The Boring PartsFederalLocal · USLocal · Canada
Gardner, MA

Gardner public meetings in 2025

351 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 29, 2025

Board of Health

Gardner Board of Health to review department updates and landfill pump replacement

The Board of Health will receive updates on various department operations, including staffing and food establishments. The body will also discuss the replacement of a landfill leachate pump and emergency dispensing sites.

public-healthlandfillemergency-preparednesshousingfood-safety
✓ Decided: Board elects Emma Chaitin as interim Health Chair for three months

The Board signed and approved the July 21 and September 22 meeting minutes and unanimously approved the November 19 Executive Session minutes. The November 24 minutes were held pending a question for the City Clerk. Susan Avallone submitted her resignation after 18 years of service. The Board voted to appoint Emma Chaitin as interim Chairperson for a three‑month term.

Mon Dec 29, 2025

Retirement Board

Board to approve trial balance, ledger and bank reconciliation for December 2025

The Gardner Contributory Retirement Board will consider approving its trial balance, general ledger, and the City Treasurer’s bank reconciliation. It will also review the November 2025 investment statement and discuss disability retirements in process. New‑business items include approving retirements and acknowledging deceased members, setting an election timetable, appointing an interim ex‑officio member, updating insurance rates for retirees and survivors, and a request from a member who was previously excluded.

retirementfinanceboardinsuranceelections
✓ Decided: Board approved $789,995.58 warrant and appointed interim ex‑officio member

The board unanimously approved the minutes from the November 24, 2025 meeting, the October 2025 trial balances and the City Treasurer’s bank reconciliations, and Warrant #12/25 for $789,995.58. It also appointed Jacqueline Leger as an interim ex‑officio board member, approved the 2026 Medex health‑plan rates for inclusion in the December payroll mailing, and granted Dennis Ashe twelve weeks of creditable service makeup. David Walsh was appointed Election Officer and the election timetable for the 2026 board election was approved.

Tue Dec 23, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to discuss 2026 budget and urban renewal projects

The Gardner Redevelopment Authority will meet to approve minutes from November 2025 and discuss updates on the Summit Industrial Park and Main Street projects. The agenda includes a review of the 2026 financial budget and a tentative schedule for future meetings.

budgeturban-renewalindustrial-parkminutesmeetings
✓ Decided: Board postpones new land appraisal for Rear Main South until Jan 2026

The Gardner Redevelopment Authority approved the November 26 minutes (4‑0). It decided to wait until the January 2026 meeting before ordering a new appraisal for the Rear Main South parcels. The board entered and later closed an executive session to discuss a land sale/purchase (both 4‑0) and placed the November financial statements on file (4‑0). The regular meeting schedule was confirmed and the meeting was adjourned (4‑0).

Mon Dec 22, 2025

Traffic Commission

Traffic Commission to discuss parking, speed limits, and winter parking

The Traffic Commission will approve September meeting minutes and discuss Edgell Street parking, the city-wide 25 mph speed limit, and a proposed hybrid winter parking ban. The commission will also address a new sign request for a purchased property on Pleasant Street.

trafficparkingspeed-limitpublic-safetywinter-parking
✓ Decided: Council declines to act on proposed hybrid winter parking ban

The commission unanimously approved the September 3, 2025 meeting minutes. The city council voted not to take action on the proposed hybrid winter parking ban, citing timing. The commission also unanimously adjourned the meeting at 9:37 a.m.

Thu Dec 18, 2025

Bandstand Committee

Bandstand Committee to discuss 2026 concert season and sponsors

The Bandstand Committee will meet to approve previous minutes and review correspondence. The body will discuss finalizing the 2026 concert season and potential sponsors, as well as review financial statements.

arts-and-culturecommunity-eventsbudget
✓ Decided: Bandstand Committee sets 2026 concert schedule and accepts minutes

The committee accepted the November 20, 2025 minutes. It approved a $500 sponsor check from Nancy. Concert dates for the 2026 season were finalized, with rain‑date Sundays from 2 pm‑4 pm, evening hours of 5 pm‑7 pm after August 8 2026, no July 4th concert, and a concert during the food‑truck festival. The next meeting was scheduled for April 23 2026 at 3:30 pm.

Thu Dec 18, 2025

Gardner Housing Authority

Authority will vote to accept November 20, 2025 meeting minutes

The Gardner Housing Authority will consider several reports and updates, including a vote to accept the minutes from the November 20, 2025 meeting. A vote is also required on the November 2025 invoice history report. Additional items include updates on the housing authority fidelity card, vacancy task force activities, and the emergency management plan.

housingfinanceadministrationvacancyemergency-management
Wed Dec 17, 2025

Gardner Redevelopment Authority

Authority will discuss updates to urban renewal projects and 2026 budget

The Gardner Redevelopment Authority will review progress on several urban renewal projects, including the Rear Main Project North and South, Summit Industrial Park, and updates on 155 Mill Street, 85 Winter Street, and 205‑213 Main Street. The board will also examine the November 2025 financial statements and discuss the financial budget and meeting schedule for 2026. No decisions are indicated; the items are listed for discussion.

urban-renewalfinancebudgetredevelopmentmeetings
Wed Dec 17, 2025

School Subcommittees

Policy Subcommittee will discuss school policies and approve minutes

The Gardner Public Schools Policy Subcommittee meeting will consider approval of the November 19, 2025 meeting minutes. Committee members will discuss a series of policy items, including a local wellness initiative, budget planning, transfer authority, fiscal year budget, a funding proposal, use of school facilities and equipment, signature authority, bonded employees, fiscal accounting, audits, purchasing and bidding requirements. No specific decisions are detailed in the agenda.

educationbudgetpolicywellnessfacilitiesprocurement
✓ Decided: Subcommittee sent multiple policy revisions to January School Committee for first read

The subcommittee approved the minutes from the November 19, 2025 Policy Meeting. It reviewed several policies and, with unanimous votes, recommended changes and sent those policies to the full School Committee for a first read in January. The meeting was then adjourned.

Tue Dec 16, 2025

Historical Commission

Commission to consider comment invitation on telecom project at 677 Timpany Blvd

The Gardner Historical Commission will meet on December 16, 2025 to review prior minutes and discuss several preservation and development items. Topics include a request for public comment on a proposed telecommunications project at 677 Timpany Boulevard and a Section 106 environmental review of the North Central Pathway Extension (MassDOT Project No. 613260). The board will also receive updates on historic markers, the Old Burying Ground restoration, and other community‑heritage projects.

historical-preservationtelecommunicationsmassdotcommunity-developmentmeetings
✓ Decided: Commission adopted 2026 meeting dates and locations

The commission approved the November 18 minutes, filed a Massachusetts Preservation Projects Fund communication, and sent its determination on a proposed telecommunications project to Terracon. It also adopted the calendar of meeting dates and locations for 2026. No other business was taken. The meeting was adjourned at 7:20 p.m.

Tue Dec 16, 2025

License Commission

License Commission to approve 2026 liquor, AAD, and poker license renewals

The Gardner License Commission will consider approving all complete 2026 liquor license renewals for dozens of establishments, including the Colonial Hotel, Price Chopper, and Gardner Ale House. It will also vote on the 2026 AAD and poker machine permit renewals for venues such as Acadien Social Club, Paramount Café, and Yen Yen. In addition, the commission will review pending items from previous meetings, including a license transfer for Sawa Asian Cuisine & Lounge and officer changes for the Gardner Fish & Gun Club.

licensingalcoholgamblingbusinessrenewalslocal-government
✓ Decided: Commission unanimously approved all 2026 liquor and AAD/poker license renewals

The License Commission voted unanimously to approve all complete 2026 ABCC liquor license renewals for the listed establishments. It also unanimously approved all 2026 AAD and poker permit renewals for the listed establishments. No other substantive decisions were recorded.

Tue Dec 16, 2025

Zoning Board

Zoning Board to hear requests for multi-family use and a fueling station

The Gardner Zoning Board of Appeals will hold public hearings regarding two special permit requests. The board will consider a change of use for a multi-family property and the establishment of a fueling station with a convenience store.

zoninghousingcommercial-developmentpublic-hearings
✓ Decided: Zoning Board unanimously approves special permit for Walmart gas station and store

The Board granted a continuation of the Nanda Patil rezoning hearing to the next meeting. It also approved the Special Permit for the proposed Walmart gasoline station and convenience store. Both actions were approved unanimously. The Board also approved the minutes from the October 21 and November 18, 2025 meetings.

Mon Dec 15, 2025

City Council

City Council to vote on winter parking ban and budget transfers

The Gardner City Council will consider an ordinance establishing a 'Winter Parking Ban' from January 1 to March 1 and amending parking fines. The body will also vote on transferring funds between department accounts and review applications for motor vehicle dealer licenses.

parkingbudgettransportationpublic-safetycity-councilordinance
✓ Decided: City Council approved Class II motor vehicle dealer licenses for ten businesses

The council voted 8 yeas to grant Class II motor vehicle dealer licenses to ten applicants, including AC Auto Clinic and Gardner Auto Mart. It also approved a Class III license for Riverside Auto. Additionally, two appropriation transfers were adopted, moving $10,687.80 to Auditor Department operating expenses and $1,622.79 to City Council department expenditures.

Mon Dec 15, 2025

Golf Commission

Golf Commission to approve minutes and review building feasibility study

The Golf Commission will consider approval of the November 17, 2025 meeting minutes. Commissioners will receive an update on the building feasibility study. The commission will review and approve its financial statements and expense report. Additional updates from members Dan Berry and Bill Frank will be discussed.

golffinancefacilitiesminutes
✓ Decided: Commission approved November minutes and FY26 financials

The Golf Commission accepted the November 17, 2025 meeting minutes with a 4‑0 vote. They also approved the FY26 year‑to‑date financial report, again by a 4‑0 vote. The meeting was then adjourned by a unanimous 4‑0 vote. No new business was taken up.

Fri Dec 12, 2025

Economic and Community Development Committee

Committee recommends Maki Park project update for December City Council meeting

The Economic and Community Development Committee reviewed the November 21, 2025 minutes and gave a status report on the Maki Park Project, noting the ramp is complete and railings are pending with final payment due Dec 12. The committee voted to recommend that Director Stevens present a full project update and report packet at the second December City Council meeting. The item will stay with the committee until the project is finished.

parkdevelopmentproject-updatecommitteepublic-works
✓ Decided: Committee waived reading of prior minutes and adjourned the meeting

The committee voted to waive the reading of the November 21, 2025 minutes and accepted them as the official record. A motion to adjourn was made and approved, ending the meeting at 1:45 p.m. No other actions were decided during this session.

Thu Dec 11, 2025

Public Safety Committee

FEMA grant approved for fire radios, city match required

The Public Safety Committee reviewed several updates, including a $31,000 municipal road safety grant for electronic speed signs and a signed body‑camera contract slated for deployment by Jan. 1 2026. The Fire Department reported a FEMA Assistance to Firefighters Grant of $363,941.96 for new portable radios, with the city required to provide a $33,085.64 match. Additional items discussed were a $224,828 bid to repair the landfill leachate collection system and a $25,000 purchase of a used ambulance from Westminster.

public-safetygrantsequipmentinfrastructurestaffing
✓ Decided: Committee recommended approval of multiple motor vehicle dealer license applications

The Public Safety Committee waived reading and accepted the October 17, 2025 minutes (3 yeas). It voted to recommend City Council approval of nine Class II motor vehicle dealer licenses and one Class III license (each 3 yeas). The meeting was adjourned at 8:20 a.m. (3 yeas).

Thu Dec 11, 2025

Board of Assessors

Board of Assessors to review exemption applications and land applications

The Board of Assessors will review and approve meeting minutes, sign an excise abatement denial, and discuss FY26 exemption applications and FY27 Chapter Land Applications. The meeting is rescheduled from December 3.

assessorsexemptionsland-applicationsexecutive-sessionminutesabatement
✓ Decided: Board approved tax clauses, denied one clause, and entered executive session

The Board accepted the minutes from the October 17, 2025 meeting by a 2‑0 vote. It then voted 2‑0 to go into Executive Session without returning to open session. In Executive Session the Board approved several tax clauses and denied one clause, and also denied a motor vehicle excise tax abatement.

Wed Dec 10, 2025

Finance Committee

Finance Committee will consider fund transfers and a public‑works gift

The Gardner Finance Committee will review and approve minutes from July, September and October 2025. It will decide on three first‑time agenda items: two orders transferring specific dollar amounts between department accounts and a measure confirming a $10,643.67 gift from the Department of Public Works to the Gardner Community Action Committee. The committee will also discuss the City’s health‑insurance payments and trust fund.

financebudgettransfersgifthealth-insurance
✓ Decided: Finance Committee approves two fund transfers and accepts prior minutes

The committee waived reading and accepted the minutes from July, September and October 2025. It approved two fund transfers: $10,867.80 for the Auditor Department and $1,622.79 for City Council office supplies. Two items – the DPW scrap‑metal gift and the health‑insurance trust fund discussion – were deferred for further review. The meeting was adjourned at 4:14 p.m.

Wed Dec 10, 2025

Disability Commission

Disability Commission to approve minutes and discuss accessibility updates

The Gardner Disability Commission will review and approve the minutes from its October 8, 2025 meeting. Commissioners will receive updates on a city councilor, the Ovila Case playground project, and plans to improve accessibility in the Council Chamber. Additional items include an ADA Coordinator update, the commission’s new email address, a self‑evaluation and transition plan, and a discussion of Maki Park.

disabilityaccessibilitycity-councilparksgovernance
Tue Dec 9, 2025

Planning Board

Planning Board hears building projects for Mount Wachusett College and GAAMHA

The Gardner Planning Board will vote to approve minutes from its November 4 and November 25 meetings. It will hold public hearings on a building addition and site improvements for Mount Wachusett Community College at 42 Linus Allain Avenue, and on a proposed building construction and site improvements for GAAMHA, Inc. at 827 Green Street. The board will also receive a Master Plan Update presentation and consider a MassDEP referral for the Templeton Pond Expansion.

zoningdevelopmentpublic-hearingeducationinfrastructure
✓ Decided: Planning Board approves project withdrawal and postpones GAAMHA hearing

The board approved the minutes from the November 4 and November 25 meetings by a 4‑0 vote. It approved the withdrawal of Mount Wachusett Community College’s building addition project without penalty, also 4‑0. The hearing on GAAMHA, Inc.’s proposed building at 827 Green Street was continued to the January 13, 2026 meeting, vote 4‑0. The board declined to act on the Hubbardston Pond expansion and referred the matter to the State and the Building Department.

Mon Dec 8, 2025

School Committee

Gardner School Committee to vote on multiple school policies

The School Committee will hold a first reading for eight policies and a second reading for six others. The body will also consider removing two policies regarding the duties of the Vice Chair and Secretary.

school-policybudgeteducationgovernance
✓ Decided: School Committee approved multiple financial warrants and policy updates

The committee accepted the Consent Agenda, ratifying Warrants #26-19 ($170,510.57), #26-20 ($139,835.48) and #26-21 ($268,644.06) and a $2,500 donation. It approved six policies on second reading and removed two redundant policies from the manual. The meeting was then adjourned.

Mon Dec 8, 2025

Conservation Commission

Gardner Conservation Commission holds wetlands hearings

The Gardner Conservation Commission will meet to vote on minutes, address enforcement orders, and hold public hearings on wetlands protection for several projects.

wetlandspublic-hearingzoningenvironmenthousingconstruction
✓ Decided: Commission issued Certificate of Compliance for 68 Acadia Rd.

The Conservation Commission approved the prior meeting minutes and issued a full Certificate of Compliance for DEP#160-0670 at 68 Acadia Road. It voted to continue hearings for projects at 827 Green Street, 677 Timpany Boulevard, and 170 Mill Street to future meetings. The commission determined the DAV Victory Lane Veterans Housing project is outside its jurisdiction and will have a letter confirming this. The meeting was adjourned.

Mon Dec 8, 2025

Conservation Commission

Conservation Commission to hear wetlands permit applications

The Gardner Conservation Commission will hold public hearings on wetlands protection applications for a carport, a building construction, and a fuel station redevelopment. The meeting also includes approval of minutes and continued enforcement orders.

wetlandszoningpublic-hearingenvironmenthousingconstruction
Thu Dec 4, 2025

Cemetery Commission

Gardner Cemetery Commission to review financial statements and grounds conditions

The Municipal Grounds/Cemetery Commission will meet to approve previous meeting minutes and review the Cemetery Department's financial statement. The body will also receive updates on the conditions of municipal grounds and the cemetery department.

cemeteriesmunicipal-groundsfinance
Thu Dec 4, 2025

School Subcommittees

Finance Subcommittee meeting to review expenses and project updates

The Gardner Public Schools Finance Sub‑Committee will meet on Dec 4, 2025 at 5 PM in Room 201 of 160 Elm Street. The agenda includes approval of prior minutes, review of expense reports, project updates, and discussion of gifts and donations, with any new business that may arise. No specific decisions or dollar amounts are listed in the agenda.

financeschoolsbudgetexpensesprojects
✓ Decided: School sub‑committee accepted a $2,500 donation from Yen Yen

The committee carried over approval of the meeting minutes to the next meeting. A motion by Ms. Pelavin, seconded by Mr. LaFreniere, to accept a $2,500 donation from Yen Yen was approved. The meeting was adjourned at 5:46 pm.

Wed Dec 3, 2025

Airport Commission

Gardner Municipal Airport Commission to review wildlife hazard assessment

The Commission will meet to discuss old business regarding Gales Associates, Inc. and a wildlife hazard site visit. The meeting includes a review of the Environmental Assessment (EA) and Obstruction Analysis. The Airport Manager will also report on guard counts, fuel gallons, and monthly expenditures.

airportenvironmental-assessmentwildlife-hazardbudget
✓ Decided: Commission approved prior meeting minutes and discussed a remote jet club proposal

The commission approved the minutes from the November 5, 2025 meeting. They reviewed the environmental assessment for Gales Associates' tree‑clearing and easement project, noting that funding is pending and a follow‑up meeting with the city is needed. A proposal to start a remote‑jet aircraft club was presented and received positive comments, but no formal action was taken.

Wed Dec 3, 2025

Board of Assessors

Board will consider FY26 property tax exemption applications

The Gardner Board of Assessors will review and vote on FY26 property tax exemption applications and examine FY27 Chapter Land applications. The meeting will also approve the minutes from the October 17, 2025 session and receive an assessor update about a new static database and online property card PDFs. An executive session will be held under G.L. c. 30A, §21(a)(7).

property-taxexemptionsassessorland-applicationsexecutive-session
Mon Dec 1, 2025

City Council

City Council to appropriate $100,975 to the City Stabilization Account

The Gardner City Council meeting will consider several public hearings, committee reports, and a series of financial orders. Items include a flammable license application for E.J. Wyson Trucking, National Grid infrastructure plans, and ordinances affecting zoning and housing. The Finance Committee will vote on appropriations, including a $100,975 transfer to the City Stabilization Account.

zoningutilitiesfinancepublic-hearinghousingsafety
✓ Decided: Council approved two National Grid sidewalk and transformer projects

The Gardner City Council voted 11‑yeas to approve National Grid's plan to install a new hand hole, transformer pad and duct bank on Pleasant Street, and a second plan to install a hand hole and conduit on W Lynde Street. The council also approved a flammable license for E.J. Wyson Trucking at 163 & 169 Colony Road (11‑yeas) and placed the Attorney General’s ruling on an Open Meeting Law complaint on file (11‑yeas).

Mon Dec 1, 2025

Public Safety Committee

City proposes all‑night winter parking ban Jan 1–Mar 1

The Public Safety Committee will consider an ordinance amending Chapter 600 to create an all‑night winter parking ban from January 1 to March 1, 11 p.m. to 5 a.m., with emergency exceptions. The ordinance also establishes a “Noticed Parking Ban” that the Mayor or designee may order, outlines notification methods, and lists designated streets and lots where parking is prohibited during the bans. It sets fines for violations, including a $25 penalty for obstructing snow or ice removal, and authorizes the Gardner Police Department to enforce the bans through tagging, towing, and removal. The measure would become effective upon passage and publication.

parkingtrafficwinterordinancefinespublic-safetyenforcement
✓ Decided: Committee recommends new parking ordinance amendment to full Council

The Public Safety Committee held a public hearing on the winter parking ban and related ordinance. The committee voted to recommend the traffic commission communication (item 11552) to the full Council, with the motion passing unanimously (3 yeas). It also voted to recommend the parking ordinance amendment (item 11737) to the full Council, with the motion passing unanimously (3 yeas). The meeting was then adjourned by a passed motion.

Mon Dec 1, 2025

Special Search Committee for the City Auditor

Committee reviews City Auditor position and hiring criteria

The Special Search Committee for the City Auditor will meet on Dec 1, 2025 to review the City Auditor position. Members will discuss the job description, required qualifications, and the recruitment process. The meeting also includes a notice about open‑meeting recording rules.

city-auditorhiringgovernmentbudgetfinance
✓ Decided: Committee approved updated City Auditor job description with one edit

The Special Search Committee voted to accept the City Auditor job description with a single edit to line 20, as proposed by Councillor Mack and seconded by Councillor Dana Heath. The motion passed with five yeas. The committee then voted to adjourn the meeting at 7:04 p.m.

Wed Nov 26, 2025

Gardner Redevelopment Authority

Redevelopment Authority reviews urban renewal projects and finances

The Gardner Redevelopment Authority will vote to approve the minutes from its October 22, 2025 meeting. It will discuss updates on the Rear Main Project North and South, as well as the 155 Mill Street, 85 Winter Street, and 205‑213 Main Street sites. The board will also review current financial matters and the renewal of its limited liability insurance.

urban-renewalfinanceinsurancemeetingredevelopment
✓ Decided: Board approved a land appraisal for the Cumberland Farms parcel up to $4,600

The Authority approved the minutes from the October 22 meeting (vote 4‑0). It approved moving forward with a land appraisal of the Cumberland Farms property for no more than $4,600 (vote 4‑0). The board entered an executive session to discuss the 155 Mill Street and 85 Winter Street transactions (vote 4‑0) and then adjourned (vote 4‑0). A motion to approve the presented finances was made, but no vote tally was recorded.

Tue Nov 25, 2025

Community Development Block Grant Steering Committee

CDBG funds of $791,342.51 reallocated from school demolition to Greenwood Pool project

The Steering Committee will discuss FY2022-23 and FY2024 CDBG mini‑entitlement budget changes, including a $158,206.52 transfer to the Gardner Community Action Committee and Montachusett Veterans Outreach Center for social services, and a transfer of up to $791,342.51 to a new Greenwood Pool Pavilion, cancelling the School Street School demolition. The meeting will also review the FY2026 CDBG application schedule, update the status of the FY2025 CDBG Mini Entitlement Grant, and approve minutes from the October 28 regular meeting.

cdbgbudgetparkssocial-servicesdemolitiongrant
✓ Decided: Committee approved $791,342.51 transfer to Greenwood Pool Pavilion, canceling School St. demolition

The Steering Committee approved two fund transfers: $158.206.52 to the Gardner Community Action Committee and Montachusett Veterans Outreach Center, and up to $791,342.51 from the School St. School demolition project to the Greenwood Pool Pavilion, cancelling the demolition. Both motions passed unanimously (4‑0). The minutes of the October 28 meeting were also approved unanimously.

Tue Nov 25, 2025

Finance Committee

Finance Committee considered appropriating $95,000 for landfill closure maintenance.

The Gardner Finance Committee reviewed and approved several appropriations from the city's certified free cash, including funds for the City Stabilization Account, the Other Post‑Employment Benefits Trust, road resurfacing, and a landfill closure fund. It also discussed a five‑year on‑call engineering services contract for the municipal airport. Some items, such as the landfill closure appropriation and the stabilization account request, were deferred pending additional information.

financeappropriationslandfillroadsairportbenefits
✓ Decided: Finance Committee recommends $95K landfill closure appropriation

The Finance Committee voted to recommend five appropriation and transfer orders to the full City Council, including $95,000 for landfill closure, $15,000 for outside counsel, $11,000 for health equipment, $100,975 for stabilization, and $100,000 for landfill pump repair. All votes were 3-0. Three discussion items were continued without action.

Tue Nov 25, 2025

Planning Board

Ordinance to amend zoning code to promote housing growth

The Planning Board will consider a City Council amendment referral, Item 11704. The proposed ordinance would amend Chapter 675 of the City of Gardner's zoning code to promote housing growth and production. No other business is listed for this special meeting.

zoninghousingplanningordinance
✓ Decided: Planning Board approves zoning amendment to promote housing growth

The board approved Item 11704, an amendment to Chapter 675 of the City of Gardner zoning code that changes language about ADU rentals and occupancy to encourage housing production. The motion passed unanimously with a 3‑0 vote. After the approval, the board moved to adjourn the meeting, which also passed 3‑0.

Mon Nov 24, 2025

Board of Health

Board reviews landfill leachate pump replacement and groundwater monitoring

The Gardner Board of Health will review minutes from the October 27 meeting, receive health department updates on staffing, landfill leachate pump replacement and groundwater monitoring, the DEP annual report for the closed landfill, food establishments, housing, household hazardous waste collection, a PHEP tabletop exercise, and an emergency dispensing site. The board will then consider any new business, set the next meeting date, and hold an executive session to discuss health department staffing.

healthenvironmentwasteemergency-preparednessstaffing
✓ Decided: Board votes by majority to offer Health Director position to selected candidate

The Board approved the minutes from the October 27 and November 12 executive sessions. After extensive staffing discussion, the board moved into executive session and voted by majority to extend an offer for the Health Director position, with HR to finalize the hire. The next Board of Health meeting was scheduled for December 2, 2025, and the meeting was adjourned.

