The Boring PartsFederalLocal · USLocal · Canada
Marble Rock, IA

Marble Rock public meetings in 2024

117 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Mon Dec 23, 2024

Board of Supervisors

Floyd County Board of Supervisors to review vehicle sales and board appointments

The Board of Supervisors will consider the sale of two Ford Explorer police interceptors and appointments to the Board of Health, Zoning Commission, and Board of Adjustments. Members will also discuss closing the courthouse for active threat training and a potential shared engineer with Cerro Gordo County.

public-safetyappointmentsdrainagegovernment-operationszoning
✓ Decided: Floyd County adopts construction evaluation resolution for CAFOs

The Floyd County Board of Supervisors approved a construction evaluation resolution for confinement feeding operations, allowing the county to review permit applications and submit recommendations to the DNR. They also approved a $500,000 assessment for Drainage District #3, accepted bids for two police interceptors, and appointed a liaison to explore sharing a county engineer. All votes were unanimous 3-0.

Fri Dec 20, 2024

Board of Supervisors

Floyd County supervisors to review sharing county engineer with Cerro Gordo

The Floyd County Board of Supervisors will meet to approve the agenda and discuss a proposed sharing of the county engineer with Cerro Gordo County. No other substantive business is scheduled.

county-governmentintergovernmental-agreementengineerfloyd-countycerro-gordo-county
✓ Decided: Floyd County weighs sharing engineer with Cerro Gordo after resignation

The Floyd County Board of Supervisors met with Cerro Gordo County to discuss a potential shared county engineer arrangement following Floyd County Engineer Jacob Page's resignation effective January 10. No formal decision was made; the boards agreed to have liaisons from each county discuss options and report back before January 10. The meeting was adjourned with a 3-0 vote.

Mon Dec 16, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission routine monthly meeting

This is a routine monthly meeting of the Floyd County Veterans Affairs Commission. The commission will approve the previous meeting's minutes and the consent agenda covering van activity and recurring bills. They will also review bills, budget, and claims, discuss office updates, and set the next meeting date (tentatively January 20, which is Martin Luther King Jr. Day).

veteranscommissionbudgetmeetingprocedural
✓ Decided: Floyd County Veterans Affairs approves routine bills and minutes

The Floyd County Veterans Affairs Commission met on December 16, 2024, and approved the agenda, June minutes, consent agenda, and routine bills/claims. No public comment was given, and no substantive policy decisions were made. The next meeting is scheduled for February 10, 2025.

Mon Dec 16, 2024

Board of Supervisors

Board to consider extending moratorium on utility-scale wind energy systems

The Floyd County Board of Supervisors will consider extending a moratorium on utility-scale wind energy systems and delaying a vote on zoning amendments for wind and battery storage. They will also act on a juvenile detention center agreement, drainage district repairs and assessments, and routine administrative items. Public comment is open.

zoningwind-energymoratoriumdrainagejuvenile-detentionbudgetpublic-safety
✓ Decided: Floyd County extends wind energy moratorium to March 17, 2025

The Floyd County Board of Supervisors extended the moratorium on utility-scale wind and battery storage permits until March 17, 2025, to allow more time for mediation. They also approved a $53,367 elevator repair, accepted the Drainage District #3 project completion, and set 2025 employee holidays. All votes were 3-0.

Mon Dec 9, 2024

Board of Supervisors

Board to accept resignation of County Engineer, discuss replacement

This meeting includes approval of minutes, claims, and tax credit applications. The board will accept the resignation of the County Engineer and discuss filling the position. They will also review legal invoices related to a wind ordinance court ruling and a utilities commission permit. Other actions include disposal of sheriff vehicles and renewal of a liquor license.

county-engineerwind-ordinancetax-creditspublic-safetybudgetliquor-licensearpa-funds
✓ Decided: Floyd County Supervisors approve ARPA fund reallocation and wind ordinance work

The Floyd County Board of Supervisors approved paying $26,300 to Wicks Construction from ARPA funds and uncommitted remaining funds for NIACOG's wind energy ordinance work and the law enforcement/courthouse updates project. They also approved a revised $1,800 payment to attorney Thomas Reavely for wind ordinance review, and accepted County Engineer Jacob Page's resignation effective January 10, 2025.

Tue Dec 3, 2024

Conservation Board

Closed session for real estate transaction; rental rates, land contracts for 2025

The Floyd County Conservation Board will hold a closed session to discuss a real estate transaction, aiming to avoid premature disclosure that could affect the price. The board will also review and potentially approve land rent contracts for 2025, adjust camping and facility rental rates for 2025, consider the Edna Pelz Wildlife Area designation, and finalize guidelines for the Maple Syrup Friends Group.

conservationreal-estateratescontractswildlifecounty-boardcampingiowa
Mon Nov 25, 2024

Board of Supervisors

Board to weigh wind ordinance legal impact & drainage repair

The board will discuss the potential impact of a court ruling on the county's wind energy ordinance amendment and consider a drainage repair project. Other actions include approving claims, minutes, a fiscal agent agreement, and annual urban renewal report. Several board appointments and a resignation are noted.

wind-energydrainagebudgetpersonnelcounty-administrationlegaltif
Wed Nov 20, 2024

Board of Adjustment

Board to decide on conditional use for private cemetery

The Board of Adjustment will hold a public hearing and vote on a conditional use application from MP Real Estate, LLC for a private cemetery on a parcel in St Charles Township. The meeting also includes approval of previous meeting minutes.

board-of-adjustmentconditional-usecemeterypublic-hearingzoning
Mon Nov 18, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission routine meeting, new commissioner

The Floyd County Veterans Affairs Commission will hold a routine meeting to approve minutes and consent agenda (including van activity and recurring bills), review bills and claims, and discuss office updates. A new commissioner will be introduced. The meeting is largely procedural with no major policy decisions expected.

veteranscounty-commissionproceduralbudgetpersonnel
Mon Nov 18, 2024

Board of Supervisors

Board to vote on five-year roads plan, ambulance radios, elder budget

The Floyd County Board of Supervisors will vote on the Iowa DOT 2025 County Five Year Program resolution for secondary roads. They will discuss providing radios and pagers to AMR Ambulance, consider closing the courthouse for active threat training, and hear an FY26 budget request from Elderbridge Agency on Aging. Routine items include approval of minutes, claims, and appointments to boards and commissions.

roadspublic-safetyemergency-servicesbudgetinfrastructureaging-services
Mon Nov 18, 2024

Board of Health

Floyd County Board of Health to review budget and health reports

The Board of Health will meet to review year-to-date budgets and the FY24 end-of-year report. The session includes updates on home care, seasonal illness, and sanitarian services.

public-healthbudgetsanitationgrants
Wed Nov 13, 2024

Board of Supervisors

Floyd County supervisors to certify Nov. 5 election results, consider drainage repair changes

The board will review and take action on several items including drainage district repairs, legal invoices, and personnel postings. Additionally, the board will conduct a separate meeting to canvass and certify the results of the November 5, 2024 general election.

