meet to discuss inland wetlands regulated activity permit thresholds and vernal pool mapping. The body will also review updates regarding the Rose Williams property and the Patriots Park Woods Trail.

conservationwetlandsopen-spaceenvironment
✓ Decided: Commission discusses Hop River subdivision, lake management

The Coventry Conservation Commission met on January 8, 2025, and discussed a proposed three-house subdivision along the Hop River, agreeing to pass on comments about Lot 3's proximity to wetlands and to review Dr. Hank Gruener's report. They also discussed a possible joint commission for Lake Wangumbaug property owner information, and noted that DPW will use 75% of nip bottle money for dumpster covers, leaving about $13,000 for alternatives. No formal votes were taken; the meeting was procedural and informational.

Wed Jan 8, 2025

Energy Conservation / Alternative Energy Advisory Committee

Energy Conservation/Alternative Energy Advisory Committee to meet January 8

The committee will hold a meeting to conduct a roundtable of introductions and discuss old and new business. No specific projects or proposals are listed on the agenda.

energy-conservationalternative-energyadvisory-committee
✓ Decided: Committee tables October minutes, discusses EV chargers and compost grants

The Coventry Energy Efficiency and Alternative Energy Committee met virtually on January 8, 2025, and voted to table the October 2, 2024 meeting minutes. Members discussed ongoing projects including Eversource's DCFC application window, potential dumpster covers funded by Casella Waste, and a pending DEEP grant for an aerobic composting site. No formal decisions were made beyond tabling the minutes.

Mon Jan 6, 2025

Town Council

Town Council to discuss ethics, attendance, and volunteer policies

The Town Council will review several revised policies for town volunteers and officials. These items are currently listed as not ready for action. The meeting includes an executive session regarding the Town Hall Union.

ethicsvolunteerspersonneltown-policyveterans-affairs
✓ Decided: Council adopts 2025 budget meeting schedule

The Coventry Town Council approved the proposed 2025 budget meeting schedule, which includes dates for presentations, public hearings, and deliberations leading to the FY25-26 budget adoption. The schedule was accepted by consensus, and the Town Manager will notify department heads. No other substantive decisions were made; several agenda items were noted as not ready for action.

Thu Jan 2, 2025

School Energy & Building Efficiency Building Committee

Committee reviews CHS Roof project and HVAC ventilator update

The School Energy and Building Efficiency Building Committee will review financial statements and discuss the CHS Roof project, including a QA+M invoice. They will also receive updates on the Unit Ventilator/HVAC project, including a project schedule, progress meeting notes, and consider Pro-Mech Payment Application 10. The meeting includes approval of December 5, 2024 minutes.

schoolenergybuilding-efficiencyroofhvacfinancial-reviewmeeting
✓ Decided: Committee approves $869,741.63 HVAC payment and $240 QA+M invoice

The Coventry School Energy and Building Efficiency Building Committee approved two payments: $869,741.63 to Pro-Mech, Inc. for HVAC work and $240.00 to QA+M for inspection services. The CHS roof project is nearing completion, with final inspections and paperwork expected by February/March. The HVAC project is on schedule, but the transformer issue with Eversource remains unresolved, with a new plan that would reduce power shutdowns from 3 weeks to 1-2 days.

Thu Jan 2, 2025

Local Emergency Coordinating Committee

Coventry Local Emergency Coordinating Committee to debrief Christmas in the Village

The Local Emergency Coordinating Committee will meet to review the Christmas in the Village event. The body will also receive agency updates and approve minutes from November 7, 2024.

public-safetyemergency-managementcommunity-events
✓ Decided: Committee votes to invite Lions Club to discuss Christmas in the Village safety

The Local Emergency Coordinating Committee reviewed the December 8, 2024 Christmas in the Village event, noting parking and pedestrian safety concerns, including unauthorized vendor use of private property. The committee agreed to invite Lions Club representatives to an upcoming LECC meeting to address these issues. No formal votes were taken on policy changes; the only vote was to accept the previous meeting's minutes.