Mon Nov 24, 2025

Retirement Board

Board will approve retirements and acknowledge deceased members

The Gardner Contributory Retirement Board meeting on November 24, 2025 will review and approve the pre‑close trial balance, general ledger, and city treasurer’s bank reconciliation. It will also discuss the FY’26 budget trial balance, investment review, and old business on disability retirements. New business includes approving retirements, acknowledging deceased members, and reviewing a draft audit report and financial statement for 12/31/2024.

retirementbudgetfinanceauditinvestments
✓ Decided: Board denied inactive member's request to buy back previously refunded service time

The Gardner Contributory Retirement Board approved the October 28, 2025 meeting minutes, the September 2025 trial balances and bank reconciliations, and Warrant #11/25 for $734,297.85. It also approved the draft financial statement and management representation letter from CBIZ/Marcum, maintained the 3.00% correction‑of‑error interest rate, granted superannuation benefits to David L. Suchocki, and denied Scott J. Graves' request to buy back refunded service time.

Mon Nov 24, 2025

Special Search Committee for the City Auditor

City Council forms special committee to find new City Auditor

The Special Search Committee meeting will review the City Auditor position after the auditor's resignation effective Dec 8 2025. Committee co‑chairs Councillors Aleksander Dernalowicz and Dana Heath will discuss the recruitment, review, and recommendation process. Members Kazinskas, Mack, and Heglin will also participate in the discussion.

auditorhiringcity-councilgovernancefinance
✓ Decided: Committee approved revised City Auditor job description and search plan

The Special Search Committee adopted all edits to the City Auditor job description by unanimous voice vote. It also approved the plan to post the vacancy, explore interim auditing services, and conduct the candidate review process, again by unanimous vote. The meeting was adjourned at 5:24 p.m.

Mon Nov 24, 2025

Conservation Commission

Conservation Commission to hold hearings for projects at 827 Green St and 31 Travers St

The Conservation Commission will hold public hearings regarding a proposed building and parking at 827 Green Street and a new carport at 31 Travers Street. The body will also continue discussions on a contractor building at 170 Mill Street and review enforcement orders.

wetlandszoningenvironmentpublic-hearingsconstruction
✓ Decided: Commission ratified emergency certification for Lachance Street beaver dam breach

The Conservation Commission approved the November 10 minutes (5‑0‑1). It ratified an emergency certification for a newly built beaver dam breach on Lachance Street (6‑0‑0). The board also voted to continue the sludge landfill enforcement order discussion and two wetlands hearings to future meetings, each with a 6‑0‑0 vote.

Fri Nov 21, 2025

Economic and Community Development Committee

Committee considers $14,772.53 transfer from Downtown Phase III to Maki Park

The Economic and Community Development Committee will review item 11454, a report on the investigation of the Maki Park Project. It will consider a request to transfer $14,772.53 from the Downtown Phase III project account to Maki Park expenses. The committee will also discuss letters to the mayor seeking clarification on excess Downtown Phase III funds and departmental updates on the Maki Park project.

budgetfinanceparkscommunity-developmentcapital-projects
✓ Decided: Committee waived reading of September 9 minutes and adjourned the meeting

The Economic and Community Development Committee voted to waive the reading of the September 9, 2025 minutes and accepted them as presented. The meeting was then adjourned at 1:08 p.m. No other substantive actions were decided.

Thu Nov 20, 2025

Bandstand Committee

Bandstand Committee reviews minutes, discusses past season and future performers

The Bandstand Committee will approve the minutes from its previous meeting. It will discuss correspondence about the prior season's performances and consider potential performers for upcoming events. The committee will also review its financial statements and address any other business items.

bandstandculturefinancepublic-meeting
✓ Decided: Concert season 2026 dates scheduled with rain‑date Sundays

The Bandstand Committee accepted the minutes from the October 30, 2025 meeting. It confirmed the 2026 concert lineup and rain‑date schedule for Sundays from 2 p.m. to 4 p.m. The Polish American Club submitted a $1,000.00 sponsorship donation. The meeting was adjourned.

Thu Nov 20, 2025

Gardner Housing Authority

Discussion of FY 2025 and FY 2026 financial reports

The Gardner Housing Authority will hold its regular meeting on November 20, 2025. Agenda items include a motion to open the meeting, a public comment period, review of fiscal year 2025 and 2026 financial matters, acceptance of the October 23, 2025 meeting minutes, an executive director’s report, and an invoice history report for October 2025. The meeting will conclude with a motion to adjourn.

financehousing-authoritymeetingreports
Thu Nov 20, 2025

Gardner Cultural Council

Cultural Council to decide FY26 Massachusetts Cultural Council allotments

The Gardner Cultural Council will review applications submitted to the Massachusetts Cultural Council for fiscal year 2026. The council will decide which applicants receive funding and set a schedule for posting approvals or denials on the MCC website. The meeting also includes adjournment of any old business.

culturegrantsfundingcouncilarts
Wed Nov 19, 2025

Board of Health

Board conducts second interviews for Director of Public Health

The Gardner Board of Health will hold an executive session at 6:00 p.m. The session will include second interviews for the Director of Public Health candidate. No other agenda items are listed.

healthpersonnelexecutive-session
✓ Decided: Board unanimously approved an executive session on 11/24 to finalize health director hire

The Board of Health opened an executive session and completed second interviews with the final two candidates. Members then voted unanimously to hold another executive session at the November 24 meeting to finalize the decision on hiring the next Health Director. No other actions were taken.

Wed Nov 19, 2025

School Subcommittees

School Subcommittee will review policies, budget and field trip approvals

The Gardner Public Schools Policy Subcommittee will meet to approve the minutes from the October 15, 2025 meeting and to review a series of policy items, including procedures, communications, conferences, and member compensation. The committee will also discuss the annual school budget, field trip approval forms, and educational equity initiatives. The next meeting is scheduled for December 17, 2025.

educationbudgetpolicyfield-tripsequity
✓ Decided: Subcommittee approved sending revised policies to full School Committee for first read

The Policy Subcommittee unanimously approved the October 15 minutes and voted to table two field‑trip policies until the December meeting. It also approved recommended changes to eight other policies and directed that each be sent to the full School Committee for a first read in December.

Tue Nov 18, 2025

Historical Commission

Gardner Historical Commission to discuss North Central Pathway Extension

The Historical Commission will review a communication from Tighe & Bond regarding the North Central Pathway Extension (MassDOT Project No. 613260). The body will also discuss administrative rules for historic preservation special permits and several local preservation projects.

historic-preservationinfrastructurecity-planningarchives
✓ Decided: Historical Commission approved prior minutes and authorized a City Hall letter

The commission voted to accept the minutes of the October 21, 2025 meeting. They approved a motion authorizing Chair Chris Pera to prepare and submit a letter to the Building Commission about the historic significance of City Hall. The members agreed to schedule a site visit by two commissioners to review the North Central Pathway Extension project. The meeting was adjourned at 7:28 p.m.

Tue Nov 18, 2025

Public Welfare Committee

Public Welfare Committee to receive department updates

The Public Welfare Committee will meet to receive updates from several city departments and commissions. No specific votes or new ordinances are listed on the agenda.

department-updatesrecreationairportdisability-services
✓ Decided: Public Welfare Committee met, provided updates but made no decisions

The committee heard updates from the Recreation Department, Airport officials, and received reports on Greenwood Pool and the Disability Commission. No motions or votes on policy, budget, or projects were taken. The meeting was adjourned at 5:52 p.m.

Tue Nov 18, 2025

Zoning Board

Public hearing on sign requirement relief for 4 Oak Street

The Zoning Board of Appeals will hold public hearings on three pending applications. They will consider a request for sign requirement relief at 4 Oak Street (PID M22-4-57), a proposal for a new multi‑family dwelling by Walnut Heritage House Trust at 63 Walnut Street (PID R27-22-20), and an application for a motor‑vehicle light service business by Patrick J. Comiskey at 381 East Broadway (PID W12-18-4A). The meeting will also cover routine new‑business items such as announcements, correspondence, and acceptance or correction of prior minutes.

zoningsignshousingbusinesspublic-hearing
✓ Decided: Board approved special permit for Walnut Heritage House Trust at 63 Walnut St.

The board accepted the withdrawal of a sign variance application without prejudice. It approved a special permit for Walnut Heritage House Trust to develop seven multi‑family dwellings at 63 Walnut St., subject to pre‑established conditions. It also approved a special permit for Center Auto to provide motor‑vehicle light service at 381 E Broadway. Minutes from the October 21, 2025 meeting were tabled until the next month.

Mon Nov 17, 2025

Ad-Hoc Compensation Proposal Committee

Committee to discuss compensation ordinance for non-union employees

The Ad-Hoc Compensation Proposal Committee will meet to discuss the creation of a proposed compensation ordinance for non-union employees. The agenda includes financial forecasting and budget data for various city positions and revenue sources.

compensationbudgetnon-union-employeestax-levycity-government
Mon Nov 17, 2025

City Council

City Council will appropriate $201,951 for Public Works road resurfacing

The Gardner City Council meeting will consider several financial appropriations, including $201,951 for the Department of Public Works Road Resurfacing Account and $20,196 for the OPEB Stabilization Account. It will also discuss ordinances to allow cottage kitchens in residential districts and to promote housing growth, as well as a measure to contract on‑call engineering services for the municipal airport. Public hearings are scheduled for National Grid projects on Pleasant Street and Derby Drive.

financeinfrastructurezoningpublic-worksutilitiesappointments
✓ Decided: Council authorized a five‑year on‑call engineering contract for Gardner Municipal Airport

The City Council approved a five‑year on‑call engineering services contract for the municipal airport (10 yeas). It also appropriated $20,196 to the Post‑Employment Benefits Liability Trust Fund, $201,951 to the Public Works road‑resurfacing account, and $100,000 to the landfill pump repair account (each 10 yeas). Several ordinance amendments were sent to first printing, including changes to non‑union compensation and lifeguard pay (10 yeas). A motor‑vehicle dealer license was granted to FJ Drive Zone Corp. at 407 Chestnut Street.

Mon Nov 17, 2025

Williams-Rockwell

Williams-Rockwell Educational Gift Foundation to vote on grant application process

The committee will review outstanding awarded grants and receive an investment update from Raymond James. The body is scheduled to vote on opening the grant application process for the 2025-2026 school year.

educationgrantsinvestments
✓ Decided: Committee approved withdrawal of $322,769.70 from the fund

The committee approved the minutes from the February 26, 2025 meeting. It voted to withdraw and segregate $322,769.70, representing 90% of the fund's assets. The financial report for the Williams‑Rockwell Educational Gift Fund was accepted, and the 2025‑2026 grant application period was extended to Jan. 30 with $322,769.70 available. All motions passed with all members present voting in favor.

Mon Nov 17, 2025

Golf Commission

Commission will review and approve its financial report

The Gardner Golf Commission will consider approving the minutes from its October 20, 2025 meeting. It will receive an update on the building feasibility study. The commission will review and approve its financial statements and expense report. Additional updates from Dan Berry and Bill Frank will be presented.

golf-commissionfinanceminutesfeasibility-studymeeting
✓ Decided: Golf Commission approved prior minutes and kept rates unchanged

The commission voted 4‑0 to accept the September 15, 2025 meeting minutes. A motion also passed 4‑0 to keep the upcoming season's golf rates the same. The FY26 financial report was accepted by a 4‑0 vote, and the meeting was adjourned with a 4‑0 vote.

Fri Nov 14, 2025

Public Safety Committee

All-night parking ban (snow ban) proposed for Jan 1–Mar 1

The Public Safety Committee will consider an ordinance to amend Chapter 600, Section 24 of the City of Gardner Code. The amendment would create an all‑night parking ban, known as a snow ban, from January 1 to March 1 each year, effective nightly from 11:00 p.m. to 5:00 a.m. The ban would apply to all public ways, highways, and city‑controlled parking lots, with exemptions for emergency vehicles. The ordinance would take effect upon passage and required publication.

parkingtrafficpublic-safetyordinancewintercity-code
✓ Decided: Public Safety Committee recommends hearings and forwards two license applications

The committee voted 3 yeas to recommend holding a public hearing on the winter parking ban towing issue before the next City Council meeting. It also voted 3 yeas to accept the flammable‑license application for E.J. Wyson Trucking at 163 & 169 Colony Road and forward the item to the full Council. Additionally, the committee voted 3 yeas to recommend the Class 2 license application for FJ Drive Zone Corp. at 407 Chestnut Street to the full City Council.

Wed Nov 12, 2025

Board of Health

Board of Health holds executive session to interview Director of Public Health candidates

The Gardner Board of Health will meet at 5:10 p.m. in the Hubbard Conference Room for an executive session. The session will include interviews of candidates for the Director of Public Health. An announcement will remind attendees of the policy on video or audio recordings. A notice states that agenda items are anticipated by the Health Agent and may change.

healthpersonnelmeetingrecordingsgovernance
✓ Decided: Board approves interview process and schedules second interviews

The Board of Health voted to proceed with the interview process as outlined, with all members present voting in favor. Two candidates will be called back for a second interview on November 19 at 6 pm in the Executive session. The Chair will contact the HR Director in the morning to update on the interview process. The next meeting is set for Monday, November 19, 2025 at 5:00 pm in the Hubbard Conference Room.

Wed Nov 12, 2025

Finance Committee

FY2026 tax rate certified at $13.77, setting city’s revenue target

The Finance Committee will review and approve the meeting minutes and consider several agenda items. It will receive the mayor’s communication that the Massachusetts Department of Revenue certified Gardner’s FY2026 tax rate at $13.77, establishing a total levy of $35,085,926.81 for the fiscal year. The committee will also consider appropriations from free cash to the City Stabilization, OPEB Stabilization, and Public Works Road Resurfacing accounts, an $11,000 transfer within the Health Department, and a measure to award a five‑year on‑call engineering contract for the Gardner Municipal Airport.

taxbudgetairportengineeringhealthpublic-worksfinance
✓ Decided: Finance Committee approved $201,951 for road resurfacing

The Finance Committee made several approvals, including a $201,951 appropriation for the Department of Public Works road resurfacing account and a $20,196 transfer to the Other Post‑Employment Benefits Trust Fund. It also authorized a five‑year on‑call engineering contract for the municipal airport and payment of a $750 prior‑year health commission salary expense. Several items were deferred for more information or removed from the agenda.

Wed Nov 12, 2025

Disability Commission

Disability Commission to review minutes and discuss accessibility projects

The Disability Commission will review October meeting minutes and discuss updates on the City Accessibility project and a donation to the Community Action Committee. The meeting will also cover a monthly CODA call update and other business.

disabilityminutesadaaccessibilitycaccoda
Wed Nov 12, 2025

Appointments Committee

Appointments Committee to review mayoral appointments for city boards

The Appointments Committee will interview and discuss several mayoral appointments to city boards and commissions. The body is reviewing candidates for roles related to planning, zoning, and educational fund oversight.

appointmentsplanning-boardzoningcity-government
✓ Decided: Committee recommended confirming five mayoral appointments, each 3‑yea vote

The Appointments Committee voted to recommend the City Council confirm the mayor’s appointments of Paul Cormier (Planning Board), James Faust (Williams‑Rockwell Educational Gift Fund Trustee), Magnus Paul Carlberg (Redevelopment Authority and Industrial Development Finance Authority), and Timothy Horrigan (Industrial Development Finance Authority). Each motion was made by Councilor Kazinskas, seconded by Councilor Heglin, and passed with three yeas. The committee deferred decisions on Richard Roux, Robert Rice, and Melory Cornett, requesting more time.

Mon Nov 10, 2025

School Committee

School Committee approves $2.3 million in warrants and a $44,910 grant

The Gardner School Committee will adopt a consent agenda that includes a $44,910 grant for social‑emotional learning and four warrants totaling $2,267,593.80. It will conduct first and second readings of several policies, including the annual budget and student discipline, and vote to move the School Improvement Plan from the policy manual to the procedures manual. A vote on a surplus of equipment and several informational updates will also be considered.

school-committeebudgetgrantspoliciesequipmentimprovement-plan
✓ Decided: School Committee ratifies several warrants and approves policies

The committee accepted the consent agenda, which included a $44,910 grant and four warrants ranging from $206,992.59 to $887,325.63. It declared 91 kitchen items surplus and authorized their disposal. The board approved a second reading of four policies and removed one policy from the manual. The meeting was then adjourned.

Mon Nov 10, 2025

License Commission

License Commission to consider permits for holiday events

The Gardner License Commission will consider four one-day permits for holiday events at the Perry Auditorium. The board will also discuss the status of several liquor license applications pending state approval.

licensingeventsalcoholperry-auditoriumabccrenewals
✓ Decided: Commission approves several one‑day alcohol permits and license transfers

The License Commission unanimously approved the minutes from the October 14, 2025 meeting. It also unanimously approved four one‑day alcohol permits for events at the Perry Auditorium. The Commission approved the transfer of the Sawa Asian Cuisine & Lounge license, the new on‑premises license for Sawa to Go, and the officer change for the Gardner Fish & Gun Club. All approved items were submitted to the ABCC for final action.

Mon Nov 10, 2025

Conservation Commission

Conservation Commission to hold hearings on four development projects

The Conservation Commission will hold public hearings regarding wetlands protection for projects at 31 Travers St., Dunn State Park, 42 Linus Allain Avenue, and 827 Green Street. The body will also consider reimbursement for an enforcement workshop.

wetlandspublic-hearingsconservationzoningenvironment
✓ Decided: Commission closed two NOI hearings and issued standard Orders of Conditions

The Commission approved the minutes from the October 27 meeting. It continued the public hearing for 31 Travers Street and for 827 Green Street until the November 24 meeting. It closed the hearings for Dunn State Park and 42 Linus Allain Avenue and issued standard Orders of Conditions for each project. The board also approved a $595 reimbursement for staff training and adjourned the meeting.

Thu Nov 6, 2025

Gardner Cultural Council

Council will review and decide FY26 Massachusetts Cultural Council grant applicants

The Gardner Cultural Council will review applications submitted to the Massachusetts Cultural Council for fiscal year 2026. The council will decide which applicants receive allotments. It will also set a schedule for posting approvals or denials on the MCC website.

culturegrantsmccbudgetarts
Thu Nov 6, 2025

School Subcommittees

Gardner Public Schools Facilities Sub-Committee to meet November 6

The Facilities Sub-Committee will meet to discuss project updates and other old or new business. The agenda does not list specific projects or proposals for decision.

schoolsfacilitiesinfrastructure
✓ Decided: Committee recommended disposal of 91 surplus kitchen items

The Facilities Sub‑Committee approved the September 2, 2025 meeting minutes. It voted to recommend a list of ninety‑one excess kitchen equipment items to the school committee for disposal. The committee also noted that only assistant principals may now submit maintenance work orders. The meeting was adjourned at 5:25 p.m.

Thu Nov 6, 2025

School Subcommittees

Finance Subcommittee will review expenses, projects, and donations

The Gardner Public Schools Finance Subcommittee will meet on November 6, 2025 at 5:00 PM in Room 201 of 160 Elm Street. The committee will consider approval of the previous meeting’s minutes, review an expense report, receive updates on school projects, discuss gifts and donations, and consider any new business. Items listed are anticipated by the chair but may not all be discussed.

financeeducationbudgetschools
✓ Decided: Finance Subcommittee approved prior meeting minutes

The sub‑committee approved the minutes from the September 2, 2025 Finance meeting. The meeting was then adjourned at 5:10 p.m. No other actions were taken.

Wed Nov 5, 2025

Airport Commission

Commission will consider a Letter of Agreement with MIT/LL

The Gardner Airport Commission will first approve the minutes from the previous meeting. It will then review the environmental assessment and obstruction analysis prepared by Gales Associates, Inc. The commission will hear the airport manager’s report. Finally, the board will consider a Letter of Agreement with MIT/LL.

airportenvironmental-assessmentletter-of-agreementmit-ll
✓ Decided: No substantive decisions were made at the Gardner Airport Commission meeting

The meeting consisted of updates on wildlife hazard payments, the draft obstruction study, and the airport's Capital Improvement Plan. The manager reported available funds and expenses, and noted that the MIT usage agreement has not yet been received. No motions, votes, or approvals were recorded.

Tue Nov 4, 2025

Planning Board

Planning Board to consider ordinance permitting cottage kitchens in residential zones

The Gardner Planning Board will hold a public hearing on a building addition and site improvements for Mount Wachusett Community College at 42 Linus Allain Avenue. It will review preliminary site plans for a GAAMHA building at 827 Green Street and a Walmart fueling station at 677 Timpany Blvd. Two zoning ordinances will be considered: one to allow cottage kitchens in residential districts and another to promote housing growth. The board will also vote to approve the minutes from the October 14, 2025 regular meeting.

zoninghousingdevelopmentpublic-hearingplanning
✓ Decided: Planning Board voted 4-0 to send housing growth zoning amendment to City Council

The Board approved the October 14th minutes (4-0). It continued the Mount Wachusett Community College site plan hearing to Dec. 9 (4-0). It approved sending an ordinance to allow cottage kitchens in residential districts to City Council (4-0). It also approved sending an ordinance to promote housing growth and production to City Council (4-0).

Mon Nov 3, 2025

City Council

City Council to consider $6.9 million loan for Gardner Middle School roof replacement

The City Council will discuss borrowing $6,911,028.00 for the Gardner Middle School Accelerated Repair Roof Replacement Project. The city expects to receive up to 80% reimbursement from the Massachusetts School Building Authority for eligible costs. A public hearing is also scheduled regarding a flammable license application.

schoolsbudgetborrowinglicensinginfrastructure
✓ Decided: Council approves $6.9M roof repair funding for Gardner Middle School

The City Council voted 11-0 to appropriate $6,911,028 for the Gardner Middle School roof replacement project. It also approved a flammable license for E.J. Wyson Trucking at 163 & 169 Colony Road and scheduled a public hearing. The council placed the October Economic and Community Development Update on file. The meeting was adjourned at 7:54 p.m.

Mon Nov 3, 2025

City Council

City Council to consider housing‑growth zoning amendments at joint hearing

The Gardner City Council and Planning Board will hold a Joint Public Hearing on Monday, November 3, 2025 at 6:30 p.m. in the City Council Chamber, Room 219, City Hall, 95 Pleasant Street. The hearing will consider two ordinances to amend Chapter 675 of the zoning code: Ordinance 11688 to allow cottage kitchens in residential districts, and Ordinance 11704 to promote housing growth through new Small Home provisions, ADU rules, and expedited permitting. All interested residents may attend and offer testimony.

zoninghousingdevelopmentplanningpublic-hearing
✓ Decided: City Council held a joint public hearing on two zoning amendment proposals

The council and Planning Board heard public testimony on Ordinance #11688 to allow cottage kitchens in residential districts and Ordinance #11704 to promote housing growth. No members of the public spoke, and council members asked questions but did not vote. The hearing was closed at 7:30 p.m. with no formal decisions recorded.

Thu Oct 30, 2025

Cemetery Commission

Cemetery Commission to act on Old Burying Ground assessment proposal

The Cemetery Commission will hold a special meeting to act on a proposal for the Old Burying Ground Assessment. The commission is reviewing an estimate for a master plan to assess and categorize gravestones for repair and preservation.

cemeteriespublic-workspreservation
✓ Decided: Cemetery Commission approved moving forward with Gravestone Services estimate

The commission voted to approve the consensus to proceed with an assessment estimate from Gravestone Services of New England, requesting a new date for the estimate. The motion passed with all members in favor. The meeting was then adjourned at 8:30 a.m.

Thu Oct 30, 2025

Bandstand Committee

Bandstand Committee will discuss prior season and potential performers

The Bandstand Committee will first approve minutes from its previous meeting. It will then discuss the previous season's activities and consider potential performers for upcoming events. The committee will review its financial statements before addressing any other business.

bandstandculturefinancepublic-meeting
✓ Decided: Bandstand Committee accepted minutes and approved QR code on 2026 flyers

The committee approved the minutes from 10/15/2025 with corrections. Members agreed to add a QR code to the 2026 concert flyers for donations and information. The meeting was adjourned at 4:05 p.m. after a motion to adjourn.

Tue Oct 28, 2025

Community Development Block Grant Steering Committee

Transfer of $618,200 to Greenwood Pool Pavilion and cancellation of school demolition

The Community Development Block Grant Steering Committee will consider budget changes for FY2022‑23 and FY2024 CDBG mini‑entitlement funds, including transfers of $102,447 and $618,200 to Greenwood Pool projects and the cancellation of the School Street School demolition. The committee will discuss how to select new projects using the remaining FY2022‑23 funds of $158,206.52 and FY2024 funds of $173,142.51 if the transfers are approved. The meeting also includes project updates and a vote to approve the September 23, 2025 regular‑meeting minutes.

cdbgbudgetdemolitionpoolschoolpublic-hearingcommunity-development
✓ Decided: Committee approved $102,447 transfer to Greenwood Pool demolition

The steering committee voted 4‑0 to move $102,447 from the completed 205‑213 Main Street demolition project to the Greenwood Pool demolition project. It also voted 4‑0 to postpone the public hearing on a $618,200 transfer for the Greenwood Pool Pavilion until the November meeting. Additional motions to continue the discussion at the next meeting and to accept the September minutes both passed unanimously.

Tue Oct 28, 2025

Retirement Board

Board to approve trial balance, ledger, and bank reconciliation

The Gardner Contributory Retirement Board will review and approve the pre‑close trial balance, general ledger, and the City Treasurer’s bank reconciliation. It will also consider accounts payable and payroll warrants, an investment review for September 2025, the final actuarial valuation report for 2025, and approve retirements while acknowledging deceased members.

retirementfinancepayrollinvestmentactuarial
Mon Oct 27, 2025

Board of Health

Board adopts new well water regulations to take effect Jan 1 2026

The Gardner Board of Health approved the final draft of the Well Regulations, which will become effective on January 1, 2026. The board also authorized a Title 5 Local Upgrade Approval for 9 Stone Street, reducing the required setback to 3 feet. Health department updates included a $40,000 funding shortfall for the landfill leachate pump replacement and a pending $168,000 bid for a full leachate system repair. The board discussed recent improvements at the town transfer station, such as new stairs, erosion controls, and a change in metal hauler service.

water-qualityregulationstitle-5landfillhealth-departmenttransfer-station
✓ Decided: Board approves leachate pump replacement contract for landfill

The Board approved the July 1, 2025 meeting minutes and tabled the September 22, 2025 minutes for the November meeting. Angela DiPrima was named Acting Director and Dewan Falzon started a new position on October 22, 2025. A contract for leachate pump replacement at the landfill was awarded and signed. A housing unit was condemned and the owner ordered to complete repairs within set timeframes.