electionsdrainagefinancepersonnellegalcontracts
Tue Nov 12, 2024

Conservation Board

Conservation Board to discuss real estate transaction in closed session

The Floyd County Conservation Board will meet on November 12, 2024, to consider routine consent agenda items, citizen input, and reports. Key discussions include a request for vehicle access to a walking trail for fishing parking, no-hunting signs at Edna Pelz Wildlife Area, and updates on Puhl and Koebrick Wildlife Areas. The board will also move into closed session to discuss a real estate transaction that could affect the price or outcome.

conservationparksreal-estatewildlifetrailspublic-access
Thu Nov 7, 2024

Board of Supervisors

Board to consider working group on wind energy and battery storage zoning rules

The Floyd County Board of Supervisors will discuss and possibly vote on forming a five-person working group to recommend zoning ordinance amendments for commercial wind energy systems and battery energy storage. The board will also consider agreements for mediation services and legal support for the working group. Public comment is scheduled.

zoningwind-energybattery-storageworking-groupboard-of-supervisorspublic-comment
Mon Nov 4, 2024

Board of Supervisors

County Board discusses wind turbine setbacks and legal impact of court ruling

The Floyd County Board of Supervisors will discuss countywide wind turbine maps, including setback waivers and proposed ordinance amendments. They will review attorney opinions on a district court case (Worthwhile Wind LLC vs Worth County) and its potential impact on Floyd County. The Board will also consider forming a working group to recommend zoning amendments for commercial wind energy and battery storage systems.

wind-energyzoningboard-of-supervisorslegalordinancesbatteriesenergy
✓ Decided: Board tables wind ordinance, plans working group with mediator

The Floyd County Board of Supervisors discussed the commercial wind energy conversion system (C-WECS) and battery energy storage system (BESS) ordinance, reviewing legal opinions and maps. They decided to form a working group, chaired by former Iowa Supreme Court Chief Justice Louis Lavorato, to recommend ordinance amendments by December 13. A special meeting is set for November 7 to formalize the plan. No final ordinance decision was made.

Tue Oct 29, 2024

Board of Supervisors

Board to decide on third reading of wind energy ordinance amendment

The Floyd County Board of Supervisors will discuss and potentially act on the third reading of an amendment to the county's zoning ordinance for wind energy conversion systems and battery energy storage systems. The board will also review attorney opinions on a recent court ruling in a similar case (Worthwhile Wind LLC v. Worth County) and consider options including tabling, taking no action, or approving amendments. Setback requirements from the 2011-2 Ordinance and proposed 1,000-foot waivers are part of the discussion.

wind-energyzoningordinance-amendmentboard-of-supervisorssetbackspublic-safetyrenewable-energyfloyd-county
Mon Oct 28, 2024

Board of Supervisors

Board discusses wind energy and battery storage zoning litigation

The Board of Supervisors will discuss insurance coverage and a District Court ruling regarding wind energy conversion systems and battery storage systems. They will also review a safety action plan for an SS4A grant and drainage repairs.

zoningwind-energylitigationinfrastructuregrants
Thu Oct 24, 2024

Board of Supervisors

Board to review legal impact of wind ordinance before October 29 vote

The Floyd County Board of Supervisors will discuss hiring outside legal counsel to review a recent court ruling in Worth County that may affect a proposed wind ordinance amendment. The board will also consider how this ruling could impact Floyd County if the amendment is approved at the October 29 meeting.

zoninglegal-reviewwind-energyboard-of-supervisorsfloyd-county
Mon Oct 21, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to meet, welcome new commissioner

This is a regular monthly meeting of the Floyd County Veterans Affairs Commission. The agenda includes approval of minutes, bills and budget, a director's update, and an announcement regarding a new commissioner. No major decisions or financial commitments are on the agenda.

veterans-affairscommission-meetingpersonnelbudgetiowa
Mon Oct 21, 2024

Board of Supervisors

Floyd County Board considers legal counsel for wind ordinance review

The Board of Supervisors will review a proposed wind ordinance amendment and the potential impact of a District Court ruling. The meeting includes decisions on drainage project payments and nuisance property cleanup.

wind-energydrainageroadslegal-counselnuisance-ordinancebudget
Mon Oct 14, 2024

Board of Supervisors

Board discusses wind ordinance amendment impact from court ruling

The Floyd County Board of Supervisors will discuss a court ruling in a wind energy case that may affect their proposed wind ordinance amendment. They will also consider routine approvals of minutes and claims, and note personnel hires for Communications and Public Health positions.

wind-energylegalcounty-boardpersonnelordinancespublic-health
Sat Oct 12, 2024

Conservation Board

Board to review wetland agreement and maple syrup development

The Floyd County Conservation Board will consider several action items, including a contractual agreement with a private landowner to allow water to shed into a new wetland at the Little Cedar Wildlife Area, review of no-hunting signs at the Edna Pelz Wildlife Area, and development of maple syrup production at the Tosanak Recreation Area. The board will also begin the annual tour of areas and handle routine consent agenda items such as meeting minutes and claims.

conservationwildlifewetlandssignsmaple-syruprecreationiowa
Wed Oct 9, 2024

Board of Supervisors

Board to consider third reading of zoning amendments for wind and battery storage systems

The Floyd County Board of Supervisors will review and take action on the third reading of amendments to the Zoning Ordinance (Ordinance #2011-2) regarding wind energy conversion systems and battery energy storage systems. A second reading review with NIACOG Planner John Robbins and discussion of setback requirement maps are also on the agenda. The Board may set a date for a fourth or final reading.

zoningwind-energybattery-storageordinancespublic-meeting
Mon Oct 7, 2024

Board of Supervisors

Board to discuss wind energy ordinance revisions, possible closed session

The Floyd County Board of Supervisors will consider a letter from an attorney representing Marble Ridge Wind Energy LLC regarding proposed wind energy ordinance revisions. The board may vote to enter closed session to discuss strategy with counsel in matters where litigation is imminent. Other business includes approval of minutes, claims, a liquor license, and an appointment to the Conservation Board.

wind-energylitigationclosed-sessionliquor-licensecounty-boardconservation-boardjail-inspection
Tue Oct 1, 2024

Emergency Medical Services Advisory Council

EMS Advisory Council to finalize public education campaign

The Marble Rock Emergency Medical Services Advisory Council is meeting to discuss and finalize a public education campaign. The agenda includes updates on public education resources and scheduling the next meeting.

emspublic-educationmeeting
Mon Sep 30, 2024

Board of Supervisors

Board to discuss wind energy and battery storage setback requirements

The Floyd County Board of Supervisors will review tax abatement requests and a legal invoice. The board will also discuss setback requirements for wind energy and battery storage systems in a proposed Zoning Ordinance.

zoningwind-energytaxesinfrastructurelegal-fees
Tue Sep 24, 2024

Emergency Medical Services Advisory Council

EMS council to discuss educational campaign format options

The Marble Rock EMS Advisory Council will hold a special meeting to discuss format options for an educational campaign and assign related action items. Other agenda items are routine procedural approvals of minutes and scheduling.