Mon Oct 27, 2025

Conservation Commission

Conservation Commission to hold hearings on sewer and park projects

The Conservation Commission will hold public hearings regarding a new sewer line and improvements at Dunn State Park and 42 Linus Allain Avenue. The body will also discuss a contractor building at 170 Mill Street and a project with the North County Land Trust.

wetlandssewerpublic-worksconservationzoning
✓ Decided: Commission denies sewer line project with Negative 3 determination

The Conservation Commission approved the September 22 minutes and issued a Certificate of Compliance for 95 Peason Boulevard. It voted to continue enforcement discussions for the Sludge Landfill, 36 Nicolle Terrace, and 282 Brookside Drive. The commission closed the hearing on the 150 Linus Allain Avenue sewer line and issued a Negative 3 Determination. It also approved a $1,680 payment for seasonal mowing of the Alisauskas Property.

Thu Oct 23, 2025

Gardner Housing Authority

Invoice History Report for September 2025 will be reviewed

The Gardner Housing Authority will open its regular meeting, accept the minutes from the September 23, 2025 meeting, hear the Executive Director’s report on other matters, review the September 2025 invoice history, allow public comment, and then adjourn.

housing-authorityfinancepublic-commentmeeting
Wed Oct 22, 2025

Gardner Redevelopment Authority

Authority will vote on Sep 24 minutes and review urban renewal projects

The Gardner Redevelopment Authority will consider approval of the minutes from its September 24, 2025 regular meeting. It will receive an update on the Urban Renewal Plan, including the status of properties at 155 Mill Street, 85 Winter Street, and 205‑213 Main Street, and discuss current financial information. The meeting will also include the introduction of new board members.

redevelopmenturban-renewalminutesboardfinance
✓ Decided: GRA voted 5‑0 to enter executive session for land sale

The Gardner Redevelopment Authority approved the September 24 minutes with a 5‑0 vote. It then voted 5‑0 to enter an executive session to discuss a land sale. The meeting was adjourned by a 5‑0 vote.

Tue Oct 21, 2025

Historical Commission

Commission will discuss Old Burying Ground restoration and preservation

The Gardner Historical Commission will meet on Tuesday, October 21, 2025 at the Gardner Museum Resource Room, 28 Pearl Street. The agenda includes approval of the September 23, 2025 meeting minutes, administrative items such as membership recruitment and a law department review of historic preservation rules, and discussion of several projects. Project topics include historic markers, the Old Burying Ground restoration, Greenwood Memorial Pool artifacts, school disposition status, community‑center archives, and a MACRIS update. No specific decisions or votes are indicated in the agenda.

historical-preservationburial-groundcommunity-centerschoolarchivesmuseum
✓ Decided: Commission approved prior minutes and accepted $4,500 graveyard assessment

The Gardner Historical Commission approved the September 23, 2025 meeting minutes. It accepted a $4,500 assessment proposal from Gravestone Services for the Old Burying Ground, pending Cemetery Commission approval. Commissioners voted to send a collaborative letter to local institutions and provided forms to a resident seeking historic register status. The meeting was adjourned at 7:25 p.m.

Tue Oct 21, 2025

Zoning Board

Public hearing on sign requirements for 4 Oak St. (PID# M22-4-57)

The board will hold a public hearing on a request to modify sign requirements for the property at 4 Oak Street (PID# M22-4-57). The board will also consider routine new‑business items, including announcements, correspondence, and acceptance or correction of the previous meeting’s minutes.

zoningsignspublic-hearingminutesboard
✓ Decided: Board grants continuation of NH Signs variance application

The Zoning Board accepted the September meeting minutes by unanimous vote. It also voted unanimously to grant a continuation of the variance request for NH Signs at 4 Oak Street, directing the applicant to meet with the Building Commissioner before a final decision.

Mon Oct 20, 2025

Ad-Hoc Compensation Proposal Committee

Committee to discuss non-union employee compensation ordinance

The Ad-Hoc Compensation Proposal Committee will meet to discuss creating a proposed compensation ordinance for non-union employees. The meeting is scheduled for Monday, October 20, 2025, at 6:30pm in the City Council Chambers.

city-councilcompensationnon-unionordinancegovernance
Mon Oct 20, 2025

Golf Commission

Golf Commission to review financials and building feasibility study

The Gardner Golf Commission will meet to approve meeting minutes, discuss a building feasibility study, and review financial reports.

golfcommissionfinancefeasibility-studyminutes
✓ Decided: Commission approved $33,600 building feasibility study

The Golf Commission accepted the September 15 minutes (5‑0). It approved a $33,600 building feasibility study to inform a potential new building (4‑1). The commission also accepted FY26 year‑to‑date financials (5‑0) and adjourned the meeting (5‑0).

Mon Oct 20, 2025

City Council

City Council to consider borrowing $6.9 million for Gardner Middle School roof replacement

The Gardner City Council will discuss the FY2026 Tax Classification Hearing and consider a measure to borrow $6,911,028 for the Gardner Middle School roof replacement project at 297 Catherine Street. The council will also review an ordinance adding an Assistant Youth Center Director position to the Non‑Union Compensation Schedule and confirm several mayoral appointments. Additional items include a measure related to the November 4, 2025 city election and other public hearing matters.

financeeducationappointmentselectionspublic-hearings
✓ Decided: Council sets FY2026 residential tax factor at one for all properties

The City Council adopted a residential factor of one for real‑estate taxation for FY2026. It voted to request additional time to consider borrowing $6,911,028 for the Gardner Middle School roof replacement project. An ordinance adding an Assistant Youth Center Director position at $20 per hour was approved. Two mayoral appointments of Jonathan Zlotnik to authority boards were confirmed.

Fri Oct 17, 2025

Public Safety Committee

Public Safety Committee reviews winter parking ban and police department updates

The committee discussed a recommendation to shorten the winter parking ban from five months to three months (December to March) to reduce towing volume and DPW delays. The police department provided updates on staffing, grant funding, and a request for supplemental body camera funding.

parkingpolicepublic-safetybudgettowing
✓ Decided: Committee voted to place traffic commission measure on file

The Public Safety Committee waived reading and accepted the minutes from August 28 and September 12, 2025 (3 yeas). It also voted to place a traffic commission measure regarding a 25‑mph speed limit on file pending law department review (3 yeas). No other substantive actions were decided.

Fri Oct 17, 2025

Board of Assessors

Board will vote on recommendation for single vs split tax rate for FY2026

The Board of Assessors will begin the meeting, approve the minutes from the September 24, 2025 meeting, and consider its recommendation to the City Council on adopting either a single or split property tax rate for fiscal year 2026. The board will also hold an executive session under state law and will discuss, review, and decide on FY26 exemption applications.

tax-rateproperty-assessmentbudgetexemptionscity-council
✓ Decided: Board recommends a single residential tax factor to City Council

The Board approved the September 24, 2025 minutes (2‑0). It voted to recommend a Residential Factor of 1, creating a single tax rate, to the City Council (3‑0). The Board entered Executive Session (3‑0) and approved Clauses 17D (2), 22A‑F (1) and 41C (2) while denying Clause 22E (2).

Thu Oct 16, 2025

Public Welfare Committee

Council to approve veteran services agreement with Hubbardston and cottage‑kitchen zoning change

The Public Welfare Committee voted to forward two items to the full City Council for approval. One is Measure 11683, authorizing the mayor to sign an intermunicipal agreement that extends Gardner’s veteran services to Hubbardston, with an intermunicipal fee of $2 per resident prorated for six months. The second is Ordinance 11688, amending the zoning code to permit cottage‑kitchen operations in single‑family, rural residential, and general residential districts.

veteran-serviceszoningcottage-kitchensintermunicipal-agreementhousing
✓ Decided: Committee amends accessible dwelling size and forwards housing ordinance to council

The Public Welfare Committee approved waiving the reading and accepting the September 30, 2025 minutes. It voted 3 yeas to increase the maximum square footage for an accessible dwelling unit from 900 to 1,250. The committee also voted 3 yeas to send the amended housing ordinance to the full City Council for passage.

Wed Oct 15, 2025

Finance Committee

City proposes to sell 13‑17 West Lynde Street land as surplus, minimum $1,000

The Finance Committee will review and approve the previous meeting minutes. It will consider the mayor’s communications certifying the FY2026 LA‑4 property valuation and the FY2026 LA‑13 new‑growth assessment, which affect the upcoming tax rate. The committee will discuss a measure setting the November 4 2025 city election schedule. In subcommittee, members will discuss health‑insurance payments and a measure to declare the land at 13‑17 West Lynde Street surplus, authorizing its sale for at least $1,000.

finance-committeeassessmenttax-rateproperty-salehealth-insuranceelection
✓ Decided: City Council to hold November 4, 2025 election as ordered

The Finance Committee recommended that the full Council place the FY2026 LA‑4 and LA‑13 tax certifications on file. It also adopted the City Election Order setting the November 4, 2025 election date. The committee granted additional time for discussion of health‑insurance payments and the disposition of land at 13‑17 West Lynde Street.

Wed Oct 15, 2025

Bandstand Committee

Bandstand Committee to discuss previous season and potential performers

The Bandstand Committee will meet to review the previous season and discuss potential performers. The body will also review financial statements and approve minutes from the previous meeting.

artsculturepublic-spacesgardner
✓ Decided: Bandstand Committee accepted minutes and cancelled July 4th concert

The committee accepted the minutes from the October 15 meeting. It decided not to hold a concert on July 4th and will instead include a concert during the food‑truck festival. The Polish American Vet pledged a $1,000 donation as a sponsor. The next meeting is set for October 30, 2025 at 3:30 p.m.

Wed Oct 15, 2025

School Subcommittees

Policy Subcommittee will review school policies and officer duties

The Gardner Public Schools Policy Subcommittee will approve the minutes from September 17, 2025 and review a series of school policies, including duties of the Vice Chair, Secretary, and other officers, the superintendent contract, support services, student progress reports, graduation requirements, and medication administration. The committee will also discuss the August 2025 MASC policy updates. The meeting will set the next subcommittee dates for November 19 and December 17, 2025.

school-policygovernanceeducationadministrationmeetings
✓ Decided: Subcommittee approved sending multiple policy revisions to full School Committee

The Policy Subcommittee unanimously approved the September 17 minutes and marked two policies as reviewed with no changes. It recommended combining policies BDBB and BDBC into Policy BDG and sent the revised Policy BDB to the full School Committee for a first read. Several policies were approved for removal of source dates and one was moved from the policy manual to the procedures manual. All motions passed unanimously.

Tue Oct 14, 2025

Conservation Commission

Commission to hold hearing on sewer line applicability at 150 Linus Allain Ave

The Gardner Conservation Commission will vote to approve the minutes from the September 22, 2025 meeting. It will conduct a joint public hearing under MGL Ch. 131 §40 to determine applicability of the Wetlands Protection Act and the city’s Wetlands Protection Ordinance for a proposed sewer line at 150 Linus Allain Avenue, which falls within a Buffer Zone of an Isolated Vegetated Wetland and a Riverfront Area. Public comment will be limited to two minutes per speaker.

wetlandssewerpublic-hearingenvironmentcity-government
Tue Oct 14, 2025

School Committee

School Committee to vote on superintendent goals and district improvement plan

The Gardner School Committee will meet to approve minutes and warrants totaling over $1.7 million, discuss policy updates, and vote on superintendent goals and the district improvement plan.

school-committeebudgetpolicysuperintendenteducationwarrant
✓ Decided: District Improvement Plan 2024‑2027 approved by School Committee

The Gardner School Committee approved the Consent Agenda, ratifying five warrants and a $16,000 music donation. The Committee also approved the Superintendent’s FY26 goals and the District Improvement Plan for 2024‑2027. A first reading was scheduled for four new policies, and the meeting was adjourned.

Tue Oct 14, 2025

License Commission

Commission hearing on Gardner Fish & Gun Club officer change

The License Commission will open with announcements and approve the September 9, 2025 meeting minutes. It will hold a hearing on the Gardner Fish & Gun Club’s application to change officers. The commission will review status updates on several pending license transfers and manager changes, including Sawa Asian Cuisine, Sawa to Go, South Gardner Hotel, and Gardner Lodge. New business includes introducing a new clerk, Dewan Falzon, and noting the upcoming liquor‑license renewal deadline of November 26, 2025.

license-commissionliquor-licensesbusiness-licenseshearingspersonnel-changesnew-clerk
✓ Decided: Commission approved fee increases for liquor license applications

The commission unanimously approved the September 9, 2025 meeting minutes and a change of officers for the Gardner Fish & Gun Club. It also approved several pending license actions—including a transfer for Sawa Asian Cuisine & Lounge, a new on‑premises all‑alcohol license for Sawa to Go, and a change of manager/officers for Gardner Lodge 1426 BPO Elks—though these remain subject to ABCC approval. Additional actions included deferring a trade‑in advisory, adopting fee increases for 1‑day liquor licenses and amendment applications, and setting the November meeting for November 10, 2025 in the Council Chamber.

Tue Oct 14, 2025

Planning Board

Board will consider an ordinance permitting cottage kitchens in residential areas

The Planning Board will hold a continuation of public hearings, including a vote to approve the minutes from the September 12, 2025 regular meeting. It will review the definitive site plan for a building addition and site improvements at Mount Wachusett Community College, 42 Linus Allain Avenue. The board will also consider two zoning amendment ordinances: one to allow cottage kitchens in residential districts (Item 11688) and another to promote housing growth and production (Item 11704).

zoninghousingdevelopmentpublic-hearing
✓ Decided: Board scheduled joint public hearings on cottage kitchens and housing growth

The Planning Board voted to continue the Mount Wachusett Community College public hearing to November. It approved the September 9, 2025 meeting minutes. The Board also scheduled joint public hearings with the City Council for Ordinance Items 11688 (cottage kitchens) and 11704 (housing growth) on November 3, 2025, with a follow‑up Board meeting on November 4, 2025. The meeting was adjourned at 6:36 p.m.

Tue Oct 14, 2025

Appointments Committee

Appointments Committee confirms mayor's appointments to city authorities

The Gardner Appointments Committee will interview and discuss a series of mayoral appointments. Members will vote on measures confirming appointments to the Redevelopment Authority, Industrial Development Finance Authority, city director positions, and various commissions. The agenda also includes a communication from the mayor regarding the department title and a discussion of committee rules.

appointmentscity-governmentpersonnelcommitteesgovernance
✓ Decided: Committee recommended confirming all mayoral appointments, passing each with 3 yeas

The committee approved the amended minutes from the September 24, 2025 meeting with three yeas. It voted to recommend the mayor’s appointments—including Director of Purchasing, Redevelopment Authority members, Industrial Development Finance Authority members, Youth Commission member, and others—to the full council, each passing with three yeas. The committee also voted to keep the Information Technology Director appointment item on the agenda, with three yeas.

Fri Oct 10, 2025

Development Review Committee

Committee reviews two development proposals: support-animal facility and fueling station

The Development Review Committee will consider two conceptual site plans submitted as new business. One plan, from GAAMHA, Inc., proposes a 74‑by‑100‑foot structure for offices, meeting rooms, and a barn area for residents working with support animals at 827 Green Street. The second plan, from Walmart Real Estate Business Trust, proposes a self‑service fueling station with eight multi‑product dispensers at 677 Timpany Boulevard. The committee will discuss these proposals.

development-reviewzoningplanningsupport-animalfueling-station
Mon Oct 6, 2025

Ad-Hoc Compensation Proposal Committee

Committee to discuss a new compensation ordinance for non-union city employees

The Ad‑Hoc Compensation Proposal Committee will meet to discuss creating a compensation ordinance for non‑union employees of the City of Gardner. No vote or final decision is indicated; the item is listed as a discussion topic. The meeting also includes standard procedural announcements.

compensationemploymentordinancecity-government
Mon Oct 6, 2025

City Council

Council votes on $6.9M loan for Gardner Middle School roof replacement

The Gardner City Council is scheduled to vote on a $6,911,028 loan for the Gardner Middle School roof replacement project at 297 Catherine Street. The agenda also includes a zoning ordinance amendment to promote housing growth and production, as well as a supplemental budget increase of $183,171.62 for operational expenses. Additionally, the council will confirm multiple appointments to the Fire Department and various city commissions.

housingzoningbudgeteducationappointmentsveterans
✓ Decided: Council approved $183,317.62 for additional operational expenses

The Gardner City Council approved several actions, including a $183,317.62 increase to the operating‑expenditure budget, a $5,795 transfer of Building Department funds, and an intermunicipal agreement for veteran services. It also adopted an ordinance creating an Assistant Youth Center Director position and confirmed multiple fire‑department appointments and an airport commission appointment. All motions passed unanimously with eleven yeas.

Fri Oct 3, 2025

Economic and Community Development Committee

Committee to review Maki Park project investigation

The Economic and Community Development Committee will receive a September update and discuss a report on the Maki Park project. The body is seeking explanations from the Mayor regarding project funding and departmental updates.

economic-developmentmaki-parkbudgetgovernment-oversight
✓ Decided: Committee waived reading of September 9 minutes and accepted them

The committee voted to waive the reading of the September 9, 2025 meeting minutes and accept them as presented. A motion to adjourn the meeting was approved, ending the session at 1:08 p.m. No other actions were voted on; the remaining agenda items were informational updates.

Wed Oct 1, 2025

Airport Commission

Airport Commission reviews wildlife hazard and obstruction analysis

The Gardner Municipal Airport Commission is meeting to discuss old business regarding environmental assessments. The body will review reports from Gales Associates, Inc. and the Airport Manager.

airportenvironmental-assessmentwildlife-hazardinfrastructure
Wed Oct 1, 2025

Finance Committee

Finance Committee to consider $6.9 million loan for Gardner Middle School roof

The Finance Committee will discuss several funding requests, including a large borrowing measure for school repairs and a general fund supplemental budget. The body will also review RFP committees for two schools and a land disposition proposal.

schoolsborrowingbudgetreal-estateveterans-services
✓ Decided: City authorized borrowing up to $6.9 million for Gardner Middle School roof project

The Finance Committee approved a $5,795 transfer from Building Department salaries to operating expenses and adopted a supplemental budget of $183,317.62 for police body‑camera equipment, grant‑writing services, school e‑rate internet, tree removal and an ambulance vehicle. It also authorized the City to borrow up to $6,911,028 for the Gardner Middle School roof replacement project. Additional actions included authorizing a veteran‑services intermunicipal agreement and placing two RFP review committee proposals on file.

Wed Oct 1, 2025

Bandstand Committee

Committee will vote to approve minutes from the prior meeting

The Bandstand Committee will consider approving the minutes from its previous meeting. It will discuss the prior season and possible future performers, review financial statements, and handle any other business before adjourning. No other specific actions or contracts are listed on the agenda.

bandstandartsfinancepublic-meeting
✓ Decided: Bandstand Committee accepted prior minutes and set concert schedule

The committee approved the minutes from the June 5, 2025 meeting. Members were assigned to contact specific performers for the upcoming summer concert series, and the next meeting was scheduled for October 15, 2025 at 3 p.m. A proposal to expand the series from 8 to 10 shows was discussed but not decided. The meeting was then adjourned.

Tue Sep 30, 2025

Public Welfare Committee

Committee recommends zoning change and veterans services agreements

The Public Welfare Committee voted to recommend a zoning map amendment and a veterans services agreement with Ashby to the full council. The committee also reviewed a proposed agreement to provide veterans services to the Town of Hubbardston starting January 1, 2026.

zoningveterans-servicesintermunicipal-agreementmunicipal-government
✓ Decided: Committee approved presenting a veteran services intermunicipal agreement with Hubbardston

The Public Welfare Committee accepted the August 4, 2025 minutes. It voted to forward the intermunicipal veteran‑services agreement with the Town of Hubbardston to the full council. It also voted to forward an ordinance allowing cottage kitchens in residential districts to the full council. The meeting was adjourned at 5:36 p.m.

Thu Sep 25, 2025

Retirement Board

Board to approve retiree payments, veterans buybacks, and financial statements

The Gardner Contributory Retirement Board will consider several financial items, including the pre‑close trial balance, general ledger, and payroll warrants for September 25. It will review the investment report and discuss disability retirements in process. The board will also vote on approving retiree payments, acknowledging deceased members, and authorizing veterans’ buyback purchases. A procurement request for legal services will be presented.

retirementfinancepensionsboardprocurement
✓ Decided: Board approved $732,837.49 warrant and several pension-related actions

The board unanimously approved the September 30 warrant for $732,837.49 and adopted the July 2025 trial balances and ledger histories. It also approved the August 26 meeting minutes, the January 1 actuarial valuation draft, veterans’ buybacks, and survivor benefits for Frederick P. Bernhardt. Permission was granted for board members and the administrator to attend the MACRS Winter Conference. The meeting was adjourned at 11:16 a.m.

Wed Sep 24, 2025

Appointments Committee

Appointments Committee to confirm mayor's appointments to city commissions

The Gardner Appointments Committee will meet to discuss and vote on measures confirming the mayor's appointments to the Conservation, Airport, Cemetery, Municipal Grounds, and Historical Commissions. The committee will also discuss its own rules.

appointmentsgovernmentconservationairportcemeterymunicipal-grounds
✓ Decided: Committee recommends mayor's appointments to multiple city commissions

The Appointments Committee waived reading the August 26 minutes and then voted to recommend confirmation of the mayor's appointees to several commissions, including the Airport, Cemetery, Municipal Grounds, Historical, and Golf commissions. The committee also discussed a draft format for future appointment documents and requested more time to review it. The meeting was adjourned at 5:57 p.m.

Wed Sep 24, 2025

Gardner Redevelopment Authority

GRA discusses Urban Renewal updates for 155 Mill, 85 Winter, and Main St.

The Gardner Redevelopment Authority will vote to approve the minutes from its September 3, 2025 regular meeting. The board will receive an update on the Urban Renewal Plan’s Rear Main Project, covering 155 Mill Street, 85 Winter Street, and 205‑213 Main Street, with discussion of prospective buyers and current financials. The authority will also discuss appointments to the GRA board.

urban-renewalredevelopmentboard-appointmentsmeeting-minutesplanning
✓ Decided: Board unanimously approved September 3 minutes

The Gardner Redevelopment Authority approved the September 3, 2025 meeting minutes by a 4‑0 vote. It then entered and later exited an executive session, each by unanimous vote, and adjourned the meeting with a 4‑0 vote. No other actions were decided; project updates were discussed but not acted upon. The next meeting is set for October 22, 2025.

Wed Sep 24, 2025

Board of Assessors

Board of Assessors to review FY26 exemption applications

The Board of Assessors will meet to approve meeting minutes and sign the 2025 MV Excise Commitment 5. The board will also enter an executive session to discuss, review, and approve or deny FY26 exemption applications.

taxesexemptionsmv-excise
✓ Decided: Board approved multiple assessment clauses during executive session

The Board of Assessors accepted the August 5, 2025 minutes with a 2‑0 vote. It then moved the meeting into executive session, also by a 2‑0 vote, and approved several assessment clauses. The approved items were Clause 17D (4), Clause 22A‑F (10), Clause 22E (9), Clause 37 (4) and Clause 41C (2).

Tue Sep 23, 2025

Community Development Block Grant Steering Committee

Gardner CDBG Committee to discuss project updates and new funding requests

The Community Development Block Grant Steering Committee will review the status of the FY2025 application and provide updates on FY2022-24 projects. The body will also discuss potential new projects to utilize remaining CDBG funds.

cdbgdemolitioncommunity-developmentgrantsinfrastructure
✓ Decided: Committee approved prior meeting minutes and filed FY2022‑23 social service report

The Steering Committee approved the minutes from the April 18, 2025 meeting with a 4‑0 vote. A motion to place the FY2022‑23 social service projects on the official file was also approved 4‑0. The meeting included updates on CDBG funding status, completed demolition of 205‑213 Main Street, and ongoing work on the Greenwood Pool project and School St. School demolition, but no further actions were voted on.

Tue Sep 23, 2025

Gardner Housing Authority

Housing Authority will consider minutes and reports at Sept 23 meeting

The Gardner Housing Authority regular meeting on September 23, 2025 will open with a motion, approve the minutes from the August 21, 2025 meeting, and hear the Executive Director’s report and an invoice history report for August 2025. The agenda also includes a public comment period and a motion to adjourn.

housingauthorityminutesreportspublic-comment
Tue Sep 23, 2025

Historical Commission

Historical Commission reviews projects and administrative matters

The Gardner Historical Commission will approve the August 19, 2025 meeting minutes and discuss several administrative items, including a resignation, volunteer recruitment, a code of ethics for public historians, and a law department review of historic preservation rules. The commission will also receive updates on historic markers, the Old Burying Ground restoration, Greenwood Memorial Pool artifact work, school property disposition, the community center archives project, and MACRIS revisions.

historical-preservationadministrationprojectscommunityarchives
✓ Decided: Commission approved prior meeting minutes and placed ethics code on file

The Gardner Historical Commission voted to accept the minutes from the August 19, 2025 meeting. It also thanked Paul Gaj for his service and filed his resignation letter. The Commission acknowledged the National Council on Public History's Code of Ethics and placed it on file. The meeting was then adjourned.

Mon Sep 22, 2025

Board of Health

Board votes on final private well regulations

The Gardner Board of Health will review minutes from the July 21 meeting, then vote on the final draft of its private well regulations. It will consider a Title 5 Local Upgrade Approval application for 9 Stone St and discuss the Board's authority over such approvals. Health Department updates will be presented, covering landfill leachate pump replacement, groundwater monitoring, food establishments, housing, disease prevention, arboviruses and tickborne illnesses. The meeting will conclude with new business and scheduling the next session.

private-wellswater-qualityhealthenvironmenttitle-5regulations
✓ Decided: Board approved Title 5 Local Upgrade for 9 Stone St, replacing failing well system

The board postponed voting on the July 21, 2025 minutes because a quorum was not present. It unanimously accepted the final draft of the Well Regulations, which will take effect on January 1, 2026. It also unanimously approved a Title 5 Local Upgrade for 9 Stone St to replace a failing well system. Discussion on the authority for Title 5 upgrades was moved to the next meeting and the meeting was adjourned.

Mon Sep 22, 2025

Conservation Commission

Conservation Commission to hear wetlands projects and approve minutes

The Gardner Conservation Commission will meet to approve minutes and hold public hearings on wetlands protection applications, including a drainage project at Dunn State Park and a building addition at 42 Linus Allain Avenue. Several items are continued to a future meeting.

wetlandspublic-hearingdunn-state-parkzoningenvironmentconstruction
✓ Decided: Commission issues Negative 3 determination for 71 Kendall Pond East project

The Conservation Commission approved the September 8 minutes unanimously. It granted a Negative 3 determination, with required ESCs and BMPs, for the sandy‑fill addition at 71 Kendall Pond East. The commission also voted to continue the hearings for the Dunn State Park drainage project and the 42 Linus Allain Avenue building addition until the October 27 meeting. The meeting was then adjourned.

Fri Sep 19, 2025

Economic and Community Development Committee

Committee reviews Maki Park investigation and subcommittee updates

The Economic and Community Development Committee will approve the August 22, 2025 meeting minutes, introduce the new Economic Development & Finance Manager, receive a report on the investigation of the Maki Park project, and discuss the cancelled Regional Planning Commission onboarding training. No formal decisions beyond discussion are indicated.

economic-developmentcommunity-developmentparksplanningcity-council
✓ Decided: Committee voted to request a mayoral explanation of excess Downtown Phase III funds

The committee waived the reading of the August 22, 2025 minutes and accepted them as presented. It approved sending a letter to Mayor Nicholson asking why excess Downtown Phase III funds are available despite unfinished work on Park Street. It also approved a second letter requesting the year‑to‑date quarterly departmental updates for the Maki Park project. Finally, the committee placed the Regional Planning Commission discussion on file.

Wed Sep 17, 2025

School Subcommittees

Gardner schools to discuss superintendent contract and budget policies

The Gardner Public Schools Policy Subcommittee will meet to review and discuss a list of policies, including the superintendent contract, the annual budget, and student discipline.

schoolspolicybudgetsuperintendentstudent-discipline
✓ Decided: Subcommittee sent four key policies to full committee for first read

The subcommittee approved the May 15, 2025 Policy Meeting minutes unanimously. It tabled the Superintendent Contract policy for further review in October. It voted unanimously to forward the Annual Budget, Budget Adoption Procedures, School Nutrition Program, and Student Discipline policies—with recommended changes—to the full School Committee for a first read in October.

Tue Sep 16, 2025

Master Plan Steering Committee

Steering Committee to review finalized Master Plan values and public feedback schedule

The Master Plan Steering Committee will review the finalized Master Plan’s values and vision statements. Members will consider additional input on the drafted inventory and assessment, and discuss the process for developing goals and recommendations. The committee will also set the schedule for an open‑house to gather public feedback.

master-planplanningpublic-engagementcommunity-developmentzoning
Tue Sep 16, 2025

Zoning Board

Public hearing on converting 63 Walnut St. office to condos

The Gardner Zoning Board of Appeals will hold public hearings on two applications for 63 Walnut Street. One application (Case 2025-07-02) seeks to maintain the existing seven‑unit residential apartment building. The other application (Case 2025-08-01) proposes converting a vacant office building at the same address into seven condominium units. The board will also address announcements, correspondence, and any corrections to prior meeting minutes.

zoninghousingpublic-hearingdevelopmentcondoapartments
✓ Decided: Board denied Trevor Brown’s 63 Walnut St special permit application

The Zoning Board voted to deny Trevor Brown’s special permit for converting the existing structure at 63 Walnut St into seven residential apartments after the applicant failed to appear. A motion to deny Steven Nogueira’s similar application was withdrawn and no vote was recorded on that case. The board also noted that the site‑visit minutes for 0 Emerald Street required no vote.

Mon Sep 15, 2025

Golf Commission

Golf Commission to discuss proposed new restaurant plan

The Golf Commission will meet to review financial reports and receive updates from the Pro Manager and Superintendent. The body is scheduled to discuss a proposed plan for a new restaurant.

golf-courserestaurantfinance
✓ Decided: Feasibility study for proposed building plan was tabled

The commission accepted the August 25, 2025 meeting minutes by a 4-0 vote. It also approved the FY25 end‑of‑year and FY26 year‑to‑date financials by a 4-0 vote. The motion to accept the feasibility study for the proposed building did not receive a second and was tabled. The meeting was adjourned by a 4-0 vote.

Mon Sep 15, 2025

City Council

City Council to appropriate $154,951.06 and $205,589.23 from enterprise funds

The Gardner City Council will consider two finance committee orders appropriating additional sums from enterprise funds: $154,951.06 allocated to Sewer, Water, Golf Course, and Solid Waste funds, and $205,589.23 to the Mayor's Unclassified Reserve Account. The agenda also includes a measure declaring 25 Main Street (Parcel B) surplus for commercial lease at a minimum of $10 per year, and an ordinance to amend zoning Chapter 675 to permit cottage kitchens in residential districts. Additional items are a public hearing, a mayoral communication about forming an ad‑hoc committee, and standing committee reports.

financeappropriationszoningleasepublic-hearingsmayor-communication
✓ Decided: Council approved $205,589.23 additional appropriation for city expenses

The City Council voted 10‑yeas to appropriate $205,589.23 from the Mayor's Unclassified Reserve for the FY 2025‑2026 expense budget. It also approved a $154,951.06 appropriation from Enterprise Funds and declared 25 Main Street surplus for commercial lease (9 yeas, 1 nay). The council placed on file the mayor’s proposal to form an Ad‑Hoc Compensation Committee and referred a zoning ordinance for cottage kitchens to the Planning Board and Welfare Committee for a joint public hearing.

🏢 Building at this address: Flatiron Block · 3 floors
Fri Sep 12, 2025

Public Safety Committee

City Council to consider adopting a 25 mph speed limit in business districts

The Public Safety Committee will hear a request from the Traffic Commission to opt‑in to Massachusetts General Laws Chapter 90 §17C, lowering the statutory speed limit to 25 mph on city‑owned roads in thickly settled or business districts. The committee will also review the Traffic Commission’s analysis of vehicle towing under the winter parking ban and a proposed hybrid parking‑ban model that would shift the city‑wide ban to January 1–March 1 with overnight restrictions. A list of streets proposed for the 25 mph limit will be presented for possible inclusion in a new municipal traffic ordinance.

trafficspeed-limitparkingwinterpublic-safetycity-council
✓ Decided: Public Safety Committee discussed updates but made no formal decisions

The committee heard updates from police, fire, building, public health, and waste departments. Topics included staffing, budget constraints, grant applications, equipment purchases, and a proposed change to the winter parking ban system. No motions were voted on or approved during the meeting.

Wed Sep 10, 2025

Airport Commission

Gardner Airport Commission to review wildlife hazard and obstruction analysis

The Airport Commission is meeting to discuss old business regarding Gales Associates, Inc. The agenda includes a wildlife hazard site visit and an environmental assessment and obstruction analysis.

airportenvironmental-assessmentwildlife-hazardaviation
✓ Decided: Commission provided updates; no decisions were approved or denied

The meeting covered updates on runway reconstruction payments, the wildlife hazard site visit report, and a change from an Environmental Assessment to a CATEX review. The airport manager reported bill payments and requested further financial data. No formal approvals, denials, or votes were recorded.

Wed Sep 10, 2025

Finance Committee

Mayor to approve veterans services agreement with Hubbardston

The Finance Committee will consider Measure 11683 to authorize the Mayor to enter into an intermunicipal agreement with the Town of Hubbardston for shared veterans services from 2026 to 2028. The committee will also review measures designating surplus land at 25 Main Street for commercial lease at $10 per year and at 13‑17 West Lynde Street for disposition. Additional agenda items include orders to appropriate extra funds from enterprise accounts and to raise the fiscal‑year budget, and a discussion of non‑union salaries for the golf course and library.

veterans-servicesintermunicipal-agreementland-surplusbudgetfinance-committee
✓ Decided: Finance Committee approved lease of 25 Main Street surplus land for commercial use

The committee voted 3 yeas to declare the parcel at 25 Main Street surplus and authorize its lease for commercial use at a minimum value of $10 per year. It also approved an order to appropriate $154,951.06 from available enterprise funds to several department enterprise accounts and an order to raise $205,589.23 for the Mayor's Unclassified Reserve Account, each passing with 3 yeas. Two other measures – the intermunicipal veterans services agreement with Hubbardston and the sale of the West Lynde Street parking lot – were tabled for further discussion with more time granted.

Wed Sep 10, 2025

Disability Commission

Guest Nora Bent will present Legislative Advocacy training to the commission

The Disability Commission will review and approve the minutes from its June 11, 2025 meeting. The commission will hear a Legislative Advocacy training presentation from Nora Bent, Director of Government Affairs for ARC MA.

disability-commissionmeeting-minuteslegislative-advocacyarc-matraining
Tue Sep 9, 2025

License Commission

License Commission to hear 3 alcohol license applications

The Gardner License Commission will hear applications for a one-day beer and wine license for Otter River Hotel, a one-day all-alcohol license for Acadien Social Club, and a license transfer for South Gardner Hotel. The body will also discuss the status of several previously submitted applications with the ABCC.

licensingalcoholpublic-safetycode-enforcementmeetings
✓ Decided: Commission approved new $100 amendment fee and raised 1‑Day license fees

The License Commission approved the August 8, 2025 meeting minutes and issued 1‑Day beer & wine licenses for Otter River Hotel and Acadien Social Club. It approved the transfer of the South Gardner Hotel license, sending the application to the ABCC for review. The Commission adopted a $100 fee for new and amendment license applications and increased 1‑Day license fees to $50 for wine/malt and $75 for all‑alcohol, effective Jan. 1, 2026. A tentative date of Nov. 12, 2025 was set for the November meeting.

Tue Sep 9, 2025

Appointments Committee

Appointments Committee to interview and discuss 12 mayoral appointments

The Appointments Committee will interview and discuss several mayoral appointments for city boards and department leadership. The meeting includes reviews for positions in the Redevelopment Authority, Industrial Development Finance Authority, and various city commissions.

appointmentscity-governmentboards-and-commissions
Tue Sep 9, 2025

Planning Board

Planning Board to hold public hearing on college building addition site plan

The Gardner Planning Board will hold a public hearing on September 9, 2025 at 6:30 p.m. The hearing will consider the definitive site plan submitted by Dominic Allain for a proposed building addition and other site improvements at Mount Wachusett Community College, 42 Linus Allain Avenue. The meeting will be in the Hubbard Conference Room 203 at the Manca Annex, 115 Pleasant Street.

zoningplanningsite-planpublic-hearingeducation
✓ Decided: Planning Board approves minutes, continues hearing, releases escrow accounts

The board approved the July 8, 2025 regular meeting minutes by a 4‑0 vote. It voted to continue the public hearing on the Mount Wachusett Community College addition to the October 14, 2025 meeting, also 4‑0. The board approved the release of escrow accounts for the Compass Lane Subdivision and PrivateOversight LLC with a 4‑0 vote. The meeting was then adjourned by a 4‑0 vote.

Tue Sep 9, 2025

Planning Board

Planning Board hears Mount Wachusett College building addition and escrow release

The Gardner Planning Board will hold a public hearing to review the definitive site plan for a building addition and site improvements for Mount Wachusett Community College at 42 Linus Allain Avenue. It will also consider releasing escrow accounts related to the Compass Lane Subdivision held by PrivateOversight LLC. Additionally, the board will vote to approve the minutes from the July 8, 2025 regular meeting.

developmenteducationfinancezoningland-use
✓ Decided: Board approved release of escrow accounts for Compass Lane Subdivision

The Planning Board approved the July 8, 2025 meeting minutes (4‑0). It voted to continue the public hearing on the Mount Wachusett Community College addition to the October 14 meeting (4‑0). It also approved releasing the escrow accounts for the Compass Lane Subdivision and PrivateOversight LLC (4‑0). The meeting adjourned at 6:50 p.m.

Mon Sep 8, 2025

Conservation Commission

Conservation Commission to hold wetlands hearings on Dunn State Park and Linus Allain Avenue projects

The Gardner Conservation Commission will meet in person to review wetlands-related projects, including a drainage improvement at Dunn State Park and a building addition at 42 Linus Allain Avenue. The commission will also continue discussion on a contractor building at 170 Mill Street and address enforcement orders for three properties. No decisions are listed on the agenda.

wetlands-protectionpublic-hearingdrainage-improvementbuilding-constructionenforcement-order
✓ Decided: Conservation Commission ratifies emergency beaver dam certification

The Gardner Conservation Commission ratified an Emergency Certification for a beaver dam breach near Otter River Conservation Area, allowing DPW to address the issue. The Commission also approved amended minutes from the 8/25/25 meeting and approved up to $900 for attendance at the MACC Fall Conference. All other agenda items, including hearings for Dunn State Park and 42 Linus Allain Avenue, were continued to future meetings.

Mon Sep 8, 2025

School Committee

School Committee to vote on AFSCME contract and district policies

The School Committee will consider a revised AFSCME contract for 2025-2028 and the second reading of several district policies. The meeting also includes updates on the District Improvement Plan, special education, and grants administration.

contractspolicybudgetspecial-educationadministration
✓ Decided: School Committee ratified the 2025‑2028 AFSCME contract and approved the consent agenda

The committee accepted the consent agenda, which included multiple warrants and a $500 donation. It approved a second reading of several district policies. The AFSCME contract for 2025‑2028 with revisions was ratified. Robert Swartz was appointed as the district’s MASC delegate.

Thu Sep 4, 2025

Cemetery Commission

Gardner Cemetery Commission to review financial statements and department updates

The Municipal Grounds/Cemetery Commission will meet to review the Cemetery Department's financial statement and receive updates on municipal grounds. The body will also discuss a Historical Commission RFP and receive an update from the Bandstand Committee.

cemeteriesmunicipal-groundsfinancehistorical-commission
✓ Decided: Cemetery Commission agreed to solicit a quote for Old Burying Ground restoration

The commission unanimously accepted the minutes from the June 5, 2025 meeting and the financial statement. It also agreed to solicit a quote for the Old Burying Ground restoration project. The meeting was then adjourned at 8:34 am.

Wed Sep 3, 2025

Airport Commission

Gardner Airport Commission reviews wildlife hazard assessment and site visit

The Gardner Airport Commission will discuss an environmental assessment and wildlife hazard site visit conducted by Gales Associates, Inc. The meeting will also include the Airport Manager's report. No new business items are listed.

airportwildlife-hazardenvironmental-assessmentmassachusetts
Wed Sep 3, 2025

Traffic Commission

Gardner Traffic Commission to review parking and speed concerns on Sept 3

The Gardner Traffic Commission will meet on September 3, 2025, at 10 AM to discuss parking restrictions, speed zones, and pedestrian safety. Items include revisiting Edgell Street parking, drafting a 25 MPH zone letter, and reviewing stop signs and crosswalk safety. The meeting is open to public recording with prior notice.

parkingspeed-limitspedestrian-safetytraffic-commissionpublic-meeting
✓ Decided: Council declined to adopt the proposed hybrid winter parking ban

The commission unanimously approved the minutes from the September 3, 2025 meeting. They reported that the city council voted not to adopt the proposed hybrid winter parking ban because it was too late in the year to change it. The meeting was then adjourned unanimously.

Wed Sep 3, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to review urban renewal updates and financials

The Gardner Redevelopment Authority will hold a meeting to approve minutes from prior 2025 sessions and discuss ongoing urban renewal projects, including the Rear Main Project and properties at 155 Mill Street and 85 Winter Street. Financial updates on a MassDevelopment loan repayment will also be reviewed.

urban-renewalfinancialspropertymeeting-proceduresmassdevelopment
✓ Decided: GRA approves prior minutes, enters executive session, and adjourns meeting

The Gardner Redevelopment Authority approved the minutes from April 25, May 28, June 25, and July 30, 2025 with a 4‑0 vote. The board entered an executive session, also by a 4‑0 vote, during which loan repayment details were presented. The meeting was then adjourned unanimously (4‑0).

Tue Sep 2, 2025

City Council

City Council to discuss zoning changes and confirm police appointments

The Gardner City Council will consider an ordinance to rezone a property on MA-101 from Commercial 2 to Industrial 1 and confirm the Mayor's appointments for police officers and election officers. The agenda also includes a report on the August Economic and Community Development Update.

zoningpoliceappointmentselectionsbudgetcity-council
✓ Decided: Council approved zoning change from Commercial‑2 to Industrial‑1 on MA‑101 parcel

The City Council unanimously accepted the minutes from the June 2, 2025 meetings. It approved an ordinance changing the zoning district of a parcel on the easterly side of MA‑101 from Commercial 2 to Industrial 1 with a Summit Solar overlay. Councillors elected Craig Cormier as President Pro‑tem and voted to suspend Rule 5 to allow extended discussion.

Tue Sep 2, 2025

School Subcommittees

Gardner school facilities subcommittee meets Sept 2 with no concrete items listed

The Gardner Public Schools Facilities Sub-Committee will convene on September 2, 2025 at 5:15 PM in Room 201, 160 Elm Street. The agenda contains only procedural steps (call to order, approval of minutes, old/new business, adjournment) and a generic projects update; no specific decisions, contracts, or dollar amounts are posted.

proceduralfacilitiesschools
✓ Decided: Committee approved meeting minutes and adjourned the session

The Facilities Sub‑Committee voted to approve the meeting minutes of Mary 1, 2025 and then voted to adjourn the meeting. No other substantive actions or approvals were recorded.

Tue Sep 2, 2025

School Subcommittees

Gardner Public Schools Finance Sub-Committee to review expenses and projects

The Finance Sub-Committee will meet to review expense reports and receive updates on projects. The body will also discuss gifts and donations.

educationfinanceschool-budget
✓ Decided: Committee accepted a $500 donation for the GHS Athletic Banquet

The committee approved the May 1, 2025 Finance Subcommittee minutes. They accepted a $500 donation from Jason and Alyssa Zelesky for the GHS Athletic Banquet. The meeting was adjourned at 5:19 p.m.

Thu Aug 28, 2025

Public Safety Committee

Public Safety Committee recommends two second-hand dealer licenses for approval

The Public Safety Committee reviewed license applications for two businesses to collect or deal in second-hand articles. Both applicants were found to be in good standing with the Police Department and city taxes.

licensingpublic-safetyparkingbusiness-permits
✓ Decided: Committee voted to recommend extending review time for parking‑ban item #11552

The Public Safety Committee waived the reading and accepted the minutes from August 1, 2025. It then voted 3‑yeas to recommend giving more time to consider item #11552, the traffic‑commission proposal to shorten the winter parking ban. The meeting was adjourned at 9:35 a.m. after a viva voce vote.

Wed Aug 27, 2025

Finance Committee

Finance Committee to review non-union employee compensation schedule

The Finance Committee will discuss an ordinance to update the non-union employee compensation schedule, including corrections to pay rates and the addition of a Youth Center director. The body will also consider a measure regarding the September 16, 2025, City Preliminary Election.

budgetpersonnelelectionhealth-insurancecompensation
✓ Decided: Finance Committee holds updates, no decisions made

The Finance Committee reviewed departmental updates on elections, city clerk operations, human resources, and purchasing. No motions were adopted, no votes were recorded, and no actions were approved, denied, or tabled during the meeting.

Tue Aug 26, 2025

Retirement Board

Gardner Retirement Board to review investments and actuarial valuation

The Gardner Contributory Retirement System will meet to approve financial records and payroll warrants. The board will review the July 2025 PRIT investment statement and a draft actuarial valuation from Stone Consulting. Members will also act on retirement approvals and disability claims.

retirementinvestmentspensionsfinance
✓ Decided: Board approved 7.00% actuarial discount rate and funding schedule

The Gardner Contributory Retirement Board unanimously approved the minutes from July 29, 2025, the June 2025 trial balances and bank reconciliations, and Warrant #08/25 for $721,164.09. It also unanimously adopted a 7.00% actuarial discount rate with a funding schedule that includes 7.25% annual increases. The board agreed to request an updated PTG agreement that removes the optional Member Self Service feature. The meeting was adjourned at 10:48 a.m.

Tue Aug 26, 2025

Appointments Committee

Gardner council to confirm mayor's police and election officer appointments

The Gardner Appointments Committee will interview and discuss measures to confirm the mayor's appointments of a police officer and election officers for the 2025-2026 term. The committee will also discuss police officer assignments to polling locations.

appointmentspoliceelectionsboard-of-registrarsgovernance
✓ Decided: Committee recommended five mayoral appointments and waived prior minutes

The Appointments Committee waived the reading of the July 30 minutes and approved recommendations for several mayoral appointments, including Officer Russell Counts, Board of Registrars member Mario Guay, police officer assignments to polling locations, and election officers for 2025‑2026. The committee also noted multiple resignations in city departments but took no action on them. The meeting was adjourned at 5:50 p.m.

Mon Aug 25, 2025

Board of Health

Board of Health to vote on final draft of private well regulations

The Board of Health will review and vote on a final draft of regulations governing the siting, construction, and testing of private wells. The meeting will also include health department updates on housing, food establishments, and landfill monitoring.

public-healthwater-wellsregulationslandfillhousing
Mon Aug 25, 2025

Conservation Commission

Conservation Commission to hold hearings on parking and drainage projects

The Conservation Commission will hold public hearings regarding a parking lot expansion and drainage improvements. The body will also address enforcement orders and discuss local infrastructure issues.

wetlandsparkingdrainageinfrastructureenvironment
✓ Decided: Commission issued Negative 3 determination for Gardner Fish & Gun Club parking lot

The commission approved the minutes from 8/11/25, 10/28/24 and 3/24/25 with votes of 3‑0‑1, 3‑0‑1 and 4‑0‑0. It voted to keep the Enforcement Order on the sludge landfill open until the 10/27/25 meeting (4‑0‑0). It issued a Negative 3 determination rejecting the Gardner Fish & Gun Club parking‑lot repave and expansion project (4‑0‑0). It also continued the Dunn State Park drainage improvement hearing until the 9/8/25 meeting (4‑0‑0) and adjourned (4‑0‑0).

Mon Aug 25, 2025

Golf Commission

Gardner Golf Commission to review financials and receive staff updates

The Golf Commission will meet to approve previous meeting minutes and review financial reports and expense reports. The agenda includes updates from Pro Manager Dan Berry and Superintendent William Frank.

golf-coursefinancecity-management
✓ Decided: Commission approved meeting minutes, financials and adjourned

The commission voted 5-0 to accept the July 28, 2025 meeting minutes. They also approved the year‑to‑date financial report for FY 26 with a 5-0 vote. Finally, the meeting was adjourned by a unanimous 5-0 motion.

Fri Aug 22, 2025

Economic and Community Development Committee

Gardner committee meets August 22 with routine updates and subcommittee reports

The Economic and Community Development Committee will meet at City Council Chambers to approve minutes, introduce a new assistant director, and receive an August update. Two subcommittee items remain under discussion: the Maki Park Project funding needs and the choice of regional planning partner.

agenda-reviewcommunity-developmentmunicipal-meetingplanning-commissionstaffing-updates
✓ Decided: Committee waived minutes reading, approved reporting, and adjourned

The committee waived the reading of the June 27, 2025 minutes and accepted them as presented. It approved that Councilor Kazinskas will report the August update to the full City Council. The meeting was adjourned at 1:28 p.m. after a motion was passed.

Thu Aug 21, 2025

Gardner Housing Authority

Gardner Housing Authority to hold regular meeting on August 21

The Gardner Housing Authority will meet to review the Executive Director's report and the June 2025 invoice history report. The agenda includes a scheduled executive session to investigate charges of criminal misconduct or consider filing criminal complaints.

housingpublic-safetyadministration
Tue Aug 19, 2025

Historical Commission

Historical Commission to discuss art, markers, and preservation projects

The Gardner Historical Commission will meet to approve minutes, review communications from the Department of Conservation and Recreation, and discuss administrative matters and specific preservation projects including the Old Burying Ground and artifacts at the Gardner Museum.

historical-commissionpreservationartifactsdunn-state-parkcity-hallold-burying-ground58-main-street
✓ Decided: Commission approved scope of RFP for Old Burying Ground assessment

The commission accepted the June 17 minutes and placed a Mass. DCR communication on file. It approved letters acknowledging donations from Councillor Calvin Brooks and Rebecca Martin. The scope of the request for proposals to assess the Old Burying Ground was approved, and the City Engineer’s report on the AT&T antenna proposal was accepted and filed.

Tue Aug 19, 2025

Zoning Board

Zoning Board to hear requests for residential apartments and parking changes

The Zoning Board of Appeals will hold public hearings on five cases involving special permits and variances. These include requests to modify residential unit counts and parking allocations at several city properties.

zoningparkinghousingspecial-permitsvariances
✓ Decided: Board denies special permit modification for 163-165 Pine St

The Zoning Board denied the petition to modify the special permit at 163‑165 Pine St, reducing the dwelling units from eight to seven and parking spaces, with a 3‑Nay, 2‑Yea vote. It approved the withdrawal of Sean Keane’s driveway permit request. It unanimously approved the re‑allocation of two parking spaces for the Hannaford To Go program. It also approved a continuance for the Walnut St case and adopted the July 28 and July 15 meeting minutes.