emseducational-campaignpublic-safetymarble-rock
Mon Sep 23, 2024

Board of Supervisors

Board to vote on extending moratorium for wind energy permits

The Floyd County Board of Supervisors will consider extending a moratorium on accepting permits for utility-scale wind energy systems and battery storage installations under the zoning ordinance. They will also take action on a tax abatement request from Charles City, a compensation board resolution, and a proclamation for Domestic Violence Awareness Month. The agenda includes routine approvals of minutes, claims, and updates on boards and activities.

wind-energymoratoriumzoningtax-abatementcompensation-boardproclamationcounty-boardcharles-city
Tue Sep 17, 2024

Emergency Medical Services Advisory Council

EMS Advisory Council to review ballot language and public education formats

The council will review actions taken by the Board of Supervisors and Charles City Council. Members will discuss ballot language and information formats for a public education campaign.

emspublic-educationballot-languagegovernment-oversight
Tue Sep 17, 2024

Board of Supervisors

Board to consider time extension and pay app for Drainage District #3 project

The Floyd County Board of Supervisors will meet to approve minutes, claims, and several action items. Key items include a time extension and pay application for Drainage District #3, an $815.24 legal invoice for Summit Carbon Permit proceedings using ARPA funds, and a tax abatement request from Charles City. Discussions will cover changes to the County Compensation Board and a $1500 commitment to educate voters on an EMS ballot issue. Personnel updates include a jailer hire, a home care aide pay increase, and resignations of a magistrate commission member and a dispatcher.

drainage-districttax-abatementems-ballotpersonnelbudgetlegal-servicesarpa-fundssummit-carbon-pipeline
✓ Decided: Supervisors approve Drainage District #3 change order and pay app

The Floyd County Board of Supervisors approved a time extension for the Drainage District #3 Open Ditch Repair project, moving the completion date from September 30 to December 1, 2024. They also approved pay application #10 for $24,696 to ACSTAR for the same project. Additionally, they approved $815.24 to Ahlers Cooney for Summit Carbon proceedings, funded with ARPA funds, and approved a new courthouse entrance sign for $3,379.22. A tax abatement request from Charles City was tabled until September 23.

Mon Sep 16, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission holds routine monthly meeting

This is a routine monthly meeting of the Floyd County Veterans Affairs Commission. The agenda includes approval of previous minutes, a consent agenda for van activity and recurring bills, public comments, and discussion of bills, budget, and claims. No major decisions or new business are listed.

veteranscountymeetingbudgetpublic-comments
✓ Decided: Commission recommends replacing Veterans Home member

The commission approved the agenda, minutes, consent agenda, and a bill payment. It will recommend to the Board of Supervisors that Maureen be replaced on the commission due to her declining health, with a replacement name to be provided. A large donation will fund Thiesen cards and food for VA outreach shelves.

Mon Sep 16, 2024

Board of Health

Floyd County Board of Health to review budget and sanitarian reports

The Board of Health will meet to review reports from Public Health/Home Health Care and the County Sanitarian. The body will discuss year-end and year-to-date budgets and a potential change to meeting times.

public-healthbudgetsanitationgovernment-administration
✓ Decided: Floyd County Board of Health approves agenda and minutes, hears program updates

The board approved the agenda and the May 20, 2024 minutes, both by 3-0 votes. Members heard reports from North Iowa Community Action Organization on child development screenings, WIC, family planning, and healthy pregnancy programs. The board decided to keep the 5:30 PM meeting time and noted Dave Tice's resignation at year-end. No other formal decisions were made.

Tue Sep 3, 2024

Conservation Board

Floyd County Conservation Board to review wind turbine setbacks and land acquisition

The board will review and take action on wind turbine ordinance setback recommendations. Members will also enter a closed session to discuss a real estate transaction and a corresponding letter of support for land acquisition.

wind-turbinesland-acquisitionreal-estateconservation
Tue Sep 3, 2024

Board of Supervisors

Floyd County supervisors to vote on zoning changes for wind and battery storage

The board will review and consider amendments to the county zoning ordinance regarding wind energy conversion systems and battery energy storage systems. A second reading of the amendment is scheduled, and a date for a third reading will be set. The meeting includes approval of the agenda and adjournment.

zoningwind-energybattery-storageordinancesenergypublic-hearing
✓ Decided: Floyd County advances wind turbine ordinance with stricter setbacks

The Board of Supervisors approved the second reading of an amended zoning ordinance for wind and battery storage, adding stricter setback requirements, a 40-decibel sound limit, and waste disposal rules. Several proposed amendments failed or died for lack of a second, including one to remove certain buildings from the occupied building definition and another to strike the 450-foot tower height and 70-turbine limit. The third reading is set for October 9, 2024, with staff to provide overlay maps on setback impacts.

Tue Sep 3, 2024

Board of Supervisors

Public hearing on Rudd parcel sale; closed session on litigation

The Floyd County Board of Supervisors will hold a public hearing on selling a parcel in Rudd and consider a related resolution. They will also vote on hiring a Secondary Road Mechanic, funding for EMS levy voter education, and an invoice for $759.94 from Perry Novak. The board plans to enter closed session to discuss litigation strategy.

board-of-supervisorspublic-hearingproperty-dispositionhiringems-levytaxeslitigationclosed-session
✓ Decided: Floyd County sells Rudd property to Dana Larson for $2,000

The board approved the sale of two lots in Rudd to Dana and Janelle Larson for $2,000, plus costs, after a public hearing. They also approved hiring a mechanic, funding EMS levy education, and engaging a law firm for pipeline litigation. All votes were 3-0.

Mon Aug 26, 2024

Board of Supervisors

Board to vote on resolution setting election date for EMS tax in Floyd County

The Floyd County Board of Supervisors will consider routine approvals including minutes, claims, and the treasurer's semi-annual report. The main action items are a resolution to set an election date for imposing an emergency medical services tax, property tax suspensions, and agreements for the county radio system and shared talkgroups. The board will also note the hiring of a Communications/Dispatcher.

emergency-medical-servicestaxelectionsradio-systempublic-safetyproperty-taxhiringcounty-board
✓ Decided: Floyd County sets Nov. 5 EMS tax election; 3-0 vote

The board approved a resolution calling a special election on Nov. 5, 2024, for a proposed EMS property tax of up to 69 cents per $1,000 assessed value, with annual revenue capped at $670,000 for five years. The board also approved the Floyd County Radio System User Agreement and a Memorandum of Understanding for shared operable talkgroups, both 3-0. Claims, minutes, agenda, and the treasurer's semi-annual report were approved. The board noted the hiring of a dispatcher at $25.91/hour.

Mon Aug 19, 2024

Veterans Affairs Commission

Commission to approve minutes, consent agenda, and monthly bills

The Floyd County Veterans Affairs Commission will hold a routine meeting to approve the agenda, last month's minutes, and the consent agenda covering van activity and recurring bills. They will also discuss bills, budget, and claims, hear a director's update, and set the next meeting date. Public comments will be accepted.

veterans-affairscommissionprocedural
✓ Decided: Floyd County VA Commission approves agenda, minutes, claims

The Floyd County Veterans Affairs Commission met on August 19, 2024, and approved the agenda, June minutes, consent agenda, and a motion to pay bills, budget, and claims. Director Todd Schriever reported that a veterans marker was provided for an unmarked grave, claims are up, a $10,000 check has arrived, and the VA laptop needs replacement, which commissioners agreed to do ASAP. The next meeting is set for September 16 at 1600.