Tue Aug 19, 2025

Master Plan Steering Committee

Committee discusses proposed values and vision for Gardner’s 2025 Master Plan

The Master Plan Steering Committee will review and finalize proposed values and vision statements for Gardner’s 2025 Master Plan. This is a regular meeting with no formal decisions expected, but the committee will discuss key guiding principles for future development.

master-plancommunity-developmentvision-statementgardner-maplanning-committee
Mon Aug 18, 2025

City Council

City Council to consider updated non-union employee compensation schedule

The City Council will discuss an ordinance to replace the existing non-union compensation schedule. The proposal includes corrections to decimal errors in hourly rates and updates regarding a Youth Center director and a part-time local inspector position.

personnelcompensationordinancecity-government
✓ Decided: Council nominates Craig Cormier as President Pro‑tem and postpones salary ordinance

Council voted 10‑yeas to nominate Councillor Craig Cormier as President Pro‑tem for the evening and to close nominations. Council President George Tyros recused himself from the personnel compensation ordinance due to a conflict of interest. No vote was taken on the ordinance; council members asked the Mayor for additional salary study information before any decision can be made.

Tue Aug 12, 2025

License Commission

License Commission to review 1-day alcohol permits and new license category rules

The License Commission will hold hearings for several 1-day beer, wine, and liquor permits for upcoming events. The board will also consider voting to adopt new ABCC regulations regarding the trading of wine and malt licenses for all-alcoholic beverage licenses.

liquor-licensespublic-hearingsalcohol-permitsregulations
✓ Decided: License Commission approves multiple 1‑Day alcohol permits and tables license‑trade advisory

The Commission unanimously approved the July 8, 2025 meeting minutes and issued several 1‑Day beer and wine licenses for Oktoberfest and other events, including an amended wine‑and‑malt license and six licenses for late‑summer Friday nights. One parking‑lot party license was approved pending resolution of a City Collector funding issue. The board tabled the state advisory on trading on‑premise wine & malt licenses for all‑alcohol licenses and requested a fee‑schedule report from neighboring towns for the next meeting.

Mon Aug 11, 2025

Conservation Commission

Conservation Commission to hear three wetlands permit requests

The Gardner Conservation Commission will hold public hearings on three wetlands-related projects: a patio installation at 90 Kendall Pond West, drainage improvements at Dunn State Park (289 Pearl Street), and a contractor building at 170 Mill Street. The meeting will also discuss enforcement orders, old business, and new items like a nature trail update and a culvert failure at Perley Brook.

wetlands-protectionpublic-hearingenforcement-ordersdrainage-improvementspatio-installation
✓ Decided: Commission denies patio permit at 90 Kendall Pond West

The Conservation Commission approved the minutes from the August 2024 and July 2025 meetings. It voted 4‑0‑0 to close the public hearing and issue a Negative 3 Determination of Applicability for the patio project at 90 Kendall Pond West, effectively denying the permit. The commission also voted to continue the Dunn State Park drainage improvement hearing until 8/25/25 and to postpone discussion of the 170 Mill St project until the 9/8/25 meeting.

Wed Aug 6, 2025

Airport Commission

Gardner Airport Commission to review SWPPP update and wildlife survey

The Airport Commission is meeting to receive updates on old business. The agenda includes reports regarding stormwater pollution prevention and wildlife surveys.

airportenvironmental-compliancewildlife
Tue Aug 5, 2025

Board of Assessors

Board of Assessors to review excise abatements and tax exemptions

The Board of Assessors will review and sign motor vehicle excise abatements from July 2025. The body will also meet in executive session to decide on FY27 Chapter Land and FY26 Exemption applications.

taxesmotor-vehiclestax-exemptionsassessment
✓ Decided: Board approved July 2025 motor vehicle tax items and multiple tax clauses

The Board accepted the June 3, 2025 minutes (2‑0). It moved into Executive Session for the remainder of the meeting (2‑0). The Board reviewed and signed the July 2025 motor vehicle excise abatements and the 2025 motor vehicle excise tax commitments. It also approved a series of tax clauses listed in the record.

Mon Aug 4, 2025

Public Welfare Committee

Public Welfare Committee recommends floodplain zoning update to the City Council

The committee voted to recommend a zoning ordinance amendment to comply with updated FEMA flood insurance rate maps. Members also discussed the FY2026 budget and a proposal for a senior center revolving fund.

zoningflood-plainbudgetsenior-centerveterans-serviceslibrary
✓ Decided: Committee recommended zoning map amendment for Dinan Drive parcel to council

The Public Welfare Committee waived reading and accepted the May 30, 2025 minutes. It voted to recommend the Petition for Zoning Map Amendment (Parcel W32-5-5 Dinan Drive/Zub Lane) to the full council. It also voted to recommend the renewed intermunicipal agreement with the Town of Ashby for veterans services to the full council. The meeting was adjourned at 8:35 a.m.

Mon Aug 4, 2025

City Council

City Council meets with MART to discuss transit safety and ridership

The City Council held an informal meeting with the Montachusett Regional Transit Authority (MART). The body discussed ridership data from 2023 to 2025, pedestrian safety, and driver training initiatives.

transitpublic-safetytransportationridership
✓ Decided: Aleksander Dernalowicz elected President Pro-Tempore

The City Council elected Councillor Aleksander Dernalowicz as President Pro-Tempore to preside over the informal meeting, using a voice vote with eight yeas and no objections. The meeting featured a presentation by the Montachusett Regional Transit Authority on rider and pedestrian safety, ridership trends, and service improvements, following a request from Councillor Karen Hardern. No other actions were approved, denied, or tabled.

Mon Aug 4, 2025

City Council

Gardner City Council to consider zoning change and new Youth Center Director position

The City Council will review several committee reports, including a zoning map amendment and the creation of a Youth Center Director position. The body will also consider second-hand article licenses and a revolving account for LifeLine Service Activities.

zoningpersonnelbudgetlicensingintermunicipal-agreement
✓ Decided: Jennifer Dymek elected City Treasurer by unanimous council vote

The council elected Jennifer Dymek as City Treasurer, receiving nine votes. They approved licenses for GameStop Inc. and EcoATM LLC to operate second‑hand article businesses on Timpany Boulevard, each passing with nine yeas. Additional actions included creating a $10,000 revolving fund for LifeLine senior services, adding a Youth Center Director position with a $65,000 salary, renewing the intermunicipal veterans‑services agreement with Ashby, and transferring $10,000 from Building Department salaries to operating expenditures, all approved unanimously.

Fri Aug 1, 2025

Public Safety Committee

Committee recommends approval for two business licenses

The Public Safety Committee reviewed license applications for two local businesses. The committee also addressed a communication regarding parking meters and postponed a discussion on winter parking ban towing.

business-licensesparkingpublic-safety
✓ Decided: Committee recommended two second‑hand article licenses to City Council

The Public Safety Committee waived the reading of the June 27, 2025 minutes. It voted to recommend approval of a license for EcoATM LLC, 677 Timpany Blvd., and a license for GameStop #3725, 376 Timpany Blvd., to the City Council. Both recommendations passed with three yeas. The meeting adjourned at 8:02 a.m.

Thu Jul 31, 2025

Finance Committee

Finance Committee to review veterans services agreement and budget transfer

The Finance Committee will consider a renewed intermunicipal agreement for veterans services with the Town of Ashby and a $10,000 budget transfer. The body will also discuss health insurance payments and city policies.

veterans-servicesbudgethealth-insurancecity-policy
✓ Decided: Mayor authorized to renew veteran services pact with Ashby through FY 2028

The Finance Committee approved three motions: waiving the reading of prior minutes; recommending the City Council adopt an order letting the Mayor enter a renewed intermunicipal agreement with the Town of Ashby for veteran services through fiscal year 2028; and recommending the transfer of $10,000 from the Building Department salary account to the operating expense account for an interim commissioner. The committee also kept the health‑insurance payment item on the agenda for further information and removed the sexual‑harassment‑policy item from the calendar.

Wed Jul 30, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to discuss Main Street projects and loan repayment

The Gardner Redevelopment Authority will provide updates on the Rear Main Project and properties at 155 Mill and 85 Winter Street. The body will also discuss current financials regarding a MassDevelopment loan repayment and prospective buyers for 205-213 Main Street.

urban-renewalreal-estateloanseconomic-development
✓ Decided: Executive session opened to discuss 205‑213 Main St.

The Authority moved to discuss 205‑213 Main St. in an executive session; the motion was made by Magnus Carlberg, seconded by Tim Horrigan, and the session was entered at 8:53 a.m. The session was later closed at 9:16 a.m. after a motion to close, also made by Carlberg and seconded by Horrigan. The meeting was then adjourned.

Wed Jul 30, 2025

Appointments Committee

Appointments Committee to interview and discuss five city appointments

The Appointments Committee will interview and discuss several mayoral appointments and the election of a City Treasurer and City Collector of Taxes. The meeting includes a review of minutes from May 14, 2025.

appointmentscity-governmentpoliceplanningelections
✓ Decided: Committee recommended two mayoral appointments and adjourned

The Appointments Committee voted to recommend the Mayor’s appointment of Stephen Hirons as Sealer of Weights and Measures to the full Council. It also voted to recommend the election of Jen Dymek as City Treasurer and City Collector of Taxes. The meeting was adjourned at 5:30 p.m.

Tue Jul 29, 2025

Retirement Board

Gardner Retirement Board to review actuarial valuation draft

The Gardner Contributory Retirement Board will meet to approve financial records and retirement applications. The board will also review a draft actuarial valuation as of January 1, 2025, provided by Stone Consulting.

retirementpensionsactuarial-valuationfinance
✓ Decided: Board unanimously approved $953,412.22 payment warrant

The Gardner Contributory Retirement Board unanimously approved the June 24, 2025 and May 27, 2025 meeting minutes, a $953,412.22 payment warrant, and the Actuarial Draft Report as of Jan 1 2025. It also approved the July 2025 payroll mailing list and health‑insurance rates for retirees and surviving spouses. The board tabled discussion of the funding schedule until the August 2025 meeting. No retirements were approved for July 2025.

Mon Jul 28, 2025

Conservation Commission

Commission to hold hearing on contractor building at 170 Mill Street

The Conservation Commission will conduct a joint public hearing regarding a Notice of Intent for a contractor building and site improvements. The body will also address emergency certifications and enforcement orders.

conservationwetlandszoningpublic-hearinginfrastructure
✓ Decided: Commission ratified emergency certification for Beaver Dam breach on Lachance Street

The commission approved the July 14 minutes (4‑0‑1) and ratified an emergency certification for the Beaver Dam breach off Lachance Street (5‑0‑0). It voted to continue discussions on the Sludge Landfill, 36 Nicolle Terrace, 282 Brookside Drive, and 170 Mill Street projects at future meetings. The meeting was adjourned at 6:57 PM (6‑0‑0).

Mon Jul 28, 2025

Golf Commission

Gardner Golf Commission to review financials on July 28

The Golf Commission will meet to approve previous meeting minutes and review financial reports. The agenda includes updates from Pro Manager Dan Berry and Superintendent William Frank.

golf-coursefinancecity-management
✓ Decided: Golf Commission unanimously approved the FY25 financial report

The commission accepted the June 23, 2025 meeting minutes and approved a fall membership promotion. Both the FY25 and FY26 financial reports were accepted, and the meeting was adjourned unanimously.

Mon Jul 28, 2025

Zoning Board

Zoning Board to review special permit modifications for 163-165 Pine Street

The Zoning Board of Appeal will hold public hearings regarding two cases at 163-165 Pine Street. The board will discuss a special permit violation update and a request to modify a previous permit.

zoningspecial-permitshousingparking
✓ Decided: Zoning Board reviews revised plan but takes no final action

The Board heard a presentation on the updated special‑permit development plan for 163‑165 Pine Street, including changes to parking, lighting, and grading. Members discussed concerns raised by the neighboring property owner about runoff, steep parking, and lighting. The Board did not render a final decision and scheduled further work, including a guard‑rail proposal, a professional lighting plan, and completion of the property survey.

Fri Jul 25, 2025

Gardner Housing Authority

Gardner Housing Authority to review Annual Plan

The Gardner Housing Authority will meet to accept the minutes from the June 18, 2025 meeting and the Annual Plan. The board will also review the Executive Director's report and an invoice history report.

housingpublic-housingadministration
Mon Jul 21, 2025

Board of Health

Board of Health to review draft private well regulations

The Board of Health will discuss draft regulations governing the siting, construction, and testing of private wells. The meeting also includes health department updates on landfill leachate and food establishments.

public-healthwater-wellsregulationsenvironmentlandfill
✓ Decided: Super 8 motel will cease shelter use and return to motel operations

The Board of Health reported that the Super 8 motel is no longer being used as a shelter and will resume motel operations. The board reviewed proposed well regulations, including radiological testing limits and a tenant right to request new water testing if results are older than five years. Updates were given on a $40,000 leach system replacement cost, groundwater monitoring results, food and housing inspections, and a West Nile virus case in wildlife. The next meeting is scheduled for August 25, 2025.

Tue Jul 15, 2025

Zoning Board

Zoning Board to review school conversion into 23 apartments

The Zoning Board of Appeals will hold public hearings on five cases. The board is reviewing requests for special permits, modifications, and variances for residential properties.

zoninghousingapartmentspublic-hearings
✓ Decided: Zoning Board unanimously continues 63 Walnut St. special permit case

The board voted to continue the special‑permit case for 63 Walnut Street, allowing the potential buyer more time to finalize the purchase. Member Hanks made the motion, Member Antaya seconded, and the motion passed unanimously. No other motions were approved or denied during the meeting.

Tue Jul 15, 2025

Master Plan Steering Committee

Gardner Master Plan Steering Committee to review project timeline and status

The committee will discuss the current timeline for the Master Plan, including a grant extension and historical and natural resources. Members will review project status, upcoming public engagement events, and results from previous community events.

city-planningmaster-plancommunity-engagementgrants
Mon Jul 14, 2025

Conservation Commission

Conservation Commission to hold hearing on contractor building at 170 Mill Street

The Conservation Commission will hold a joint public hearing regarding a Notice of Intent for a contractor building and site improvements at 170 Mill Street. The body will also review enforcement orders and a certificate of compliance request.

conservationwetlandszoningpublic-hearingenvironment
✓ Decided: Commission issues partial COC for 380 Leo Drive and continues several project discussions

The Conservation Commission approved several sets of meeting minutes, issued a partial Certificate of Compliance for 380 Leo Drive (DEP#160-0261), and voted to postpone discussion of the sludge landfill, 36 Nicolle Terrace, 282 Brookside Drive, and 170 Mill Street to the July 28, 2025 meeting. All motions carried with the vote totals recorded in the minutes.

Tue Jul 8, 2025

License Commission

License Commission to review alcohol permits and application deadlines

The Board of License Commission will hold hearings for a one-day alcohol permit and a license amendment. The board will also discuss updating the submission deadline for one-day permits and review the status of several pending license transfers.

alcohol-licensespermitsbusiness-regulation
✓ Decided: License Commission adopts 45‑day submission rule for 1‑Day alcohol permits

The commission approved several license applications, including a 1‑day all‑alcohol permit for Moon Hill Brewing and an amendment for South Gardner Mini Mart. It also approved manager changes for Gardner Lodge 1426 BPO Elks and the Lithuanian Outing Association, and approved transfers and new licenses for Sawa Asian Cuisine & Lounge and Sawa to Go, pending ABCC review. The commission adopted a new requirement that 1‑day alcohol permit applications be submitted 45 days before the event. Minutes from the June 10 and June 17, 2025 meetings were approved.

Tue Jul 8, 2025

Planning Board

Planning Board to review zoning change for solar overlay and site plans

The Gardner Planning Board will discuss a zoning map amendment and review site plans for residential and commercial improvements. The board will also consider a parking variance request.

zoningsolarhousingparkingsite-plans
✓ Decided: Planning Board approves multi‑family site plan and recommends zoning change

The Board approved the June 10, 2025 meeting minutes. It approved the definitive site plan for the multi‑family residential units at 0 Emerald Dr with conditions. It also recommended changing the zoning of the parcel east of MA‑101 from Commercial 2 to Industrial 1 with a Summit Solar Overlay. Both motions passed unanimously.

Mon Jul 7, 2025

City Council

Gardner City Council to consider floodplain zoning updates and property sales

The City Council will discuss updating the Floodplain Overlay District to comply with FEMA requirements. The body is also considering zoning changes for Central Street and historic preservation projects, as well as the sale of city-owned property.

zoningfemareal-estatebudgethistoric-preservation
✓ Decided: Council declared 130 Elm St. surplus, set $300,000 minimum sale price

The City Council approved several zoning amendments, licensing grants, and budget measures. It also authorized the construction of a wall at the Waterford Community Center and created a new Youth Center Director position with a $65,000 salary. The council declared the land and buildings at 130 Elm Street surplus, establishing a $300,000 minimum price for any sale.

Mon Jul 7, 2025

City Council

City Council to consider zoning change for parcel on MA-101

The City Council and Planning Board will hold a joint public hearing to consider amending the City of Gardner Zoning Code. The proposal seeks to change the zoning designation of a specific parcel in eastern Gardner.

zoningland-usesolar
✓ Decided: City Council approved zoning change for parcel east of MA‑101

The City Council and Planning Board held a joint public hearing on July 7, 2025 to consider an ordinance amending the Gardner zoning map. No members of the public spoke for or against the amendment. The council later accepted the amendment on November 17, 2025, changing the parcel from Commercial 2 to Industrial 1 with a Summit Solar overlay.

Wed Jul 2, 2025

Airport Commission

Gardner Airport Commission to review facility and budget updates

The Airport Commission will meet to discuss updates from Gale Associates and the Airport Manager. The session includes reviews of the budget and facility status.

airportbudgetinfrastructurewildlife-management
✓ Decided: No decisions made as meeting lacked quorum

The commission meeting opened at 5:35 pm with no quorum, so no votes or approvals occurred. Items such as the runway project closeout, stormwater plan approval, and wildlife survey were discussed, but no actions were formally decided. The meeting adjourned at 6:11 pm.

Wed Jul 2, 2025

Finance Committee

Finance Committee to consider sale of 130 Elm Street for $300,000

The Finance Committee will review several proposals regarding the Waterford Community Center and municipal staffing. The body is also discussing city-wide policies on sexual harassment and facilities management.

real-estatecommunity-centerpersonnelbudgetsenior-services
✓ Decided: City Council to sell 130 Elm Street property for at least $300,000

The Finance Committee recommended that the full City Council declare the land and buildings at 130 Elm Street surplus and authorize their disposal with a minimum sale price of $300,000. The recommendation was adopted by a 3‑yea vote. The Committee also approved several orders for the Gardner Community Action Committee to alter the Waterford Community Center and increased revolving‑fund limits for senior‑center programs.

Fri Jun 27, 2025

Economic and Community Development Committee

Economic and Community Development Committee to meet June 27

The committee will receive the June economic and community development update. Members will also review reports on the Maki Park Project and the Regional Planning Commission.

economic-developmentcommunity-planningparksregional-planning
✓ Decided: Committee waived minutes reading and adjourned the meeting

The Economic and Community Development Committee approved a motion to waive the reading of the May 30, 2025 minutes and accept them as presented. A second motion to adjourn the meeting was also approved. No other formal actions were taken.

Fri Jun 27, 2025

Public Safety Committee

Gardner Public Safety Committee to review business licenses and parking meter status

The committee will discuss the number of vehicles towed under winter parking ban procedures and the status of city parking meters. Members will also consider license applications for two businesses.

licensingparkingpublic-safetytraffic
✓ Decided: Committee recommended City Council approve EcoATM and Ten Pins licenses

The Public Safety Committee waived reading the May 22 minutes and accepted them. It recommended the mayor's parking‑meter communication be placed on file. It voted to recommend the City Council approve a license for EcoATM LLC at 560 Main Street and a bowling‑alley license for Ten Pins at 560 West Broadway Street. All motions passed with three yeas.

Wed Jun 25, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to review project updates and year-end financials

The Gardner Redevelopment Authority will discuss updates on the Rear Main Project and properties at 155 Mill and 85 Winter Street. The meeting includes a review of fiscal year end financials and proposed improvements at the Garbose property.

redevelopmenturban-renewalfinanceproperty-improvement
✓ Decided: Extension granted for Rear Main Project completion until June 30, 2026

The Rear Main Project was reported to have restarted, with drainage work beginning this week. Parking on the rear service road was noted as an issue due to a crane. The Authority granted an extension for the project’s completion until June 30, 2026, and some reimbursements have already been submitted. Presentations were given on the S. Bent and Garbose properties and the Authority’s year‑end financials.

Tue Jun 24, 2025

Retirement Board

Gardner Retirement Board to review FY26 COLA notice and investments

The Gardner Contributory Retirement Board will meet to approve financial warrants and review investment statements. The board will also discuss the FY26 Cost of Living Adjustment (COLA) notice for retirees and survivors.

retirementpensionsfinanceinvestmentsgovernment-administration
✓ Decided: Board conducted interviews for Fifth Board Member position

The Gardner Contributory Retirement Board bypassed the agenda to interview applicants for the Fifth Board Member seat. Four candidates—Magnus Carlberg, Sai Saathvik Domala, Jacob Cormier, and Thomas Burgomaster—were interviewed, while William Cardaropoli cancelled his interview. No votes or formal decisions were recorded during the meeting.

Mon Jun 23, 2025

Conservation Commission

Conservation Commission to hold hearing on 170 Mill Street project

The Conservation Commission will conduct a joint public hearing regarding a Notice of Intent for a contractor building and site improvements at 170 Mill Street. The body will also discuss enforcement orders and local environmental updates.

conservationwetlandszoningenvironmentpublic-hearing
✓ Decided: Commission approved $385 for MACC dues and postponed several items to July

The commission voted 6-0 to table the June 9 minutes until the July 14 meeting. It also voted unanimously to continue discussion on the Sludge Landfill, 36 Nicolle Terrace, 282 Brookside Drive, and the 170 Mill Street project at the July 14 meeting. The board approved a $385 expenditure for yearly MACC dues. The meeting was adjourned.

Mon Jun 23, 2025

Golf Commission

Golf Commission to discuss new fees for preferred tee times

The Golf Course Commission will meet to review financial reports and expense reports. The body is also scheduled to discuss new fees for preferred tee times and tournament meal requirements.

golf-coursefeesbudgetrecreation
✓ Decided: Golf Commission approved FY26 financial statements

The commission accepted the June 9 meeting minutes with a 4‑0 vote. A motion was made to post commission policies on the City and Golf Course websites. The commission accepted the presented financials for FY26 by a 4‑0 vote. The meeting was adjourned with a 4‑0 vote.

Wed Jun 18, 2025

Gardner Housing Authority

Gardner Housing Authority to review May 2025 invoice history

The Gardner Housing Authority will hold a regular meeting to review administrative reports. The board will consider the minutes from the May 29, 2025 meeting and an invoice history report from May 2025.

housingfinanceadministration
Tue Jun 17, 2025

License Commission

License Commission to hear application for new alcohol license at 360 Timpany Blvd.

The Gardner Board of License Commission is holding a special meeting to conduct a public hearing. The board will consider a request for a new liquor license.

liquor-licensebusiness-permitspublic-hearing
✓ Decided: License Commission unanimously approves new alcohol license for Sawa To Go

The Gardner License Commission voted to approve Sawa To Go's application for a new all alcoholic beverage license at 360 Timpany Blvd. The approval allows the restaurant to serve alcohol and operate a dining room and bar for eat‑in service. All commission members voted in favor. No other business was conducted.

Tue Jun 17, 2025

Master Plan Steering Committee

Gardner Master Plan Steering Committee to review project timeline and status

The committee will discuss the current status of the Master Plan, including a grant extension and historical and natural resources. The meeting includes a review of needed action items and upcoming public engagement events.

master-plancommunity-developmentpublic-engagementplanning
Tue Jun 17, 2025

Zoning Board

Zoning Board to review multi-family housing and driveway requests

The Zoning Board of Appeals will hold public hearings on several land-use requests. These include proposals for multi-family dwellings and modifications to property setbacks and driveways.

zoninghousingland-usemulti-family
✓ Decided: Board approves special permit to convert 75 Oak St. to a three‑family dwelling

The Zoning Board of Appeals unanimously approved a special permit for BCF Investment LLC to change a two‑family house at 75 Oak Street to a three‑family dwelling, with conditions on driveway spacing and curb cuts. It also unanimously granted a special permit for Stephen Seney to build two multi‑family dwellings at 0 Emerald Street. The board denied variances requested by Gary and Joe Collette for individualizing driveways at 21‑19 Stephanie Drive, and approved a variance amendment for Donald S. Foster II to reduce the front yard setback to 30 feet. Additionally, a five‑year extension for a variance and special permit was approved for Glenn Maki at 0 Linus Allain Avenue.

Tue Jun 17, 2025

Historical Commission

Historical Commission to discuss zoning amendments and facility modifications

The Historical Commission will meet to elect officers and review the FY2026 budget. The body will discuss several preservation projects and a proposal from AT&T regarding a facility at 58 Main Street.

historic-preservationzoningbudgetdemolitioncity-planning
✓ Decided: Commission accepted invitation to co‑host Boston Tea Party Museum anniversary event

The Gardner Historical Commission approved the Council on Aging's invitation to co‑host a Boston Tea Party Museum 250th‑anniversary speaking event at the senior center. The FY2026 budget received an additional $3,000 and funds were earmarked for a professional assessment of the Old Burying Ground. The commission also voted to offer the Greenwood Memorial Record Holders Board to John Hochard. Officers and associate members for the 2025‑2026 session were elected.

Mon Jun 16, 2025

Board of Health

Board of Health to review private well regulations and variance requests

The Board of Health will discuss draft regulations for private wells and consider variance requests for a project at 0 Minott St. The meeting also includes updates on landfill projects and a pediatric vaccine clinic.

public-healthzoningwater-qualitywellsvaccineslandfill
✓ Decided: Board approved variance for well setback at 0 Minott Street

The Board accepted the minutes from the May 19, 2025 meeting. It granted a variance allowing a private well to be placed within 10 feet of the right‑of‑way at 0 Minott Street, pending Conservation Department approval. The meeting was then adjourned.

Mon Jun 16, 2025

City Council

Gardner City Council to vote on FY2026 budgets and major funding appropriations

The City Council is deciding on the FY2026 School Department and City expense and salary budgets. The body will also consider several zoning amendments and numerous funding transfers from free cash and enterprise surpluses.

budgetzoningpublic-workseducationfinance
✓ Decided: Council approves multiple funding orders, including $260K fire overtime

The City Council voted unanimously to send three zoning amendments to first printing. It also adopted a series of appropriation orders, transferring funds to police, sewer, water, public works, and emergency services. The largest single appropriation was $260,000 to the Fire Department for overtime. All motions passed with 11 yeas.

Thu Jun 12, 2025

Finance Committee

Finance Committee to review FY2026 Capital Improvement Plan and numerous fund transfers

The Finance Committee is reviewing a wide range of appropriation requests, including the FY2026 Capital Improvement Plan. The body will consider multiple orders to move funds from free cash and enterprise surpluses to various city departments.

budgetcapital-improvementpublic-workspublic-safetysenior-services
✓ Decided: Finance Committee approved $575,000 for DPW snow and ice removal

The Finance Committee voted to recommend a series of appropriations to the City Council, including large transfers for police overtime, fire overtime, sewer chemical treatment, and a $575,000 allocation for Department of Public Works snow and ice removal. The committee also removed item 11516 concerning a special committee for the Waterford Community Center from the subcommittee agenda. All motions passed with three yeas.

Wed Jun 11, 2025

Airport Commission

Gardner Airport Commission to review runway and facility updates

The Airport Commission will meet to discuss updates regarding the runway and airport facilities. The meeting includes a budget review and a report from the Airport Manager.

airportinfrastructurebudgettransportation
✓ Decided: Commission approved signing the Aero Study

The Gardner Airport Commission voted to approve signing the Aero Study. The commission also noted the signing of a lease agreement for Dakota Nielson. No other substantive actions were recorded.

Wed Jun 11, 2025

Disability Commission

Gardner Disability Commission to vote on summer meeting schedule

The Disability Commission will meet to discuss grant opportunities, training, and local events. The body is scheduled to vote on suspending formal meetings for July and August.

disability-servicescommunity-eventsgrantstraining
✓ Decided: Commission voted to suspend meetings in July and August, resuming in September.

The commission approved the May 14, 2025 meeting minutes unanimously. It voted to suspend all commission meetings for July and August, planning to resume regular meetings in September, also unanimously. The legislative advocacy (ARC) training was scheduled for July 9, and the commission signed up to attend the 12th Annual Greater Gardner National Night Out. The meeting was formally closed at 2:00 PM by unanimous vote.

Tue Jun 10, 2025

Planning Board

Planning Board to review multi-family and senior housing projects

The Planning Board will continue a public hearing on a multi-family residential site plan and review a conceptual plan for a senior residential development. The board will also discuss zoning amendments and updates to the floodplain overlay district ordinance.

zoninghousingsenior-housingland-useordinances
✓ Decided: Board accepted amendment to the city’s Floodplain Overlay District

The Planning Board approved the May 13 meeting minutes and postponed the definitive site plan for multi‑family units to the July 8 meeting. It accepted an amendment to the Floodplain Overlay District and recommended the city council adopt a historic preservation zoning amendment for Central Street. The board also set July 7 for a joint public hearing on a zoning map change and adjourned the meeting.

Tue Jun 10, 2025

License Commission

License Commission to hear 1-day beer and wine applications for Food Truck Festival

The Board of License Commission will hold hearings for two temporary event licenses and review the status of several pending manager changes and license transfers. The board is also tracking a renewal application missing required documentation.

liquor-licensesfood-truck-festivalalcohol-permitsadministrative
✓ Decided: Two 1‑day beer & wine licenses approved for July 12 festival

The commission unanimously approved the minutes from the May 13, 2025 meeting. It also unanimously approved 1‑day beer and wine licenses for Tavern 13 and Moon Hill Brewing for the July 12, 2025 Food Truck Festival. All other items on the agenda were tabled for the July meeting.

Mon Jun 9, 2025

Conservation Commission

Commission to hold hearing on New England Power transmission line refurbishment

The Conservation Commission will hold public hearings regarding a large scale transmission line project and a contractor building at 170 Mill Street. The body will also discuss beach nourishment and utility maintenance.

wetlandsutilitiespermittingenvironmentpublic-hearings
✓ Decided: Commission approved New England Power transmission line plan with 2‑year monitoring

The Conservation Commission accepted the refurbishment plan for the New England Power A1/B2 transmission line and required a two‑year monitoring program. It also issued a Certificate of Compliance for 525 Parker Street and approved the minutes from three prior meetings. The discussion on the 170 Mill St project was postponed to the July 14 meeting, and the meeting was adjourned.

Mon Jun 9, 2025

Golf Commission

Gardner Golf Commission to review financials and receive staff updates

The Golf Commission will meet to approve previous meeting minutes and review financial reports. The session includes updates from Pro Manager Dan Berry and Superintendent William Frank.

golf-coursefinancecity-management
✓ Decided: Commission approved minutes, tabled policy discussion, and adjourned

The Golf Commission approved the minutes from the May 5 and May 12 meetings with a 4‑0 vote after correcting a vote error. The discussion of golf‑course policies was postponed until the June 23 meeting. The commission then adjourned the meeting by a 4‑0 vote.

Mon Jun 9, 2025

City Council

City Council to review FY2026 budget and fund appropriations

The City Council is meeting to review the FY2026 budget, including authorizations for revolving funds and specific appropriations from surplus and reserved accounts. The body will consider funding for the school department, city expense budget, and salary and labor budget.

budgetappropriationsschoolspublic-worksfinance
✓ Decided: No formal actions were approved or denied at the June 9 informal meeting

Council members discussed budget items, staffing, and facility needs but did not vote on any measures. Topics included sewer and water funding, pool repairs, library staffing, airport maintenance, and upcoming storm‑water permit requirements. No approvals, denials, or amendments were recorded.

Mon Jun 9, 2025

City Council

Gardner City Council to hold joint hearing on zoning amendments

The City Council and Planning Board will hold a joint public hearing to consider three amendments to the City's Zoning Code. One proposal seeks to update floodplain regulations to comply with new FEMA requirements and ensure property insurability.

zoningfloodplainfemahistoric-preservationparking
✓ Decided: City Council accepted the historic preservation zoning amendment

The joint public hearing on June 9, 2025 presented three zoning amendments: a floodplain overlay update, a commercial overlay for Central Street, and a historic preservation project amendment. No public opposition was voiced for any amendment. The City Council formally accepted the historic preservation zoning amendment, with the acceptance dated October 20, 2025. No vote tally was recorded in the minutes.

Mon Jun 9, 2025

School Committee

Gardner School Committee to vote on multiple policy updates and removals

The School Committee will consider the second reading and adoption of several policies, including those regarding background checks and meeting notifications. The body will also vote on the removal of policies concerning the duties of the Chair and Finance Officer.

school-policybudgetadministrationgovernance
✓ Decided: School Committee approved a 5% salary increase for Superintendent Dr. Pellegrino

The Committee accepted the consent agenda, ratifying four warrants totaling $978,806.57. It adopted several policies on first and second readings and removed two redundant policies. The superintendent’s end‑of‑cycle evaluation report was accepted, and a 5% salary increase for Dr. Pellegrino was approved.

Sat Jun 7, 2025

Zoning Board

Zoning Board to review multi-family dwelling proposal at 0 Emerald St

The Zoning Board of Appeals will conduct a site visit and review a special permit application. The board is considering a proposal to construct two multi-family dwellings.

zoninghousingmulti-familyland-use
✓ Decided: Zoning Board held site visit; no decisions were made

Board members Melory Cornett, David Antaya, Richard Hanks and Chairman Raymond LaFond visited 0 Pine St on June 7, 2025. Applicant Stephen Seney showed the proposed multifamily structures, driveways, retainer wall and drainage system. Two neighbors attended and the board left the property at about 10:00 a.m. No formal actions, approvals, or votes were recorded.

Fri Jun 6, 2025

Development Review Committee

Review of proposed 180-unit senior residential development

The Development Review Committee will review a conceptual site plan for a senior residential project. The proposal includes 180 units consisting of 90 duplexes.

housingsenior-livingdevelopmentzoning
Thu Jun 5, 2025

Cemetery Commission

Gardner Cemetery Commission to review financial statements and grounds conditions

The Municipal Grounds/Cemetery Commission will meet to review the Cemetery Department's financial statement and receive updates on municipal grounds and cemetery conditions. The body will also hear an update from the Bandstand Committee.

cemeteriesmunicipal-groundsfinancepublic-works
✓ Decided: Commission unanimously accepts minutes, financial statement and adjourns

The Municipal Grounds/Cemetery Commission approved the minutes from the March 5, 2025 meeting. It also accepted the financial statement and directed the Director of Public Works to provide the total balance of cemetery accounts. The meeting was then adjourned at 8:12 a.m., with all motions passing unanimously.

Thu Jun 5, 2025

Bandstand Committee

Bandstand Committee to finalize 2025 concert schedule

The Bandstand Committee will meet to approve previous minutes and review correspondence. The body will discuss the 2025 concert schedule, contracts, and financial statements.

arts-and-cultureconcertspublic-works
✓ Decided: Bandstand Committee accepted minutes and set August concert times

The committee approved the minutes from the May 15 meeting after corrections. It confirmed a $2,000 donation from the Culture Council and a sponsor check from David Lapointe. Concert start times were set: the first two weeks of August will run 6 p.m.–8 p.m., and the final two weeks will run 5 p.m.–7 p.m. No next meeting date was scheduled.

Wed Jun 4, 2025

Airport Commission

Gardner Airport Commission to review runway and facility updates

The Airport Commission will meet to discuss updates regarding the runway and airport facilities. The body will also review the budget and the Airport Manager's report.

airportinfrastructurebudgetaviation
Tue Jun 3, 2025

Board of Assessors

Board of Assessors to review motor vehicle excise abatements

The Board of Assessors will meet to approve meeting minutes and sign May 2025 motor vehicle excise abatements. The board will also receive an update on the FY26 budget hearing and the LA3 submission.

taxesbudgetabatementsreal-estate
✓ Decided: Board accepted April minutes and adjourned the meeting

The Board of Assessors voted 2‑0 to accept the minutes from the April 22, 2025 meeting. A second 2‑0 vote approved the motion to adjourn the session at 2:06 p.m. No other substantive actions were taken.

Mon Jun 2, 2025

City Council

Gardner City Council to review FY2026 budget and non-union pay scale

The City Council will review the FY2026 budget, including appropriations for city departments and schools. The meeting includes a proposal to establish a new compensation matrix for non-union employees.

budgetsalarieseducationcity-government
✓ Decided: Council approves FY2026 budget appropriations totaling over $90 M

The Gardner City Council approved a series of FY2026 budget appropriations without objection, covering revolving funds, parking meter receipts, sewer and water surplus earnings, landfill surplus, cable commission fees, enterprise funds, and school and city department budgets. A motion by Councillor Elizabeth Kazinskas, seconded by Councillor Dana Heath, to request additional information on the salary study and to table the ordinance amending the non‑union compensation schedule passed with 10 yeas. A subsequent motion by Councillor Brad Heglin, seconded by Councillor Aleksander Dernalowicz, to amend that motion and refer it to the Committee of the Whole also passed with 10 yeas.

Mon Jun 2, 2025

City Council

City Council to consider zoning change for industrial use on MA-101

The Gardner City Council will review a petition to change a parcel on MA-101 to an Industrial 1 district with a Summit Solar Overlay. The body will also consider second-hand dealer licenses and funding adjustments for the Council on Aging.

zoningsenior-servicesbusiness-licensespersonnelbudget
✓ Decided: Council approved new Economic Development & Finance Manager position

The Gardner City Council voted 10 yeas to adopt an ordinance adding the Economic Development and Finance Manager position to the non‑union compensation schedule. It also approved licenses for two businesses to sell second‑hand articles, and referred a zoning map amendment and a spending‑limit order for the Council on Aging to committees for further study. The council authorized acceptance of donations for the Council on Aging and adjourned the meeting.

Fri May 30, 2025

Public Welfare Committee

Public Welfare Committee to discuss floodplain zoning and senior center funding

The committee will consider an ordinance to update floodplain overlay zoning to meet FEMA requirements. Members will also discuss creating a $20,000 revolving account for Lifeline Service Activities and hold budget meetings for various city departments.

zoningbudgetseniorsfemapublic-welfare
✓ Decided: Council approved floodplain overlay amendment to meet FEMA requirements

The Public Welfare Committee approved Ordinance 11519 to amend Section 510 of the zoning code, updating the floodplain overlay district, with a vote of 3 yeas. The committee also referred Measure 11577, creating a revolving fund for Lifeline services, to the Finance Committee, passing 3 yeas. Additionally, the reading of the May 20, 2025 minutes was waived and accepted. The meeting adjourned at 11:47 a.m.

Fri May 30, 2025

Economic and Community Development Committee

Economic and Community Development Committee to hold FY2026 budget hearing

The committee will meet to conduct a budget hearing for FY2026 and receive a May update on economic and community development. The body will also discuss the Regional Planning Commission and the Maki Park Project investigation.

budgeteconomic-developmentplanningparks
✓ Decided: Committee waived reading of minutes and accepted them as presented

The committee voted to waive the reading of the April 4, April 22, and May 16 minutes and accepted them as presented. A motion to adjourn the meeting was made, seconded, and approved, ending the session at 1:36 p.m. The subcommittee items on the Maki Park project and the Regional Planning Commission were each retained for future consideration. No other actions or approvals were recorded.

Fri May 30, 2025

Zoning Board

Zoning Board to conduct site visits for multi-family and condo projects

The Zoning Board of Appeals is conducting site visits for four cases. These visits concern the construction of multi-family dwellings and the individualization of driveways for condominiums.

zoninghousingmulti-familycondominiums
Thu May 29, 2025

Finance Committee

Finance Committee to review FY2026 budget and multiple funding requests

The Finance Committee will hold budget meetings for various city departments and review numerous orders to appropriate funds from free cash and enterprise surpluses. The body will also consider the FY2026 Capital Improvement Plan and updated city financial policies.

budgetpublic-workswater-sewerpublic-safetycapital-improvements
✓ Decided: Finance Committee approved $1M transmission main replacement and other budget items

The Finance Committee approved a series of appropriations and measures for the FY2026 budget. Highlights include a $1,000,000 appropriation for the Transmission Main Replacement Project and funding for public works, police, fire, and water services. The committee also adopted the FY2026 Capital Improvement Plan and created a revolving account for Youth Center Services.

Thu May 29, 2025

Gardner Housing Authority

Gardner Housing Authority to hold regular meeting May 29

The Gardner Housing Authority will meet to review administrative reports and approve previous meeting minutes. The agenda consists of procedural and reporting items.

housing-authorityadministrationgardner-ma
Wed May 28, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to review Rear Main Project and loan repayments

The Gardner Redevelopment Authority will receive updates on several urban renewal projects and loan repayments. The body will also schedule a discussion regarding fiscal year end financials.

urban-renewalloansfinanceredevelopment
✓ Decided: GRA meeting adjourned unanimously after updates on projects and finances

The Gardner Redevelopment Authority meeting opened with updates on the Rear Main Project change order of $588,000, the MassDevelopment loan repayment of $173,690.72, and deposits received for 155 Mill and 85 Winter Streets. No substantive actions or votes were taken on these items. The only formal decision was the motion to adjourn, which passed unanimously with a 4‑0 vote.

Tue May 27, 2025

Retirement Board

Gardner Retirement Board to review FY2026 budget and disability retirements

The Gardner Contributory Retirement Board will meet to approve minutes, financial reports, and warrants, and discuss old and new business including disability retirements, a board administrator contract renewal, and the proposed FY2026 operating budget.

retirementbudgetfiscal-year-2026contractsfinancial-reports
✓ Decided: Board unanimously approved FY2026 budget and multiple 7‑year legal contracts

The Gardner Contributory Retirement Board approved the FY2026 operating budget of $616,760.00 and entered seven‑year contracts with two law firms for legal services. It also approved a three‑year contract for the Board Administrator, authorized late applications for the open board‑member seat, and granted retirement benefits to Cheryl K. Slack. All actions were approved unanimously.

Thu May 22, 2025

Public Safety Committee

Gardner Public Safety Committee meets May 22 to review FY2026 budgets and new license applications

The Public Safety Committee will convene at 8:00 A.M. in City Council Chambers to review minutes from the March 28 meeting, discuss FY2026 budget proposals for public safety departments, and address new agenda items including parking meter status and second-hand dealer license applications.

budgetpublic-safetyzoninglicensingcity-council
✓ Decided: Committee recommends FY2026 budget and two second-hand license approvals

The Public Safety Committee waived the reading of the March 28, 2025 minutes and accepted them (3 yeas). It voted to recommend the FY2026 budget to the City Council for approval (3 yeas). It also recommended approval of two second‑hand dealer licenses—Gardner Coins and Cards at 18 Parker Street and Hopeful Boutique at 29 Pleasant Street (each 3 yeas). The meeting was adjourned at 8:57 a.m.

Thu May 22, 2025

Traffic Commission

Traffic Commission to discuss speed zones and parking trials

The Traffic Commission will review safety concerns at specific intersections and discuss the implementation of 25 MPH zones. The body will also consider parking restrictions and signage trials.

traffic-safetyparkingspeed-limitssignagepublic-safety
✓ Decided: Commission asked Mayor to adopt citywide 25 mph speed zones

The Traffic Commission unanimously voted to request that the Mayor accept special 25 mph speed zones citywide under Chapter 218, Sec. 193. It also approved a 60‑day parking‑restriction trial on West Broadway and Union Street and referred the Douglas Street parking trial to Public Safety. Additional actions included moving Item 9 to the start of the agenda and approving the minutes from the January 30, 2025 meeting.

Tue May 20, 2025

Zoning Board

Gardner Zoning Board to hear requests for multi-family housing and driveway changes

The Zoning Board of Appeals will hold public hearings on several special permits and variances. Decisions include requests to increase dwelling density and modify driveway access for residential properties.

zoninghousingspecial-permitsvariances
✓ Decided: Board unanimously votes to continue pending cases to future meetings

The Zoning Board of Appeals voted unanimously to continue the special permit case for 163‑165 Pine Street until the July meeting. It also voted unanimously to continue the special permit case for 75 Oak Street until the June meeting. No other substantive actions or approvals were taken.

Tue May 20, 2025

Public Welfare Committee

Public Welfare Committee to vote on zoning changes and senior center donations

The Gardner Public Welfare Committee will meet to discuss and vote on several zoning amendments, a budget presentation for Montachusett Vocational Technical School, and accept gifts for the Gardner Senior Center. The meeting will also include introductions, reading of prior meeting minutes, and councillor questions.

zoningbudgetsenior-centereducationfloodplainhistoric-preservation
✓ Decided: Committee approved zoning changes for Central Street commercial overlay

The Public Welfare Committee voted to place the FY'26 Montachusett Vocational Technical School budget presentation on file, to keep the floodplain overlay amendment on the agenda pending further input, and to approve several orders and zoning amendments, including a commercial overlay on Central Street and a historic preservation provision. All motions passed with three yeas.

Tue May 20, 2025

Historical Commission

Historical Commission to discuss preservation zoning and city artifacts

The Historical Commission will meet to review the FY2026 budget and administrative rules. The body will discuss several preservation projects and a zoning amendment related to 100 Central Street.

historic-preservationzoningbudgetcity-artifacts
✓ Decided: Commission adopts new Rules and Regulations and approves budget plan

The Gardner Historical Commission adopted its revised Rules and Regulations. It approved the minutes from the April 15 meeting as amended. The commission voted to send the Mayor a letter outlining FY2026 expenditure plans for the budget.

Mon May 19, 2025

Board of Health

Gardner Board of Health establishes regulations for private wells

The Board of Health is implementing regulations for the siting, construction, and testing of private wells to protect public health and groundwater quality. These rules supersede all previous private well regulations in the city.

public-healthwater-qualityprivate-wellspermitsgroundwater
✓ Decided: Board approved transfer station fee increases effective July 1, 2025

The Board of Health unanimously accepted the minutes from the April 28, 2025 meeting. It also unanimously approved the proposed increases to transfer‑station fees, with the changes taking effect on July 1, 2025. The meeting was then adjourned by unanimous vote. Other well‑regulation items were discussed but not formally adopted.

Mon May 19, 2025

City Council

Gardner City Council to vote on FY2026 school budget of $37.68 million

The City Council will hear a presentation on the FY2026 Gardner Public Schools budget and vote on a proposed $37,676,548 level-services budget. The budget presentation covers enrollment changes, out-of-district placement costs, and a funding gap that was closed to reach a zero deficit.

budgetschoolseducationfy2026public-schoolsgardner
✓ Decided: City Council received FY2026 Gardner school budget presentation

The council met informally on May 19, 2025 to hear Superintendent Mark Pellegrino’s FY2026 school budget presentation. A discussion and vote on approving the $37,676,548 budget were called, but the minutes do not record the vote outcome or any formal decision.

Mon May 19, 2025

City Council

City Council to vote on FY2026 budgets and department appropriations

The City Council will consider the FY2026 budget proposal and several orders to appropriate funds for city departments, including schools. The body will also discuss non-union compensation and the creation of an Economic Development and Finance Manager position.

budgetappropriationspersonneleducationfinance
✓ Decided: Council approves $36.7M school budget and major FY2026 appropriations

The City Council accepted the amended minutes from the April 7 meeting and placed on file the Mayor’s FY2026 budget communication. It approved several large appropriations, including $36,715,187 for the School Department, $29,332,133 for the city’s expense budget, and $14,587,314 for the salary and labor budget. The Council also adopted an ordinance amending the non‑union compensation schedule, authorized the Gardner Community Action Committee to alter its leased space at the Waterford Community Center, and confirmed the Mayor’s appointment of Jason Stevens as Director of Community Development & Planning.

Sat May 17, 2025

Zoning Board

Zoning Board to conduct site visit at 163-165 Pine Street

The Zoning Board of Appeals will conduct a site visit to review a specific property. The board will discuss a Special Permit violation regarding a site owned by MHG Fund, LLC and Jonathan Bombaci.

zoningspecial-permitsite-visitcode-violation
✓ Decided: Zoning Board visited 163-165 Pine St site, no actions taken

Board members Melory Cornett, David Antaya, and Chairman Raymond LaFond conducted a site visit at 163-165 Pine Street on May 17, 2025 from 9:30 am to 10:00 am. Applicant Jonathan Bombaci showed the proposed additional parking space and explained design changes. The board completed the visit and left the property. No formal decisions, approvals, or votes were recorded.

Fri May 16, 2025

Economic and Community Development Committee

Gardner committee to discuss new Economic Development and Finance Manager position

The Economic and Community Development Committee will meet to discuss the creation and compensation of an Economic Development and Finance Manager position. The body will also review an investigation report on the Maki Park Project and discuss the Regional Planning Commission.

economic-developmentpersonnelcity-planninggovernment-administration
✓ Decided: Committee recommended creating an Economic Development Manager position at $85,000

The committee waived the reading of the February 18 and March 14 minutes and accepted them as presented. It voted to recommend approval of the Economic Development and Finance Manager position and its job description to the full City Council, and to amend the compensation to $85,000 and send the ordinance to first printing. The discussion of the Regional Planning Commission item was postponed to a future meeting with the mayor. The meeting was adjourned at 1:04 p.m.

Thu May 15, 2025

School Subcommittees

Gardner Public Schools Policy Subcommittee to review school district policies

The Policy Subcommittee will meet to review a series of district policies. These reviews cover areas including school committee meetings, superintendent contracts, and student conduct.

school-policysuperintendentstudent-conductgovernance
✓ Decided: Subcommittee tables superintendent contract, forwards policy updates to full committee

The subcommittee approved the minutes from the April 16, 2025 Policy Meeting. It tabled the Superintendent’s Contract policy for further review at the next meeting. Several policies were left unchanged, deemed redundant, or had formatting changes approved and were sent to the June full School Committee for a first read. The meeting was then adjourned.

Thu May 15, 2025

Bandstand Committee

Bandstand Committee to finalize 2025 concert schedule, discuss contracts

The Bandstand Committee will finalize the 2025 concert schedule and discuss related contracts. They will also approve previous meeting minutes and review financial statements. The agenda is largely procedural but includes substantive decisions on summer programming.

bandstandconcertscontractsparksmeetinggardner-ma
✓ Decided: Bandstand Committee approves $500 donation and accepts prior minutes

The committee accepted the minutes from the April 24, 2025 meeting. It approved a $500.00 donation from Price Chopper. Rain dates were confirmed for several scheduled performers. The meeting was adjourned at 4:00 p.m.

Wed May 14, 2025

Finance Committee

Finance Committee to review Waterford Community Center lease modifications

The Finance Committee will consider a measure allowing the Gardner Community Action Committee to build a wall at the entrance of their leased space at the Waterford Community Center. The body will also continue discussions on health insurance trust funds and municipal building management.

facilitiesleasingpersonnel-policyhealth-insurancemunicipal-management
✓ Decided: Finance Committee recommended City Council approve a wall for the CAC at Waterford Center

The committee waived the reading and accepted the April 7, 2025 Finance Committee minutes. It recommended that the City Council approve the Gardner Community Action Committee’s request to build a wall in the Waterford Community Center lease space. The committee also approved a motion to resend the vote on naming the council chambers and to purchase a bronze plaque honoring Ronald F. Cormier. Several discussion items, including health‑insurance trust funds and policy updates, were kept on the agenda for future consideration.