Mon Aug 19, 2024

Board of Supervisors

Budget amendment public hearing and EMS levy ballot issue discussed

This meeting includes a public hearing on the FY25 County Budget Amendment and a resolution for the amendment. The board will also discuss placing an Emergency Medical Services levy on the ballot. Other actions include approval of claims, tax exemption applications, disposition of a county-owned parcel in Rudd, and a 28E agreement with Mitchell County for an emergency duress system.

budgetpublic-hearingtaxesopioid-fundsproperty-dispositionemergency-medical-servicescounty-agreementsroads
Mon Aug 12, 2024

Board of Supervisors

Board to act on fiber-line change order and tax-exemption applications

The Floyd County Board of Supervisors will meet on August 12, 2024 at 9:00 a.m. in the Floyd County Courthouse Board Room. The board is scheduled to approve minutes, claims, and two Motorola fiber-line change orders totaling $12,928.82, plus process homestead and disabled-veteran tax-credit applications and set a second reading for a wind-energy ordinance amendment.

fiber-optictax-creditswind-energyconservation-boardclaims
✓ Decided: Board approves Motorola change orders for fiber and concrete work

The Floyd County Board of Supervisors approved two Motorola change orders: #4 for $2,000 for 50 feet of additional fiber at the Rockford site, and #5 for $3,929.82 for concrete work at the Charles City tower. The board also tabled property tax credit and exemption applications until August 19, rescheduled a zoning ordinance second reading to September 3, and appointed Roy Schwickerath to the Conservation Board.

Tue Aug 6, 2024

Board of Supervisors

Board to consider zoning amendments for wind and battery energy systems

The Floyd County Board of Supervisors will continue a public hearing regarding amendments to Zoning Ordinance #2011-2. The board will decide whether to close the hearing and proceed with the first reading of the amendment.

zoningwind-energybattery-storagepublic-hearing
✓ Decided: Floyd County advances wind turbine ordinance with stricter setbacks

The Board of Supervisors continued a public hearing on amending the county's wind energy zoning ordinance, hearing extensive public comment both for and against. After the hearing, the board approved a series of amendments to the ordinance, including stricter setback requirements, a 450-foot height limit, a 70-turbine cap, and increased insurance requirements. The board then approved the first reading of the amended ordinance, with a second reading scheduled for August 19.

Tue Aug 6, 2024

Board of Supervisors

Floyd County supervisors to discuss EMS tax and funding recommendations

The Floyd County Board of Supervisors will consider approving a pay application for Drainage District #3, hiring a Secondary Roads Shop/Sign Foreman, and discussing the Emergency Medical Services Tax, including recommendations from the EMS Advisory Council and Ambulance Commission. They will also review an Omnitel invoice for the Communications Tower project and note the resignation of a dispatcher.

budgetemergency-servicestaxroadshiringcommunicationsdrainage
✓ Decided: Floyd County supervisors approve hiring new roads foreman, EMS tax levy discussed

The Floyd County Board of Supervisors approved routine agenda items, claims, and a drainage project payment, and hired Nate O'Neill as Secondary Roads Shop/Sign Foreman. They also discussed a potential EMS property tax levy for the November ballot, with a consensus to pursue it, but no formal vote was taken.

Mon Aug 5, 2024

Emergency Medical Services Advisory Council

EMS Advisory Council to vote on proposal for supervisors

The EMS Advisory Council is holding a special meeting to review and vote on a proposal intended for the supervisors.

emsemergency-servicespublic-safety
✓ Decided: EMS Council asks supervisors for up to $669K annually for 5 years

The EMS Advisory Council discussed the Board of Supervisors' rejection of their earlier request for $669,000 annually for 10 years. They approved a new recommendation asking the Board to collect up to $0.69 per $1,000 of property valuation, which would fund up to $669,000 annually for 5 years. The motion passed unanimously.

Mon Jul 29, 2024

Board of Supervisors

County board to consider zoning amendment for wind and battery energy systems

The Floyd County Board of Supervisors will hold a special meeting to consider a proposed amendment to the zoning ordinance regarding wind energy conversion systems and battery energy storage systems. The meeting includes a presentation by the Zoning Commission chair, a public hearing, and potential action on the first reading of the amendment.

zoningwind-energybattery-storagepublic-hearingordinance-amendmentfloyd-county
✓ Decided: Floyd County continues wind turbine ordinance hearing to Aug. 6

The Board of Supervisors held a public hearing on proposed amendments to the county's zoning ordinance for large-scale wind and battery energy storage systems. After extensive public comment, the board voted 3-0 to continue the hearing to August 6 at 6:30 p.m. at the Fairgrounds Youth Enrichment Center. No action was taken on the ordinance's first reading.

Fri Jul 26, 2024

Board of Supervisors

Board to set meeting rules for wind and battery storage zoning amendment

The Floyd County Board of Supervisors will consider establishing rules for meetings on a proposed amendment to the zoning ordinance regarding wind and battery storage. They will also review preliminary construction drawings for the Rockford Communications Tower and discuss a proposal to maintain ambulance services, including a request for a special meeting with the hospital board.

zoningwind-energybattery-storageambulancecommunications-towerboard-of-supervisors
✓ Decided: Board forwards EMS funding proposal to FCMC trustees

The Floyd County Board of Supervisors approved forwarding a revised Emergency Medical Services (EMS) funding proposal to the FCMC Board of Trustees and requested a special meeting to discuss it. The proposal would place a $450,000/year property tax levy on the November ballot and phase in hospital payments to cover one-third of AMR costs. The board also approved preliminary construction drawings for the Rockford communications tower and set rules for the upcoming zoning public hearing.

Wed Jul 24, 2024

Zoning Commission

Marble Rock Zoning Commission to discuss policies, approve minutes

The Marble Rock Planning & Zoning Commission will meet to approve the agenda and minutes from the June 26, 2024 meeting, and discuss policies and procedures of the commission. No specific zoning actions, rezonings, or public hearings are scheduled.

planningzoningprocedural
Mon Jul 22, 2024

Board of Supervisors

Board to vote on proposal to maintain ambulance services in Floyd County

The Floyd County Board of Supervisors will consider several administrative items, including approval of previous minutes and claims, but also action items such as a pay increase for County Attorney staff and a resolution on assistants and clerks. The most consequential item is a 10:00 a.m. vote on the Board's amended proposal to maintain ambulance services in the county.

ambulancebudgetcounty-employeespublic-safetywages
Tue Jul 16, 2024

Emergency Medical Services Advisory Council

EMS Advisory Council to discuss November 2024 tax levy vote

The Marble Rock EMS Advisory Council will consider replacing a member and selecting a chair. Members will also discuss next steps for a November 2024 tax levy vote to fund emergency medical services. The meeting includes approval of prior minutes and setting the next meeting date.