Wed May 14, 2025

Disability Commission

Disability Commission to discuss parks accessibility, ADA anniversary, and upcoming events

The Gardner Disability Commission will review meeting minutes, receive updates on the Health and Wellness fair and local parks/playgrounds accessibility, and discuss old business including the ADA 35th anniversary and new business regarding the Small Business Saturday and Gardner Festival. No votes are scheduled; items are for discussion only.

disabilityaccessibilityparksadaeventshealth-and-wellness
✓ Decided: Commission approved meeting minutes and closed meeting, plans festival participation

The Disability Commission unanimously approved the May 14 meeting minutes. The commission signed up to participate in the Small Business Saturday and Gardner Festival on June 21. The meeting was closed unanimously at 2:00 PM. Grant opportunities and park accessibility were discussed but no actions were voted on.

Wed May 14, 2025

Appointments Committee

Committee to interview and consider confirming Jason Stevens as Community Development Director

The Appointments Committee will interview Jason Stevens for the position of Director of Community Development & Planning and then discuss confirming his appointment along with three other mayoral appointments: Stephen Hirons (Sealer of Weights and Measures), Michael Budwick (Golf Commission), and Brian Hall (Conservation Commission). The committee will also approve minutes from prior meetings.

appointmentscity-councilcommunity-developmentweights-and-measuresconservation-commissiongolf-commission
✓ Decided: Committee recommended three mayoral appointments and asked for clarification on resignations

The committee waived reading of the minutes and accepted them as presented. It voted to send a letter to the mayor requesting clarification about the Department of Inspectional Services concerning recent resignations. The committee recommended the mayor’s appointments of Jason Stevens as Director of Community Development & Planning, Michael Budwick to the Golf Commission, and Brian Hall to the Conservation Commission to the full council. No decision was made on Stephen Hirons’s appointment, pending further interview.

Tue May 13, 2025

Planning Board

Planning Board to review multi-family home on Emerald Street and self-storage on Manca Drive

The Gardner Planning Board will continue a public hearing to consider two definitive site plan applications. One application proposes a multi-family home on Emerald Street, and the other proposes a self-storage facility on Manca Drive. The public is invited to attend.

planning-boardpublic-hearingsite-plan-reviewmulti-family-housingself-storagezoning
✓ Decided: Planning Board closed hearing, continued 0 Emerald St. review to June 10

The board voted 3-0 to close the public hearing on the West Mini Storage definitive site plan. It then voted 3-0 to continue the public hearing on the 0 Emerald Street project until June 10. Finally, the board voted 5-0 to close the public hearing.

Tue May 13, 2025

Planning Board

Planning Board continues hearings for West Mini Storage and multi-family project

The Gardner Planning Board will continue public hearings for two definitive site plans: a self-storage facility on Manca Drive (West Mini Storage) and a multi-family residential development on Emerald Street (Stephen Seney). They will also discuss updates to the Floodplain Overlay District Ordinance and a proposed zoning amendment for a Historical Preservation Project. The meeting includes approval of previous minutes and announcements.

planning-boardzoningpublic-hearingsite-planfloodplainhistorical-preservationself-storagemulti-family-housing
Tue May 13, 2025

License Commission

License Commission to consider KENO license for Four Seasons Chinese Cuisine

The Gardner Board of License Commission will hold a hearing on Four Seasons Chinese Cuisine's application for a KENO license. Old business includes updates on change-of-manager applications for Gardner Lodge 1426 BPO Elks and the Lithuanian Outing Association, both pending ABCC review. New business involves the upcoming ownership change of South Gardner Hotel, affecting its restaurant and boarding house licenses.

licenseskenoliquorhearingsmeetingscommission
✓ Decided: Moon Hill Brewing Co approved for 1‑day July 12 event license

The License Commission approved the minutes from the February/April 8, 2025 meeting with all members in favor. It also approved a one‑day license for Moon Hill Brewing Co’s July 12, 2025 customer‑appreciation event, with all members in favor. Two pending manager‑change requests for Gardner Lodge 1426 BPO Elks and the Lithuanian Outing Association were tabled for the June meeting.

Mon May 12, 2025

Conservation Commission

Commission to hold hearings on wetlands permits for transmission line and new home

The Gardner Conservation Commission will hold public hearings on two Notices of Intent: a single-family home at Betty Spring Rd and a large-scale refurbishment of the New England Power A1/B2 transmission line. They will also continue discussion on a contractor building at 170 Mill St. New business includes a fire runoff incident at 549 West Broadway and preliminary permitting discussions for a subdivision off Pearl Street and a beach nourishment project.

conservationwetlandspublic-hearingnotice-of-intentconstructiontransmission-linesubdivision
✓ Decided: Commission approved 0 Betty Spring Road home project with O&M report

The Conservation Commission approved the single‑family home project at 0 Betty Spring Road, adopting the standard order and requiring an annual operations‑and‑maintenance report. Enforcement orders for 36 Nicolle Terrace and 282 Brookside Drive were continued through June 9, 2025. Hearings on the New England Power transmission line and the 170 Mill St project were also continued to the June 9 meeting. The meeting was adjourned at 8:04 PM.

Mon May 12, 2025

Golf Commission

Golf Commission to vote on updated policies

The Gardner Golf Commission will meet to vote on updated policies for the golf course. The agenda also includes approval of meeting minutes from December 2024 and April 2025, old and new business, and correspondence. No specific policy changes or dollar amounts are detailed in the agenda.

golfcommissionpoliciesminutesmeeting
✓ Decided: Commission approved sending requested December 16 minutes to John Curran

The Golf Commission approved the 12/16/24 meeting minutes (3-1) and corrected the 4/7/24 minutes (4-0). A public‑record request from John Curran for the December 16 minutes was approved (4-0). Discussion of golf course policies was tabled until June 9, 2025, and the meeting was adjourned (4-0).

Mon May 12, 2025

School Committee

Gardner School Committee to vote on policies and program of studies

The School Committee will consider the adoption of several policies regarding member authority, qualifications, and resignations. The body will also vote on the Program of Studies and review four warrants totaling $1,221,347.76.

educationpolicybudgetschool-committee
✓ Decided: School Committee approved budget warrants, policies, and Program of Studies

The committee accepted the consent agenda, approving four warrants totaling $1,224,827.76. It gave first reading approval to a set of new policies and second reading approval to three specific policies. The committee adopted one policy on member resignation and approved the Program of Studies, including the Competency Determination. The meeting was then adjourned.

Wed May 7, 2025

Airport Commission

Airport Commission to discuss runway and master plan updates

The Gardner Municipal Airport Commission will meet on May 7, 2025, to approve minutes from the previous meeting and receive updates from Gale Associates on runway and master plan projects. The agenda also includes the Airport Manager's report, guard system counts, facility updates, and a budget review. No votes on specific expenditures or new policies are scheduled.

airportairport-commissionbudgetmaster-planrunway
Mon May 5, 2025

Golf Commission

Gardner Golf Commission to review financials and receive updates

The Golf Commission will meet to approve previous meeting minutes and review financial reports, including an expense report. The body will also receive updates from Pro Manager Dan Berry and Superintendent Bill Frank.

golf-coursefinancecity-management
✓ Decided: Golf Commission approves FY25 financials by unanimous vote

The commission voted 5-0 to approve the FY25 financials, including a $22,869 stipend for the Financial Administrator. Minutes from the December 16 and April 7 meetings were tabled for future review. No other substantive actions were taken.

Mon May 5, 2025

City Council

Gardner City Council to consider zoning changes for Central Street and historic projects

The City Council will discuss several zoning amendments, including a commercial overlay for Central Street and a new 'Historic Preservation Project' section. The body will also review an intermunicipal agreement for veterans services and financial audit reports.

zoninghistoric-preservationveterans-servicesbudgetfema
✓ Decided: Council approved intermunicipal agreement with Winchendon for veterans' services

The council approved an order authorizing the city to enter an intermunicipal agreement with the Town of Winchendon to provide veterans' services, passing unanimously (9 yeas). It also amended a zoning ordinance to correct parcel identifiers and referred three separate zoning amendments—adding a commercial overlay on Central Street, creating a historic preservation project provision, and updating the floodplain overlay to meet FEMA requirements—to the Planning Board and Public Welfare Committee for further study and a joint public hearing, each passing with 9 yeas. The council accepted the March 17, 2025 meeting minutes and placed on file two mayoral communications regarding FY2024 financial audit reports, all with unanimous approval.

Thu May 1, 2025

School Subcommittees

School finance subcommittee to review expenses, projects, donations

The Gardner Public Schools Finance Sub-Committee is meeting to discuss routine financial oversight items. The agenda includes approval of previous minutes, expense report review, projects update, and gifts & donations. No specific dollar amounts or action items are listed.

educationfinanceschoolssubcommitteegardner
✓ Decided: Finance Subcommittee approved April 3 minutes and adjourned

The sub‑committee voted to approve the minutes from the April 3, 2025 Finance meeting. After reviewing expense reports, the committee adjourned the session at 5:10 p.m.

Thu May 1, 2025

School Subcommittees

Gardner Public Schools Facilities Sub-Committee to meet May 1

The Facilities Sub-Committee will meet to discuss old business and receive a projects update. The agenda consists of standard procedural items.

schoolsfacilitiesgardner
✓ Decided: Committee approved prior minutes and adjourned the meeting

The Facilities Sub‑Committee made and seconded a motion to approve the March 4, 2025 meeting minutes. A second motion to adjourn was also made, seconded and the meeting was adjourned at 5:25 PM. No other substantive actions were decided.

Wed Apr 30, 2025

Zoning Board

Zoning board to consider special permit for 163-165 Pine Street

The board will conduct a site visit on April 26 for a special permit request by MHG Fund, LLC at 163-165 Pine Street. A violation update is scheduled for April 30. No other items are listed.

zoningspecial-permitsite-visitviolationgardner
Wed Apr 30, 2025

Finance Committee

Finance Committee to consider interlocal pact with Winchendon for veterans services

The Finance Committee will vote on an intermunicipal agreement allowing Winchendon to join Gardner's Veterans Service District for fiscal years 2025–2027, at $2 per population with a 3% increase in FY27. The committee also will discuss proposals to form a special committee for the Waterford Community Center Project, review the city's updated sexual harassment policy, evaluate facilities management for municipal buildings, and receive audit reports on federal grants and FY2024 finances.

financeveterans-servicesintermunicipal-agreementwaterford-community-centersexual-harassment-policyfacilities-managementaudit
✓ Decided: Finance Committee approves intermunicipal veterans agreement and audit file recommendations

The committee voted unanimously to authorize the City Council to enter an intermunicipal agreement with Winchendon for veterans services for FY2025‑2027. It also approved recommendations to place the FY2024 single‑financial‑audit and full‑financial‑audit communications on the council’s file. The three proposals on waterford center, sexual‑harassment policy, and facilities management were kept on the calendar for future discussion.

Mon Apr 28, 2025

Conservation Commission

Commission to hold hearings on Old Duck Pond Dam breach, golf course emergency, and wetlands projects

The Gardner Conservation Commission will vote to approve minutes, discuss an emergency certification for the Municipal Golf Course's failed irrigation intake pipe, and hold several public hearings. Hearings include a proposal to breach Old Duck Pond Dam (444 Green Street), a Notice of Intent for the New England Power transmission line refurbishment, and a single-family home off Betty Spring Rd. The commission will also continue discussion of a contractor building at 170 Mill Street.

wetlandspublic-hearingdam-removaltransmission-linesgolf-courseconservationgardner
✓ Decided: Commission approved Old Duck Pond Dam breach and emergency golf‑course certification

The Conservation Commission approved the minutes from the April 14 meeting. It issued an Emergency Certification for the municipal golf course irrigation pipe failure and gave a negative three determination for the 0 Talcott Avenue project. The commission approved the breach of Old Duck Pond Dam with an Order of Conditions, and continued several pending matters to future meetings.

Mon Apr 28, 2025

Retirement Board

Gardner Retirement Board to discuss administrator contract and legal services RFP

The Contributory Retirement Board will meet to approve financial warrants and review investment statements. The board is scheduled to discuss the Board Administrator's contract renewal and issue requests for proposals for legal services.

retirementcontractsfinancelegal-servicesgovernance
✓ Decided: Board approved $724,490.42 payment warrant

The Gardner Contributory Retirement Board unanimously approved the March and February meeting minutes, the January‑February trial balances and bank reconciliations, and a $724,490.42 payment warrant. It also approved withholding $234.90 from retiree Brian Gemborys' May 2025 payroll, accepted the GASB 67 & 68 draft report, and adopted a legal‑services RFP and a three‑year salary contract for the Board Administrator.

Mon Apr 28, 2025

Board of Health

Gardner Board of Health to discuss draft private well regulations

The Board of Health will review and discuss draft regulations for private wells. The meeting also includes updates on landfill projects and health department inspections.

public-healthwater-regulationslandfillinspections
✓ Decided: Board of Health discussed proposed well regulations; no decisions made

The Board reviewed a draft set of well and water supply regulations, covering purpose, definitions, permit terminology, setback distances, water quantity, quality, construction, and decommissioning requirements. Members discussed language changes, technical details, and enforcement challenges, and agreed further discussion is needed at the next meeting. No formal approvals, rejections, or votes were recorded.

Sat Apr 26, 2025

Zoning Board

Site visit for special permit at 163-165 Pine St and violation update

The Gardner Zoning Board of Appeals will conduct a site visit on April 26 at 9:30 am for a special permit application at 163-165 Pine Street (Case 2022-01-01, MHG Fund, LLC). On April 30 at 10:00 am, the board will discuss a violation update. The meeting spans two days at the same location.

zoningspecial-permitsite-visitviolationsboard-of-appealsgardner
Fri Apr 25, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to review offers for 155 Mill Street

The Gardner Redevelopment Authority will meet to discuss a MassDevelopment loan repayment and review offers for the property at 155 Mill Street. The body will also vote on the approval of minutes from the April 17, 2025 meeting.

redevelopmentreal-estateloansgardner
✓ Decided: Board entered executive session to review offers for 155 Mill Street

The Gardner Redevelopment Authority approved the minutes from the April 17, 2025 meeting by a 5‑0 vote. It unanimously voted to enter an executive session to review offers for 155 Mill Street. The meeting was then adjourned by a 5‑0 vote. No other business was taken.

Thu Apr 24, 2025

Gardner Housing Authority

Housing Authority to review March reports and minutes

The Gardner Housing Authority is holding a regular meeting. Items include approval of March meeting minutes, the Executive Director's report, and the March invoice history report. The agenda is primarily procedural.

housingauthoritymeetingminutesreports
Thu Apr 24, 2025

Bandstand Committee

Bandstand Committee to finalize 2025 concert schedule and discuss contracts

The Gardner Bandstand Committee will meet to approve previous meeting minutes and review correspondence, including finalizing the 2025 concert schedule and discussing related contracts. Financial statements will also be considered. The meeting is open to the public and may be recorded.

concertscontractsparksbandstandgardner-mapublic-works
✓ Decided: Eagles Tribute concert scheduled for Aug 9, 2025 with rain date Aug 10

The Bandstand Committee accepted the minutes from 4/24/2024. They confirmed Dan Kororeac for the Eagles Tribute concert on August 9, 2025, with a rain‑date on August 10, 2025. Members were assigned outreach to sponsors and the sign department to prepare flyers. The meeting was adjourned at 4:00 pm.

Tue Apr 22, 2025

Economic and Community Development Committee

Committee reviews Maki Park investigation report, considers new manager position

The Economic and Community Development Committee will hear a report on the investigation of the Maki Park project, which found ADA compliance failures and that no building permit was obtained. The committee will also discuss appointing an ad-hoc advisory committee for the city's first master plan, hold a discussion on the Regional Planning Commission, and consider an order and ordinance to create an Economic Development and Finance Manager position.

maki-parkada-complianceinvestigationmaster-planeconomic-developmentfinance-managerpersonnel-ordinanceregional-planning
✓ Decided: Committee recommended placing Mayor's master‑plan advisory item on file

The Economic and Community Development Committee voted to recommend item 11514, the mayor's communication about an ad‑hoc advisory committee for the city’s first master plan, be placed on the file. No vote count was recorded. The meeting was then adjourned by a motion of Councilor Heath. No other substantive actions were taken.

Tue Apr 22, 2025

City Council

Council to consider creating Economic Development and Finance Manager position

The City Council will discuss and vote on several items, including an intermunicipal agreement with Winchendon for veterans services, health insurance trust fund updates, fund transfers, donation acceptances, creation of a new Economic Development and Finance Manager position, and appointment of an advisory committee for the city's first master plan.

veteransfinanceeconomic-developmentpersonnelengineeringdonationsmaster-planordinance
✓ Decided: Council approved a five-year contract for on-call engineering services

The City Council approved a five-year contract for on-call engineering services. It referred an intermunicipal veterans services agreement with Winchendon to the Finance Committee, authorized a $282.36 solid‑waste salary payment, transferred $5,000 between appropriations, and approved acceptance of donations for the flowerpot program and the animal‑control shelter. The council also created an Economic Development and Finance Manager position and placed an economic‑development update on file.

Tue Apr 22, 2025

Gardner Cultural Council

Gardner Cultural Council to decide on MCC grant appeals and fund allotments

The Gardner Cultural Council will review appeals from denied Massachusetts Cultural Council (MCC) applicants, decide on the allotment of remaining funds to other applicants, and schedule the release of those funds. This meeting addresses the distribution of state cultural grants to local organizations and individuals.

cultural-councilgrantsfundingappealsmassachusetts-cultural-councilgardner
Tue Apr 22, 2025

Board of Assessors

Board to vote on FY25 exemption applications in executive session

The Board will review and approve March meeting minutes and hear an update on state-approved forms and Vision's review of LA3 sales data. The main item is entering executive session to discuss, approve, or deny FY25 exemption applications. No further open session is planned after the executive session.

assessorsexemptionsexecutive-sessionfy2025property-taxveteranssales-data
✓ Decided: Board approves prior minutes, moves to executive session, and OKs exemptions

The Board of Assessors accepted the March 25, 2025 minutes with a 2‑0 vote. It then voted 2‑0 to enter executive session and not return to the open session. The board approved FY25 Clause 22E exemptions and the FY25 Clause 22A‑F exemption. It also approved the submission of Veterans and MDM‑1 exemption reimbursement forms to the State.

Fri Apr 18, 2025

Community Development Block Grant Steering Committee

CDBG Steering Committee to review FY25 application and hear project updates

The committee will discuss the submitted FY25 CDBG application and receive updates on FY22/23 and FY24 grant projects, including demolitions and social services. A public hearing is scheduled for this meeting.

community-developmentblock-grantpublic-hearingdemolitionhousingsocial-servicesgardner
✓ Decided: Committee gave project updates; no substantive votes taken

The meeting was informational only, with no votes on any proposals. Updates were provided on the FY25 CDBG application, FY22/23 project status, and FY24 grant activities. A motion to adjourn was made, seconded, and carried, ending the meeting at 9:03 a.m.

Thu Apr 17, 2025

Gardner Redevelopment Authority

Authority reviews offers for 155 Mill Street property

The Gardner Redevelopment Authority will review purchase offers for the 155 Mill Street property, discuss a MassDevelopment loan repayment, and consider sponsoring the Gardner Chamber annual meeting. The board will also vote to approve meeting minutes from April 2, 2025.

redevelopmentproperty-saleloansfinanceminutessponsorship
✓ Decided: GRA approves minutes, retains loan issue, and enters executive session

The Gardner Redevelopment Authority unanimously approved the April 2 minutes. It voted to keep the MassDevelopment loan repayment item on the docket. The board entered an executive session to review offers for 155 Mill Street, also unanimously. The meeting was then adjourned unanimously.

Wed Apr 16, 2025

Public Welfare Committee

Committee to consider adding Winchendon to Gardner's veterans service district

The Gardner Public Welfare Committee will discuss and potentially vote on a measure authorizing an intermunicipal agreement with the Town of Winchendon for veterans services for FY2025 through FY2027. The city currently provides these services to several other towns and would charge Winchendon $2 per capita, with no additional staff needed.

veteransintermunicipal-agreementpublic-welfaregardnerwinchendon
✓ Decided: Committee voted to forward Winchendon veteran services agreement to full council

The Public Welfare Committee considered a measure to authorize an intermunicipal agreement with the Town of Winchendon for veteran services for FY2025‑2027. Councilors moved and seconded a motion to have the agreement presented to the full City Council for approval. The motion passed with three yeas. The meeting was then adjourned.

Wed Apr 16, 2025

Finance Committee

Finance Committee to discuss 5-year engineering contract, salary study, and health insurance

The Committee will consider several orders including a prior-year salary payment of $282.36 for a transfer station monitor, a $10,000 transfer for a contract hire, acceptance of donations for the Flower Pot Program and Animal Shelter, and authorization of a five-year contract for on-call engineering services. The committee will also discuss the ongoing salary study review, the city's health insurance trust fund (with $1.7 million reported), a memorial committee report, and proposals to create a special committee for the Waterford Community Center project, review the sexual harassment policy, and assess facilities management.

financebudgetcontractssalary-studyhealth-insurancecommunity-centerfacilitiesengineering
✓ Decided: Finance Committee approved a five‑year on‑call engineering contract

The committee unanimously approved several financial actions, including a $282.36 prior‑year salary payment, a $5,000 appropriation transfer, and acceptance of donations for the flower‑pot program and animal shelter. It also authorized a five‑year on‑call engineering services contract. Additional procedural motions were passed, such as waiving the reading of March 12 minutes and keeping the health‑insurance item on the agenda.

Wed Apr 16, 2025

Planning Board

Planning Board to consider zoning amendment for historical properties

The Gardner Planning Board will continue a public hearing on April 16, 2025, to review City Council Item 11506, a proposed Zoning Ordinance Amendment for historical properties submitted by Chair City Church. The board will discuss and potentially vote on the amendment. The public is invited to attend.

zoningplanning-boardhistorical-propertiespublic-hearingordinance-amendment
✓ Decided: Planning Board recommends City Council adopt historic preservation zoning amendment

The Gardner Planning Board held a public hearing on a proposed amendment to the zoning ordinance to create a Historic Preservation Project provision. The board voted unanimously to close the hearing, to recommend that the City Council accept the ordinance as presented, and then adjourned. No other actions were taken.

Wed Apr 16, 2025

Planning Board

Planning Board to review zoning amendment for historic preservation projects

The Planning Board will continue a public meeting to review City Council Item 11506. This proposed zoning amendment would create a new 'Historic Preservation Project' section and modify parking and loading standards.

zoninghistoric-preservationparkingcity-ordinance
✓ Decided: Planning Board recommends City Council adopt historic preservation amendment

The Planning Board held a public hearing on an amendment to the Zoning Ordinance to add a Historic Preservation Project section. The board voted unanimously to close the hearing, to recommend that the City Council accept the ordinance as presented, and then adjourned the meeting.

Wed Apr 16, 2025

Capital Improvement Committee

Gardner committee to review $2.5M in Public Works vehicle replacements

The Capital Improvement Committee is reviewing 14 project requests from the Public Works Department for FY2026-2030, totaling over $2.5 million. The requests focus on replacing aging dump trucks, plows, and other equipment, with several items marked as emergency or high priority. The committee will discuss and prioritize these capital investments for the city's five-year plan.

public-worksvehiclescapital-improvementsbudgetgardner
Wed Apr 16, 2025

School Subcommittees

Gardner Public Schools Policy Subcommittee to review school committee policies

The Policy Subcommittee will meet to review a series of administrative policies. These include guidelines for background checks, officer duties, and the conduct of school committee meetings.

educationpolicy-reviewschool-committeegovernance
✓ Decided: Subcommittee approved sending multiple policy revisions to May full School Committee

The subcommittee unanimously approved the minutes from the March 12 policy meeting. It tabled Policy BE – School Committee Meetings for further review at the May subcommittee meeting. It voted to forward several revised policies—including background checks, officer duties, executive sessions, meeting notifications, agenda, voting method, and public comment—to the May full School Committee for a first read.

Tue Apr 15, 2025

Zoning Board

Zoning Board to decide on three-family at 75 Oak St. and multi-family at 0 Emerald St.

The Zoning Board of Appeals holds public hearings on two housing proposals: converting an existing building at 75 Oak Street to a three-family dwelling and constructing two multi-family dwellings at 0 Emerald Street. The board will also consider comments and correspondence and approve minutes from prior meetings.

zoningpublic-hearingmulti-familyhousinggardnerboard-of-appeals
✓ Decided: Zoning Board discussed special permit updates but made no decisions

The board reviewed the special permit for 163‑165 Pine Street, including parking modifications and compliance issues. Members asked for clarification on parking dimensions, accessibility, and easement details. No vote or formal decision was recorded during the meeting.

Tue Apr 15, 2025

Historical Commission

Historical Commission to discuss Old Burying Ground restoration and Historic Preservation Zoning Amendment

The Gardner Historical Commission meets to approve March 18, 2025 minutes and discuss administrative updates, including FY2026 budget and commission rules. Project updates include restoration of the Old Burying Ground, documentation of artifacts, and a zoning amendment for 100 Central Street. No votes or decisions are scheduled; items are for discussion only.

historical-commissionpreservationzoningartifactsburying-groundcity-hallschoolsbudget
✓ Decided: Commission adopts rule changes and backs historic preservation zoning amendment

The Gardner Historical Commission approved amendments to its Rules and Regulations, including revising the introductory purpose statement and removing the 75‑year age requirement for a historic structure. It voted to have the clerk draft correspondence to Gardner High School outlining concerns about several school artifacts. The commission endorsed the proposed Historic Preservation Zoning Amendment and will present testimony to the Planning Board. Members also agreed to pursue recruitment of additional commission members.