emergency-medical-servicesadvisory-counciltax-levyelectionspublic-safetyiowa
Mon Jul 15, 2024

Veterans Affairs Commission

Routine procedural meeting of Veterans Affairs Commission

This is a routine meeting of the Floyd County Veterans Affairs Commission. Commissioners will approve the previous month's minutes, a consent agenda covering van activity and recurring bills, and review bills and budget items. The VA director will provide an office update, and the next meeting date will be set.

veteranscommissionfloyd-countyproceduralbudgetmeeting
Mon Jul 15, 2024

Board of Supervisors

Board to consider pay increase for County Attorney staff

The Floyd County Board of Supervisors will consider approving a pay increase for County Attorney staff and discuss sharing a position between the County Attorney and County Auditor offices. They will also review the FY23 audit report and take action on a drainage district repair payment. Other items include approval of claims, minutes, and noting the hiring of a jailer.

budgetpersonnelauditdrainagecounty-attorneypublic-safety
Mon Jul 15, 2024

Board of Health

Floyd County Board of Health to review budgets and annual plans

The Board of Health will receive reports from Public Health/Home Health Care and the County Sanitarian. The body will discuss the EMS committee and review annual policy, procedure, and preparedness plans.

public-healthbudgetemssanitationpolicy
Mon Jul 8, 2024

Board of Supervisors

Board considers motion to reconsider Summit Carbon Solutions pipeline permit decision

The Board will review legal action regarding the Summit Carbon Solutions pipeline permit and a related invoice for legal services. Additionally, they will discuss funding for AMR Ambulance Services and technology options for an upcoming zoning ordinance public hearing.

pipelinelegalambulancezoningpersonnelbudget
Tue Jul 2, 2024

Conservation Board

Action on wind turbine ordinance setback recommendations

The board will review the 2023/24 annual report and camping revenue. Members will also consider action on wind turbine ordinance setback recommendations. The agenda includes approval of June meeting minutes and claims.

zoningconservationreportsrevenuewind-turbines
Fri Jun 28, 2024

Board of Supervisors

Extension of moratorium on utility-scale wind energy and battery storage permits

The Board will discuss insurance renewals and a potential 28E agreement with Mitchell County for emergency system licenses. They are also reviewing appointments for the Ambulance Commission and North Iowa Regional Housing Authority. Additionally, updates regarding Cedar River flooding and federal bridge infrastructure grants are scheduled.

zoningenergyinfrastructureappointmentsbudgetemergency-management
Wed Jun 26, 2024

Board of Adjustment

Public hearing for a new 911 communication tower in Rockford Township

The Board of Adjustments will hold a public hearing regarding a conditional use application for a 911 communication tower. The request was submitted by the Floyd County Board of Supervisors for a site in Rockford Township. Following public comment, the Board will vote to approve or deny the application.

zoningcommunicationspublic-hearingfloyd-countyrockford-township
Wed Jun 26, 2024

Zoning Commission

Public hearing on wind energy and battery storage zoning amendments

The Commission will hold a public hearing regarding a proposed amendment to the Floyd County Zoning Ordinance. The proposal involves regulations for commercial wind energy conversion systems and battery energy storage systems. Following the hearing, the Commission will review the amendment to make a recommendation to the Board of Supervisors.

zoningwind-energybattery-storagepublic-hearingordinance
Mon Jun 17, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to review budget and personnel items

The commission will review bills, budget, and claims during this meeting. The agenda also includes discussions regarding office updates and the position of Maureen Ruane.

veterans-affairsbudgetpersonnelfloyd-county
Mon Jun 17, 2024

Board of Supervisors

Floyd County Board reviews FY25 budgets and CO2 pipeline eminent domain resolution

The Floyd County Board of Supervisors will review the FY25 budget appropriations and various fund transfers. The board is also considering a resolution objecting to Iowa Utilities Board authority for CO2 pipelines. Additionally, updates on the Communications Tower Project at the Rockford site are scheduled.

budgetinfrastructureutilitieshousingroads
Thu Jun 13, 2024

Conservation Board

Review of wind turbine setback recommendations and survey payment

The Floyd County Conservation Board will review May meeting minutes and claims. The board will also consider wind turbine ordinance setback recommendations and a survey payment for Knapp 1.

wind-energyzoningfinanceconservation
Tue Jun 11, 2024

Board of Supervisors

Floyd County Board to review communications tower and drainage repairs

The Board will review several drainage district repairs and maintenance proposals for HVAC systems. They will also discuss updates to the Communications Tower Project, including electrical work at CC City Hall. Additionally, the meeting includes reviews of invoices related to wind energy ordinances and Summit Carbon Iowa permit proceedings.

drainagecommunicationswind-energybudgetinfrastructure
Tue Jun 11, 2024

Board of Supervisors

Board of Supervisors to certify June 4, 2024 Primary Election results

The Board of Supervisors will conduct the canvass of the June 4, 2024, primary election results. This includes reviewing and acting on Resolution #15-24 for the certification of these results.

electionprimarygovernmentfloyd-county
Wed May 29, 2024

Zoning Commission

Commission to discuss wind and battery storage ordinance

The Marble Rock Zoning Commission is meeting to approve the agenda and minutes from the March 7, 2024 meeting, and to discuss a proposed ordinance on wind energy and battery energy storage systems. No final decisions are listed on the agenda; the main substantive item is the discussion of this ordinance.

zoningwind-energybattery-storageordinance
Wed May 29, 2024

Board of Supervisors

Floyd County supervisors to consider 28E law enforcement agreements and tower project

The Floyd County Board of Supervisors will review and take action on several items, including 28E law enforcement agreements with six cities, updates and actions on the Communications Tower Project, and a public hearing on the FY24 budget amendment. They will also consider various resolutions and applications.

law-enforcementcommunications-towerbudgetpublic-hearingroadsfireworks
Wed May 22, 2024

Board of Adjustment

Board to consider three wind tower applications from Invenergy

The Floyd County Board of Adjustments will review three conditional use applications from Invenergy Wind Development North America LLC. The board will decide whether to approve or deny the installation of metrological towers at three different county locations.

wind-energyzoningconditional-useland-use
Mon May 20, 2024

Board of Supervisors

Supervisors to vote on wind energy moratorium extension, appointments, road agreements

The Floyd County Board of Supervisors will vote on extending a moratorium on utility-scale wind energy systems, approve appointments to the Conservation Board and Veterans Affairs, and consider several agreements and resolutions. They will also discuss repairs to Drainage District #4 and hear updates on secondary roads and IT projects.

wind-energyappointmentsroadsdrainagecounty-agreements
Mon May 20, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to review budget, bills, and office updates

The Floyd County Veterans Affairs Commission is holding its regular monthly meeting. The agenda includes routine approvals of the agenda, previous minutes, and a consent agenda for van activity and recurring bills, followed by public comments, a review of bills and the budget, and an update from the VA Director. No major policy decisions or public hearings are listed; the meeting is primarily procedural.

veterans-affairsbudgetbillsmeeting-procedures
Mon May 20, 2024

Board of Health

Floyd County Board of Health to review signatory authority and budget reports

The Board of Health will meet to review year-to-date budgets and reports from Public Health/Home Health Care and the County Sanitarian. The board is scheduled to take action regarding signatory authority for both departments.

public-healthbudgetsanitationgrants
Mon May 13, 2024

Board of Supervisors

Floyd County supervisors to review tower, courthouse projects and budget

The Floyd County Board of Supervisors will review and take action on multiple items, including progress reports and payments for the Law Enforcement Center/Courthouse and Communications Tower projects, using bond proceeds. They will also consider claims, a budget amendment, and several contracts and invoices, including legal fees related to the Summit Carbon pipeline.

budgetconstructioncontractspublic-safetytechnologyzoning
Tue May 7, 2024

Board of Review

Floyd County Board of Review to consider assessment petition for Cedar Mall

The Board of Review will meet to elect officers and adopt rules of procedure. The body will review informal agreements made by the Assessor and discuss the assessment of horizontal pressure tanks. The board will also take action on a petition regarding the Charles City Cedar Mall Inc. property.

taxesassessmentsproperty-valuationgovernment-administration
Tue May 7, 2024

Conservation Board

Conservation Board to review wind turbine ordinance and land parcels

The Floyd County Conservation Board is meeting to review and take action on several land and facility items. The agenda includes a review of a wind turbine ordinance and specific project payments.

conservationwind-turbinesland-useparks
Mon May 6, 2024

Board of Supervisors

Floyd County supervisors to act on ambulance agreement, radio antenna, vehicle sales

The Floyd County Board of Supervisors will review and take action on several administrative and financial items, including a revised emergency ambulance services agreement, a radio antenna agreement, and the sale of surplus vehicles. They will also consider appointments to boards and commissions, a county budget amendment date, and various assessments for drainage districts.

budgetpublic-safetyvehiclesappointmentsdrainageambulance
Thu May 2, 2024

Board of Supervisors

Board to vote on liquor license for event at Clover Ridge

The Floyd County Board of Supervisors is holding a special meeting to review and take action on a liquor license application from Hot Shots Billards for an event at Clover Ridge, 2526 US 218, Charles City. The agenda also includes approval of the agenda and adjournment.

liquor-licensespecial-meetingboard-of-supervisors
Wed Apr 24, 2024

Board of Supervisors

County board to set EMS tax levy election date and amend ambulance agreement

The Floyd County Board of Supervisors will review and take action on several items, including an amendment to the 28E agreement for emergency ambulance services, setting the date for an EMS tax levy election, and approving a child support services staffing contract for FY25. They will also consider a resolution for American Rescue Plan Act funds and a correction to dental insurance rates.

ambulancetaxcontractbudgetinsurancecounty-board
Wed Apr 24, 2024

Zoning Commission

Floyd County hosts workshop on wind energy zoning amendment

The Floyd County Board of Supervisors and Planning and Zoning Commission are holding a joint educational workshop to discuss amending the Zoning Ordinance for utility-scale wind energy and battery storage. Local officials and zoning experts will present, but no decisions will be made; the county is in the study phase.

zoningwind-energybattery-storagepublic-workshopfloyd-county
Wed Apr 24, 2024

Board of Supervisors

Floyd County hosts wind energy zoning workshop, no decisions expected

The Floyd County Board of Supervisors and Planning and Zoning Commission are holding a joint educational workshop on amending the county's Zoning Ordinance for utility-scale wind energy and battery storage. Local officials and zoning experts will present, and the public can attend in person or remotely. No decisions will be made at this event; the county is in the study phase.

zoningwind-energybattery-storagepublic-workshopland-use
Tue Apr 23, 2024

Emergency Medical Services Advisory Council

EMS Council to set tax levy rate, amount, and funding method

The Emergency Medical Services Advisory Council will review and take action on recommendations for the EMS tax levy, including its periodicity, rate, amount, and whether to fund it via local option income surtax, property tax, or a combination. The council will also discuss updates on education and communication documents and plan the next meeting.

emstax-levypublic-safetybudgetadvisory-council
Mon Apr 15, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to review budget, bills, and van activity

The Floyd County Veterans Affairs Commission is holding its regular monthly meeting. The agenda includes approving the previous meeting's minutes, a consent agenda covering van activity and recurring bills, and a review of bills, budget, and claims. The VA Director will also provide an update on office news.

veterans-affairsbudgetbillsmeeting-minutespublic-comments
Mon Apr 15, 2024

Board of Supervisors

County board to adopt FY25 budget, set tax levy at public hearing

The Floyd County Board of Supervisors will hold a public hearing on the FY25 county budget, then vote to adopt it and certify taxes. They will also review the secondary road budget and five-year program, discuss an ambulance services subsidy request with the medical center, and take action on several smaller items like a surveyor hire and vehicle disposal.

budgettaxesroadsambulancecontractspublic-hearing
Mon Apr 8, 2024

Board of Supervisors

County to act on tower land deal, budget, drainage repairs

The Floyd County Board of Supervisors will review and take action on a revised offer to purchase land from Stephen Schlader for a communications tower, discuss hiring a surveyor for the project, and consider FY24 budget appropriations. They will also review repairs for Drainage District #1 and Washington School Watershed Priority Area #2, plus approve several invoices, including one for Summit Carbon legal services.

budgetcommunications-towerdrainageland-purchasepublic-healthroadswatershed
Tue Apr 2, 2024

Conservation Board

Conservation Board to review Tosanak Recreation Area parcel and wetland improvements

The Floyd County Conservation Board will meet to discuss land and facility management. The board is reviewing actions for the Tosanak Recreation Area and Little Cedar Wildlife Area.

conservationland-managementwildlifepublic-facilities
Mon Apr 1, 2024

Board of Supervisors

Supervisors to review tower agreements, hire environmental health specialist

The Floyd County Board of Supervisors is meeting to handle routine approvals and several action items. Key decisions include communication tower agreements with OmniTel, authorizing an employment offer for an Environmental Health Specialist/Zoning Administrator/911 Signs position, and paying legal invoices for pipeline matters using federal funds.

zoningcommunicationslegalbudgethiringlaw-enforcement-center
Mon Apr 1, 2024

Board of Health

Board to review offer for Environmental Health Specialist/Zoning Administrator position

The Floyd County Board of Health is meeting to discuss a specific personnel matter. The board will review and potentially take action on authorizing the Chair to work on a job offer for the Environmental Health Specialist/Zoning Administrator/911 Signs position.

personnelenvironmental-healthzoningpublic-health
Thu Mar 28, 2024

Emergency Medical Services Advisory Council

EMS Council to recommend tax levy type, rate, and amount

The EMS Advisory Council will discuss and recommend the type, rate, and amount of an EMS tax levy, including whether to fund it via property tax, local option income surtax, or both. They will also review draft materials and election strategy. The meeting follows recent county board discussions about placing the measure on a September or November 2024 ballot.

Mon Mar 25, 2024

Board of Supervisors

Public hearing on FY25 property tax levy

The Floyd County Board of Supervisors is holding a public hearing on the proposed FY25 property tax levy, followed by a vote to close the hearing. The meeting also includes approving the agenda and adjourning.

Mon Mar 25, 2024

Board of Supervisors

Floyd County Board discusses communications tower and EMS election timing

The Board of Supervisors will review several items related to a communications tower project, including land purchase and lease agreements. The meeting also includes discussion on the date for an EMS special election and updates on the Law Enforcement Center/Courthouse project.

governmentcommunicationselectionspublic-safetyutilitiesbudget
Mon Mar 18, 2024

Board of Health

Floyd County Board of Health to review public health contracts and nuisance complaint

The Board of Health will review the Local Public Health Services Contract and discuss a nuisance complaint. The meeting includes budget and staffing reports from Public Health/Home Health Care and the County Sanitarian.

public-healthnuisance-complaintbudgetcontracts
Mon Mar 18, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to meet March 18

The Floyd County Veterans Affairs Commission will hold a regular meeting on Monday, March 18 at 4:00 PM in the Floyd County 1st floor conference room. The agenda includes routine items such as approving the agenda, minutes, consent agenda, and bills, as well as a director's report and public comments. No major decisions or proposals are listed.

Mon Mar 18, 2024

Board of Supervisors

Supervisors to weigh closed session on land purchase, tower change order

The Floyd County Board of Supervisors will consider routine approvals including minutes and claims, and receive updates on boards and the Law Enforcement Center/Courthouse project. They will also discuss going into closed session to consider purchasing real estate, and take potential action afterward. Other items include a change order for the Communications Tower Project, an agreement for planning and zoning services, a bid for the 2024 Crushed Stone Resurfacing project, and setting FY25 health/dental insurance rates.

Tue Mar 12, 2024

Board of Adjustment

Board of Adjustment to consider private cemetery application

The Floyd County Board of Adjustments will meet to review a Conditional Use application. The board will also elect a new Chair and Co-Chair.

zoningland-usepublic-hearingrockford-township
Mon Mar 11, 2024

Board of Supervisors

Floyd County supervisors to discuss wind turbine zoning, budget, and courthouse project

The Floyd County Board of Supervisors will review and take action on routine items like minutes and claims, and receive updates on boards and the Law Enforcement Center/Courthouse project. They will also discuss wind turbine zoning amendments with a NIACOG planner, consider an hourly agreement for planning services, review a drainage project payment, and begin FY25 budget review including dental insurance options.

zoningwind-turbinesbudgetcourthousedrainageplanning
Thu Mar 7, 2024

Conference Board

Floyd County Conference Board to hold public hearing on FY 24/25 proposed budget

The board will conduct a public hearing regarding the proposed FY 24/25 budget and consider its adoption. The agenda also includes reviewing minutes from January 23, 2024, and considering a contract with Vanguard Appraisals, Inc. for the 2033 reappraisal.

budgetfinancepublic-hearingcontractsappraisal
Thu Mar 7, 2024

Zoning Commission

Zoning board to discuss wind turbine ordinance changes

The Marble Rock Planning & Zoning Commission will hold a regular meeting to approve past minutes, elect a new chairman and vice chairman, and discuss feedback with John Robbins regarding the zoning amendment process for the Wind Turbine Ordinance and future meetings.

zoningwind-turbinesordinanceelectionsmeetings
Tue Mar 5, 2024

Conservation Board

Floyd County Conservation Board to review budget and tower location

The board will meet to discuss the 2024/25 budget and salary updates. Members will also review the location of a county communication tower and a job title change for an office staff member.

budgetinfrastructurepersonnelconservation
Mon Mar 4, 2024

Board of Supervisors

Floyd County supervisors to review tower land purchase, budget, road projects

The Floyd County Board of Supervisors will review and act on several items, including purchasing property for a communications tower, approving bids for road and culvert projects, and setting a date for the proposed tax hearing as part of the FY25 budget review. They will also discuss personnel changes, including a resignation and pay adjustments, and consider liquor license applications.

budgetroadspublic-safetypersonnelliquor-licensecounty-board
Tue Feb 27, 2024

Emergency Medical Services Advisory Council

EMS council to pick leaders, set tax levy election date

The Floyd County EMS Advisory Council will meet to select a chair and secretary, determine its voting composition, and recommend a date for an EMS tax levy election. They will also discuss the separation between the council and the EMS Association regarding donations and public engagement, and review draft materials for the tax levy.

emstax-levyelectiongovernancepublic-safety
Mon Feb 26, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to review bills, budget, and consent agenda

The Floyd County Veterans Affairs Commission is meeting to approve the agenda, last month's minutes, and a consent agenda covering van activity and recurring bills. They will also review bills, budget, and claims, and hear updates from the VA director. This is a routine business meeting with no major policy decisions listed.

veterans-affairsbudgetbillsmeetingfloyd-county
Mon Feb 26, 2024

Board of Supervisors

Floyd County supervisors to review FY25 budget, levy rates, and tax hearing date

The Floyd County Board of Supervisors is meeting to handle routine approvals (agenda, minutes, claims) and receive updates on boards and projects. Key business includes reviewing the FY25 budget, levy rates, and fund balances, with potential action to set a date for the required proposed tax hearing. The board will also consider a closed session to discuss real estate purchase, a water softener project, and hiring for an Environmental Health Specialist/Zoning Administrator position.

budgettaxesreal-estatecourthouseelectionshiringpublic-hearing
Wed Feb 21, 2024

Board of Supervisors

Floyd County supervisors to review FY25 budget, insurance rates, tower location

The Floyd County Board of Supervisors will review and potentially approve the FY25 budget, levy rates, and fund balances, and discuss employee health and dental insurance rates for FY25. They will also receive updates on the Law Enforcement Center/Courthouse project and the Communications Tower Project, including a discussion on tower location. Other items include approval of claims, minutes, and a pay increase for the County Attorney Secretary/Office Manager.

budgetinsurancelaw-enforcement-centercommunications-towerdrainagecounty-employees
Wed Feb 21, 2024

Board of Supervisors

County seeks public input on wind and battery storage zoning rules

The Floyd County Board of Supervisors and Zoning Commission are holding a joint listening session to hear public comments on potential amendments to the county zoning ordinance regarding utility-scale wind energy development and battery storage. No decisions will be made at this meeting; it is solely for gathering public input.

zoningwind-energybattery-storagepublic-hearingcounty-board
Wed Feb 21, 2024

Zoning Commission

County seeks public input on wind and battery storage zoning changes

The Floyd County Board of Supervisors and Zoning Commission are holding a joint listening session to hear public comments on potential amendments to the county zoning ordinance regarding utility-scale wind energy development and battery storage. No decisions are being made at this meeting; it is solely for gathering public input.

zoningwind-energybattery-storagepublic-hearingfloyd-county
Mon Feb 12, 2024

Board of Supervisors

Supervisors to review FY25 budget, tower site, EMS council, veterans housing aid

The Floyd County Board of Supervisors will review the FY25 budget, including employee health/dental insurance rates, and discuss the Communications Tower Project location. They will also consider EMS Advisory Council membership, a RAISE Grant application agreement, and reinstating the Home Base Iowa initiative for veterans. The meeting includes routine approvals of minutes and claims, plus updates on the Law Enforcement Center/Courthouse project and Secondary Roads activities.

budgetpublic-safetycommunications-towerveteransgrantsroadshealth
Mon Feb 12, 2024

Board of Supervisors

County hears public input on wind, battery zoning changes

The Floyd County Board of Supervisors and Zoning Commission are holding a joint listening session to hear public comments on potential amendments to the county zoning ordinance regarding utility-scale wind energy development and battery storage. No decisions will be made; the meeting is for gathering input only. The agenda is otherwise procedural, covering agenda approval, commissioner comments, and adjournment.

zoningwind-energybattery-storagepublic-hearingcounty-board
Mon Feb 12, 2024

Zoning Commission

Floyd County to host listening sessions on wind energy zoning amendments

The Board of Supervisors and Planning and Zoning Commission are seeking community input regarding proposed updates to the Zoning Ordinance. These updates concern minimum requirements for utility-scale wind energy development and battery storage. No decisions will be made during these sessions.

zoningwind-energybattery-storagepublic-hearingfloyd-county
Tue Feb 6, 2024

Conservation Board

Floyd County Conservation Board to review skid loader purchase and CRP contracts

The board will meet to take action on a skid loader purchase for the 2024/2025 budget and review changes to CRP contract operators. The agenda also includes a discussion regarding a board member resignation and a potential closed session for personnel evaluation.

budgetequipmentconservationpersonnelcrp-contracts
Mon Feb 5, 2024

Board of Supervisors

Supervisors to review budget, energy contracts, and land purchases

The Floyd County Board of Supervisors will review the FY25 budget and discuss progress on the Law Enforcement Center/Courthouse project. The board will also consider contracts involving ARPA funds and a right-of-way purchase.

budgetinfrastructurepublic-healthland-useemergency-services
Mon Jan 29, 2024

Board of Supervisors

Joint meeting on wind farm development process

The Floyd County Board of Supervisors and Zoning Commission are holding a joint educational workshop on wind energy. Presentations by MidAmerican Energy and Alliant Energy will cover wind farm development, environmental impacts, drainage, noise, decommissioning, and battery storage, followed by a Q&A with the public.

wind-energyzoningpublic-hearingenvironmentenergy
Mon Jan 29, 2024

Zoning Commission

Joint meeting to learn about wind farm development process and wind energy topics

The Floyd County Board of Supervisors and Zoning Commission are holding a joint educational workshop on wind energy. Presentations by MidAmerican Energy and Alliant Energy will cover the wind farm development process and topics like environment, drainage, noise, decommissioning, and battery storage, followed by a Q&A panel with public questions.

wind-energyzoningeducationpublic-meeting
Mon Jan 29, 2024

Board of Supervisors

Supervisors to review FY25 budget, tower project, drainage work

The Floyd County Board of Supervisors will review and take action on several items, including amending a drainage district assessment waiver period, approving a payment for repair work, and discussing the communications tower project. They will also review the FY25 budget and receive updates on the Law Enforcement Center/Courthouse project.

budgetdrainagelaw-enforcementtowerpublic-works
Tue Jan 23, 2024

Emergency Management Commission

Floyd County EMA Commission to discuss 2025 budget and leadership appointments

The commission will meet to review the FYE 2025 Budget and take action on appointing a new chair and vice-chair. The agenda also includes discussions regarding annual training requirements and past year activities.

budgetemergency-managementleadershiptrainingfloyd-county
Tue Jan 23, 2024

Conference Board

Floyd County Conference Board reviews 2024/2025 proposed budget

The board will review the proposed budget for 2024/2025 and set a date for a public hearing. The meeting also includes discussions on a revaluation project contract and per diem increases.

budgetgovernment-financepublic-hearingappraisalfloyd-county
Mon Jan 22, 2024

Veterans Affairs Commission

Floyd County Veterans Affairs Commission to review bills, budget, and consent agenda

The Floyd County Veterans Affairs Commission is meeting to handle routine administrative business, including approving the agenda, previous minutes, and a consent agenda covering van activity and recurring bills. They will also review bills, budget, and claims, and hear updates from the VA director. This is a standard procedural meeting with no major policy decisions or public hearings listed.

veterans-affairsbudgetbillsconsent-agendameeting
Mon Jan 22, 2024

Board of Supervisors

Supervisors to review $725K payment for Law Enforcement Center project

The Floyd County Board of Supervisors will review and take action on routine items including minutes, claims, and appointments, and will discuss the FY25 budget. A significant action is approving a $725,536.74 payment for the Law Enforcement Center/Courthouse project using American Rescue Plan funds. The board will also consider an anti-human trafficking proclamation and an amended 28E agreement with the City of Floyd.

budgetlaw-enforcementpublic-safetydrainageappointmentsintergovernmental-agreement
Tue Jan 16, 2024

Board of Supervisors

Floyd County supervisors to review FY25 budgets, funding requests

The Floyd County Board of Supervisors is meeting to handle routine business and review several items, including a settlement agreement, resignations, and FY25 departmental budgets. They will also consider funding requests from local organizations and receive updates on the Law Enforcement Center/Courthouse project.

budgetcounty-boardfundingresignationssettlementcourthouse-project
Thu Jan 11, 2024

Emergency Medical Services Advisory Council

EMS Council to discuss ambulance commission outcome and tax levy

The Marble Rock, IA EMS Advisory Council is meeting to discuss membership, the outcome of a recent Ambulance Commission meeting, and a draft EMS tax levy presentation. The agenda includes routine items like approving minutes and setting the next meeting date.

emstax-levyambulanceadvisory-councilmeeting
Mon Jan 8, 2024

Board of Supervisors

Board reviews FY25 budgets and Law Enforcement Center project status

The Floyd County Board of Supervisors will approve January 2 minutes and claims. The agenda includes a progress report on the Law Enforcement Center/Courthouse project, including payment applications and potential change orders. The board will also review FY25 departmental budgets and a funding request for Main Street Charles City.

budgetcourthouselaw-enforcementcounty-government
Mon Jan 8, 2024

Board of Health

Floyd County Board of Health to approve FY25 budgets

The Floyd County Board of Health will meet to elect leadership and approve budgets for the 2025 fiscal year. The board will also review reports from Public Health/Home Health Care and the County Sanitarian.

budgetpublic-healthsanitationgovernance
Tue Jan 2, 2024

Board of Supervisors

Floyd County supervisors set 2024 officers, policies, appointments

The Floyd County Board of Supervisors holds its annual organizational meeting to set leadership, meeting schedules, policies, and make numerous appointments for 2024. They will also approve the county investment policy, designate official depositories, and begin FY25 departmental budget reviews.

appointmentsbudgetcounty-boardinvestment-policymeeting-policynewspapersorganizational-meeting
Tue Jan 2, 2024

Conservation Board

Floyd County Conservation Board to review 2024/2025 budget

The board will meet to review and take action on the 2024/2025 Conservation Budget. The meeting also includes reviews of property encroachment and wetland projects.

budgetconservationwildlife-areaswetlands