Mon Apr 14, 2025

Conservation Commission

Conservation Commission to hold hearing on engineered breach of Old Duck Pond Dam

The Conservation Commission will vote on minutes from prior meetings and discuss enforcement orders at three properties. The main business is a series of public hearings on wetland-related projects, including a tree removal request at 125 Snake Pond Road, a single-family home at Betty Spring Rd, a transmission line refurbishment, a gravel pit stabilization at Ebenezer Keyes Conservation Area, and the engineered breach of Old Duck Pond Dam at 444 Green Street. The Commission will also take up new business items such as utility maintenance notifications and a fire runoff issue at 549 West Broadway.

conservationwetlandshearingsdamtransmission-lineenforcementminutespublic-hearing
✓ Decided: Commission approved emergency certification for Heritage Village sewage overflow

The Conservation Commission approved the emergency certification for the March 27 sewage overflow at Heritage Village with a 6‑0 vote. It also approved the minutes from four prior meetings. Several enforcement orders and pending permit items were postponed to the April 28 meeting.

Mon Apr 14, 2025

School Committee

School Committee to vote on FY26 budget of $37.7 million after public hearing

The Gardner School Committee will hold a public hearing on the proposed FY26 school budget, then vote on a $37,676,548 level-services budget. The committee also plans to vote on policy adoptions (including physical restraints), appointments to the Keystone and CAPS Collaboratives, and ratification of four warrants totaling $1,324,865.74.

school-budgetpublic-hearingpolicieswarrantsspecial-educationcollaborative-appointmentsschool-committee
✓ Decided: School Committee approved FY 2026 budget of $37.68 M

The Gardner School Committee unanimously approved the FY 2026 school budget of $37,676,548. It also accepted the consent agenda items, approved several policy actions, appointed Superintendent Mark Pellegrino to two collaborative boards, and adopted the CAPS agreement and new competency standards. All votes were recorded as "so voted" or unanimous.

Fri Apr 11, 2025

Development Review Committee

Committee to review 23-lot residential subdivision on Pearl Street

The Development Review Committee will consider a preliminary site plan for a residential project on Pearl Street. The proposal involves a 23-lot subdivision with three units in each building.

zoninghousingsubdivisionresidential-development
✓ Decided: Development Review Committee adjourned the meeting unanimously

The Gardner Development Review Committee met on April 11, 2025 to discuss a proposed 23‑lot subdivision on Pearl Street. Committee members asked questions about road access, fire safety, water and sewer, wetlands, and unit sizes, but no approvals or actions were taken. The meeting was adjourned with a 6‑0 vote.

Wed Apr 9, 2025

Gardner Cultural Council

Gardner Cultural Council to decide allotment of MCC grants and review appeals

The Gardner Cultural Council will meet to review appeals from denied Massachusetts Cultural Council (MCC) applicants, decide how to allocate funds to remaining applicants, and set a schedule for releasing those funds. No other substantive business is listed.

cultural-councilgrantsmccfundingappealsgardner
Wed Apr 9, 2025

Disability Commission

Disability Commission to discuss barriers to health and wellness, and alignment with Heywood Hospital's DEI Committee

The Gardner Disability Commission will hold a meeting on April 9, 2025, featuring guest presentations on health and wellness barriers and a potential re-alignment with Heywood Healthcare's DEI Committee. The commission will also review and approve minutes from March 12, discuss the Health and Wellness Fair, and plan event promotion and ADA 35th anniversary activities.

disabilityhealthwellnessdeiadacommissiongardner
Tue Apr 8, 2025

Planning Board

Planning Board to review zoning amendment, two site plans

The Planning Board will hold a public meeting to review a proposed zoning amendment for Historic Preservation Projects (Item 11506) and consider two definitive site plans: a multi-family residential development on Emerald Street and a self-storage facility on Manca Drive. Updates to the Floodplain Overlay District Ordinance are also on the agenda. The board will vote on approvals or continue discussions.

planning-boardzoningsite-planhistoric-preservationmulti-family-housingself-storagefloodplain
✓ Decided: Board postponed floodplain ordinance updates for a public hearing

The Planning Board approved the March 11, 2025 meeting minutes. It voted to continue discussion of the Floodplain Overlay District Ordinance at the next meeting as a public hearing. The board then adjourned the session.

Tue Apr 8, 2025

Planning Board

Public hearing on zoning amendment for historical properties and two development projects

The Gardner Planning Board will hold a public hearing to consider three items: a proposed multi-family home on Emerald Street, a proposed self-storage facility on Manca Drive, and a zoning ordinance amendment for historical properties submitted by Chair City Church. The board will review the definitive site plans and the proposed ordinance change, with opportunity for public comment.

planning-boardpublic-hearingzoninghistorical-propertiesmulti-familyself-storagesite-plan-review
✓ Decided: Planning Board votes 4-0 to suspend hearings and reschedule zoning amendment

The Gardner Planning Board voted unanimously to suspend the public hearing on the Emerald Street multifamily site. It also suspended the hearing on the West Mini Storage site. Finally, the board rescheduled the public hearing on Zoning Amendment Item 11506 to April 16 at 6:30 p.m.

Tue Apr 8, 2025

License Commission

Board considers request for new liquor store at Timpany Plaza

The Gardner License Commission will hear a transfer of license for Sawa Asian Cuisine and special one-day licenses for Ftiness Concepts. Old business includes updates on the Gardner Elks' manager change, approval of a new all-alcoholic license for Four Seasons Chinese Cuisine, and a pending manager change for the Lithuanian Outing Association. New business includes a request from Seth Simonian for an additional off-premises liquor license to open a store at Timpany Plaza, and the appointment of a new clerk.

license-commissionliquor-licensestransfersspecial-permitsnew-businessgardner
✓ Decided: License Commission approves multiple licenses and appoints new clerk

The commission approved the February 11, 2025 meeting minutes. It approved a license transfer for Sawa Asian Cuisine and Lounge, two special‑day licenses for Fitness Concepts, and seasonal renewals for PACC, Lithuanian Outing and Zoe’s on the Green, all pending satisfactory inspections. The commission also appointed Brandi Caisse as the new License Commission clerk.

Mon Apr 7, 2025

Golf Commission

Golf Commission to review financials and approve past meeting minutes

The Gardner Golf Commission will meet to approve minutes from December 2024 and March 2025, hear updates from the pro manager and superintendent, and review and approve financial reports. No major decisions or public hearings are scheduled; the agenda is largely procedural.

golfcommissionminutesfinance
✓ Decided: Commission approved minutes and water bill discussion, all votes unanimous

The Golf Commission approved the March 10, 2025 minutes and tabled the December 16, 2025 minutes, each with a 5‑0 vote. A motion to approve the discussion of the upcoming water bill was also passed unanimously. The meeting was then adjourned with a 5‑0 vote.

Mon Apr 7, 2025

City Council

City Council to consider opposition to Building Department fee increases

The City Council will discuss a resolution opposing proposed Building Department fee increases. The body will also consider several mayoral appointments to city boards and a motor vehicle dealer license application.

feesappointmentslicensingzoningpublic-health
✓ Decided: Council adopts resolution opposing proposed building permit fee hikes

The City Council voted 8-2 to adopt a resolution expressing disapproval of the Building Commissioner’s proposed permit fee increases. It also approved an informal meeting with MART Transportation Services and granted a Class II motor vehicle dealer license to MTM Auto at 207 E Broadway, each by unanimous 10‑yea votes. The council waived and accepted the minutes from the February 3, 2025 meeting with a 10‑yea vote. Additionally, the council confirmed four mayoral appointments to the Zoning Board, Planning Board, Conservation Commission, and Board of Health, all by unanimous 10‑yea votes.

Mon Apr 7, 2025

Finance Committee

Finance Committee to consider resolution opposing building fee hikes

The Finance Committee will review and approve meeting minutes from February and consider several new items, including a resolution opposing proposed Building Department fee increases. They will also discuss proposals to create a special committee for the Waterford Community Center Project, review the city's sexual harassment policy, and assess facilities management. Ongoing discussions include a salary study review and the city's health insurance trust fund.

financefeescommunity-centerharassment-policyfacilitiessalary-studyhealth-insurance
✓ Decided: Finance Committee recommends full Council discuss building fee increase disapproval

The committee waived reading and accepted the February 12 and February 26 Finance Committee minutes (2 yeas, motion passed). It voted to recommend that the full City Council discuss and review the resolution opposing the proposed Building Department fee increases (2 yeas, motion passed). The committee also agreed to keep the health‑insurance trust fund item and the Ronald F. Cormier Memorial Committee report on the agenda, and then adjourned the meeting.

Fri Apr 4, 2025

Economic and Community Development Committee

Committee to consider new Economic Development and Finance Manager position, $75K

The committee will discuss two items: a proposed order to create an Economic Development and Finance Manager in the Community Development and Planning Department and an ordinance to add the position to the non-union compensation schedule at $75,000 annually. It will also receive and discuss a report on the investigation of the Maki Park Project, which found ADA compliance failures and that no building permit was obtained for construction.

economic-developmentfinance-managerpersonnelmaki-parkada-compliancebuilding-permitcity-council-committeecommunity-development
✓ Decided: Committee voted to keep the new Economic Development Manager position on the agenda

The Economic and Community Development Committee approved motions to keep three items—11510 (creation of an Economic Development and Finance Manager), 11511 (ordinance to amend the personnel code for that position), and 11454 (report on the Maki Park Project investigation)—on its agenda for future consideration. A separate motion to adjourn the meeting was also approved.

Thu Apr 3, 2025

School Subcommittees

Gardner School Finance Subcommittee to review FY26 budget sheets

The Gardner Public Schools Finance Sub-Committee will meet to review the FY26 budget sheets, along with expense reports, project updates, and gifts and donations. The meeting includes approval of previous minutes and new business discussion.

schoolsfinancebudgetpublic-schools
✓ Decided: Finance Subcommittee approved March 4 meeting minutes

The subcommittee approved the minutes from the March 4, 2025 Finance Subcommittee meeting. Members discussed a higher‑than‑normal occurrence of plumbing and elevator repairs and reviewed the current budget deficit driven by indirect costs, especially health insurance. Project updates were given on the GHS Auditorium Phase II completion and a proposed elevator overhaul. The meeting was adjourned.

Wed Apr 2, 2025

Airport Commission

Airport Commission to discuss runway and master plan updates

The Gardner Municipal Airport Commission will review updates on runway improvements and the master plan, along with lease reviews and budget items. The meeting also includes approval of prior minutes and reports from the airport manager.

airportcommissionrunwaymaster-planbudgetleases
✓ Decided: Commission unanimously accepted $221,400 fee and forwarded grant application

The commission approved the minutes from the March 5, 2025 meeting. It voted unanimously to accept Gale Associates' fee of $221,400 for the environmental assessment and obstruction study and to forward the grant application to Mayor Nicholson for final funding approval. No other substantive actions were decided at this meeting.

Wed Apr 2, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to consider contract renewal and loan repayment

The Gardner Redevelopment Authority will vote on approving the minutes from February 28, 2025, and discuss old business including the Rear Main Project under the Urban Renewal Plan. New business items include a MassDevelopment loan repayment update and a broker services update from Tracy Sladen.

redevelopmenturban-renewalindustrial-parkcontractsloans
✓ Decided: Approved steps to repay $172,179.59 MassDevelopment loan

The Authority approved the February 28 minutes and the IDFA meeting notes. It voted to keep the Rear Main Project on the docket, sign the contract with Lewis Property Care, add three vacant Summit Industrial Park parcels to Tracy Salden's inventory, and move toward repayment of the $172,179.59 MassDevelopment loan. The board also postponed discussion of broker services to the next meeting and adjourned.

Tue Apr 1, 2025

Appointments Committee

Appointments Committee to interview four mayoral picks for city boards

The Appointments Committee will interview and discuss the mayor's appointments of Laurie Wiita to the Zoning Board (term expiring Jan 22, 2028), Eric Flint to the Planning Board (term expiring Jan 7, 2028), Nicholas Summerhayes to the Conservation Commission (term expiring Feb 13, 2028), and Emma Chaitin to the Board of Health (term expiring Feb 27, 2028). The committee will also read prior meeting minutes. These appointments require City Council confirmation.

appointmentszoning-boardplanning-boardconservation-commissionboard-of-healthcity-councilgardner
✓ Decided: Committee recommends four mayoral appointments to city council

The Appointments Committee interviewed four mayoral appointees and voted to recommend each appointment to the full council. The recommended positions are Zoning Board member Laurie Wiita, Planning Board member Eric Flint, Conservation Commission member Nicholas Summerhayes, and Board of Health member Emma Chaitin. The committee also reported two staff resignations and adjourned at 6:12 p.m.

Fri Mar 28, 2025

Public Safety Committee

Request to hold informal meeting with MART on rider and pedestrian safety

The Public Safety Committee will consider a request from Councillor Karen Hardern to hold an informal meeting with the Montachusett Regional Transit Authority (MART) to discuss rider and pedestrian safety and route utilization. The committee will also review an application for a Class II motor vehicle dealers license for MTM Auto at 207 E Broadway. Department head updates from police, building, fire, and public health are scheduled.

public-safetytransitmotor-vehicle-dealersmeetingsgardner
✓ Decided: Committee waived prior minutes and approved Shannon grant, EOC kitchen, and cabinet program

The Public Safety Committee voted 3‑yeas to waive the reading and accept the minutes from December 6 and December 16, 2024. The committee also approved the renewal of the $47,000 Shannon grant, the Emergency Operations Center kitchen project, and the Monty Tech cabinet‑making program for students. No other motions were recorded.

Thu Mar 27, 2025

Gardner Housing Authority

Gardner Housing Authority holds routine meeting with reports and minutes

The Gardner Housing Authority is meeting for a regular session to approve minutes from previous meetings, receive the Executive Director's report, and review the invoice history report. No major decisions or public hearings are scheduled; the agenda consists primarily of administrative and procedural items.

housingauthoritymeetingminutesreportsadministrative
Wed Mar 26, 2025

Gardner Redevelopment Authority

Gardner Redevelopment Authority to discuss Urban Renewal and contract renewals

The Authority will review the Rear Main Project and Summit Industrial Park as part of the Urban Renewal Plan. Members will also discuss the renewal of a contract with Lewis Property Care and loan repayments to MassDevelopment.

urban-renewaleconomic-developmentcontractsloans
Wed Mar 26, 2025

Retirement Board

Retirement Board to decide on FY2026 COLA adjustment

The Gardner Contributory Retirement Board will meet on March 26, 2025, to approve minutes and warrants, review investments, and take action on a Cost of Living Adjustment (COLA) for Fiscal Year 2026. The board will also consider retirements and acknowledge deceased members.

retirement-boardcolapensionscity-hallfinance
✓ Decided: Board approved a 3.0% cost‑of‑living adjustment for FY 2026

The board unanimously approved the February 2025 meeting minutes and a $946,078.31 warrant. It also adopted a 3.0% cost‑of‑living adjustment for FY 2026. The board accepted the PERAC annual statement and the board’s 2024 annual report, and granted permission for members to attend the MACRS Spring Conference.

Tue Mar 25, 2025

Board of Assessors

Board to sign 2025 Excise Tax Commitment 2 warrant

The Board of Assessors will review and sign the 2025 Excise Tax Commitment 2 warrant, along with approving prior meeting minutes. An assessor update covers mailed notices for income/expense, supplemental bills, building permits, personal property data, and motor vehicle excise. In executive session, the board will discuss, review, and approve or deny FY25 exemption applications and real estate/personal property abatements.

assessorsexcise-taxproperty-taxabatementsexemptionsexecutive-sessionminutestax-warrant
✓ Decided: Board approved minutes, entered executive session, and ruled on FY25 exemptions

The Board accepted the March 12, 2025 minutes with a 3‑0 vote. A motion to go into executive session was passed unanimously (3‑0). The Board reviewed and decided on several FY25 exemptions, approving three Clause 22 exemptions and one real‑estate abatement request, while denying one Clause 22 exemption, two Clause 17D exemptions, and four real‑estate abatement requests.

Mon Mar 24, 2025

Board of Health

Board of Health to review private well regulations

The Board of Health will discuss whether to adopt Massachusetts Model Regulations for Private Wells or maintain current local regulations. The board will also receive updates on groundwater monitoring and leachate systems.

public-healthwater-qualitywellsenvironmental-monitoring
✓ Decided: Board tables discussion on new private well regulations

The Board of Health voted to table further discussion of the updated private‑well regulations until the next meeting. A motion to accept the January 27, 2025 minutes with corrections was approved. The board considered a public‑comment policy but made no change, and adjourned the meeting.

Mon Mar 24, 2025

Conservation Commission

Gardner Conservation Commission to review dam breach, transmission line, and housing projects

The Gardner Conservation Commission will hold a public meeting and joint public hearings under the Wetlands Protection Act and city ordinance. Items include a Request for Determination of Applicability for tree removal at 125 Snake Pond Road, Notices of Intent for a new home off Betty Spring Road, a transmission line refurbishment by New England Power, and an engineered dam breach at Old Duck Pond Dam. The commission will also consider an amendment for a gravel pit stabilization project at Ebenezer Keyes Conservation Area and continue a previous hearing for a contractor building at 170 Mill Street.

wetlandsconservation-commissionpublic-hearingnotice-of-intentwetlands-protectiondamtransmission-linehousing
✓ Decided: Commission voted 6-0 to postpone all pending items to April meetings

The Gardner Conservation Commission unanimously voted to continue discussion of several enforcement orders and pending public hearings, moving them to future meetings in April. Items were set for either the April 14 or April 28 meeting, with no approvals or denials made at this session.

Fri Mar 21, 2025

Public Welfare Committee

Public Welfare Committee to hear Montachusett Vocational Technical School budget

The Public Welfare Committee will meet to receive a budget presentation for the 2026 fiscal year from the Montachusett Vocational Technical School. The committee will also review minutes from a previous meeting.

budgeteducationvocational-school
✓ Decided: Public Welfare Committee accepted prior minutes and adjourned the meeting

The committee waived the reading and approved the minutes from the December 12, 2024 meeting. A FY2026 budget presentation for Montachusett Vocational Technical School was delivered. The meeting was then adjourned at 9:24 a.m.

Fri Mar 21, 2025

Community Development Block Grant Steering Committee

CDBG Steering Committee to hear updates on pool pavilion, Main Street demolition, social services

The Community Development Block Grant Steering Committee is holding a public hearing to discuss updates on FY22/23 projects, including demolition of Greenwood Pool and construction of an outdoor pavilion, demolition of 213/215 Main Street, and social services. The committee will also review FY24 grant updates and FY25 application updates.

community-development-block-grantpublic-hearinghousingparksdemolitionsocial-services
Tue Mar 18, 2025

Zoning Board

Zoning Board to hear requests for residential changes and dimensional relief

The Zoning Board of Appeals will hold public hearings on four cases involving special permits and variances. These include requests to change residential density and obtain relief from setback and dimensional requirements.

zoningvarianceshousingpublic-hearings
✓ Decided: ZBA approves two variances, continues Pine Street parking violation case

The Gardner Zoning Board of Appeals approved a variance for two egresses at 108 Grant Street and a variance for a single-family home at 68 Acadia Road. The board continued the special permit violation case for 163-165 Pine Street to next month, requesting more information. A special permit case for 75 Oak Street was continued to April as previously scheduled.

Tue Mar 18, 2025

Historical Commission

Historical Commission to discuss FY2026 budget and zoning amendment

The Gardner Historical Commission will discuss administrative updates, including the FY2026 budget and commission rules, and review several preservation projects such as the Old Burying Ground restoration and artifacts from city hall and former schools. A proposed historic preservation zoning amendment at 100 Central Street will also be discussed.

historical-commissionpreservationbudgetzoningartifactsburying-groundschools
✓ Decided: Gardner Historical Commission amends draft rules, approves prior minutes

The Gardner Historical Commission voted to accept the February 18, 2025 meeting minutes as amended. The Commission agreed to several amendments to its draft Rules and Regulations, including adding the full text of MGL c. 40, § 8D to Section 1, revising the Chair Pro-tem provision, and defining 'Historic Structure.' The Clerk will revise the draft for review at the April meeting. No other formal votes were taken; other items were informational or postponed.

Mon Mar 17, 2025

City Council

Council to vote on eminent domain takings for Elm Street sidewalk project

The City Council is deciding on multiple orders of taking by eminent domain to acquire easements along Elm Street for the Safe Routes to School sidewalk improvement project. The council will also consider creating a new Economic Development and Finance Manager position and confirm several mayoral appointments, including a City Engineer and members of the Council on Aging. Additionally, the council will vote on a resolution supporting the city's application for a FY2025 Community Development Block Grant.

transportationsidewalkseminent-domainappointmentspersonnelcommunity-developmentgrants
✓ Decided: Council approves eminent domain takings for Safe Routes to School project

The Gardner City Council approved an order of taking for easements by eminent domain for the Safe Routes to School Project on Elm Street, with a 9-0 vote (one councilor recused). The council also designated Attorney Christine Tree as a Special Municipal Employee to handle the related property matter, and confirmed several mayoral appointments including a new City Engineer. Two items creating an Economic Development and Finance Manager position were referred to committee for further study.

Mon Mar 17, 2025

Appointments Committee

Committee to interview and vote on four mayoral appointments

The Appointments Committee will interview candidates and discuss confirming the Mayor's appointments for one Veterans' Agent and three Council on Aging members, all with terms through January 2028.

appointmentsveteranscouncil-on-agingcity-councilmayoral-appointments
✓ Decided: Appointments Committee recommends four mayor's appointees to full council

The Appointments Committee voted to recommend all four of Mayor Nicholson's appointments to the full council: Corey Hasselman as Veterans' Agent, and Ron Darmetka, Paul Leone, and Paul Crowley as Council on Aging members. All terms expire January 16, 2028. No other business was conducted.

Fri Mar 14, 2025

Economic and Community Development Committee

Committee reviews investigation into Maki Park project non-compliance

The Economic and Community Development Committee will receive a department update and discuss a report on the investigation into the Maki Park project, which found that the completed park lacks ADA compliance. They will also consider an ordinance to require the Community Development Block Grant Steering Committee to meet monthly and a resolution supporting the city's FY2025 CDBG Mini-Entitlement Plan application.

community-developmenteconomic-developmentparksada-compliancecdbgordinanceresolution
✓ Decided: Committee recommends CDBG Mini Entitlement Plan to City Council

The Economic and Community Development Committee voted 3-0 to recommend a resolution supporting the City's FY2025 Community Development Block Grant Mini Entitlement Plan to the City Council. The committee also voted to remove a proposed ordinance on CDBG Steering Committee meetings from the calendar, and granted more time for the Maki Park project investigation. Department updates were provided on several projects.

Thu Mar 13, 2025

Gardner Housing Authority

Board to review Comprehensive Modernization funding notice

The Gardner Housing Authority will hold a special meeting to review the Comprehensive Modernization NOFA (PHN 2025-02). This is a discussion item; no votes or decisions are listed on the agenda beyond opening and adjourning the meeting.

housingmodernizationfundingpublic-housing
Wed Mar 12, 2025

Finance Committee

Finance Committee to consider new Economic Development and Finance Manager position

The Finance Committee will discuss the creation and compensation of an Economic Development and Finance Manager position. The body will also review a salary study and health insurance trust fund payments. Additionally, the committee will consider eminent domain orders for the Safe Routes to School Project on Elm Street.

personneleconomic-developmenteminent-domainroadsbudget
✓ Decided: Finance Committee recommends creating Economic Development and Finance Manager position

The Finance Committee voted to recommend creating a new Economic Development and Finance Manager position for the Community Development and Planning Department, merging the Economic Development Coordinator and Budget Project Manager roles. It also recommended an ordinance to add the position to the non-union compensation schedule with a total annual salary of $75,000. The committee kept several items on the agenda for further review, including the memorial plaque and health insurance updates, and recommended orders of taking for the Safe Routes to School project.

Wed Mar 12, 2025

Disability Commission

Disability Commission to discuss Maki Park repairs and accessibility issues

The Gardner Disability Commission will review its January 8 meeting minutes and discuss old business including the repair plan for Maki Park. New business items include the Health and Wellness Fair, post office accessibility, a survey of parking spaces, and a review of snow removal accommodations for disabilities per MOD guidelines.

disability-commissionaccessibilityparksparkingsnow-removalpost-office
✓ Decided: Disability Commission approves January minutes, discusses Maki Park repairs

The Gardner Disability Commission unanimously approved the January 8, 2025 meeting minutes. They received an update on the Maki Park repair project, with permits applied for and reviewed. The commission also discussed participation in the Health and Wellness Fair, post office accessibility, accessible parking surveys, and snow removal guidelines from the Massachusetts Office on Disabilities.

Wed Mar 12, 2025

Board of Assessors

Board of Assessors to review FY25 tax exemptions and abatements

The Board of Assessors will meet to approve meeting minutes and receive updates on map changes and Income & Expense Forms. The board will enter an executive session to decide on FY25 exemption applications and real estate and personal property abatements.

taxesassessmentsexemptionsabatements
✓ Decided: Board approves FY25 tax exemptions, denies one

The Board of Assessors approved the minutes from February 20, 2025, and received updates on map changes and supplemental tax bills. In executive session, the board approved two FY25 Clause 22E/22 exemptions and denied one Clause 22 exemption. Five real estate abatements remain pending due to missing information.

Wed Mar 12, 2025

School Subcommittees

Gardner Policy Subcommittee to review school committee and background check policies

The Policy Subcommittee will meet to review several district policies. Discussions will focus on school committee member authority, qualifications, and background check procedures.

educationschool-policygovernancebackground-checks
✓ Decided: School policy subcommittee advances 6 policy changes to full committee

The Gardner School Policy Subcommittee reviewed multiple policies, approving three as 'Reviewed March 2025' with no changes, tabling three for further review, and recommending six policies for first read at the April full School Committee meeting. The subcommittee also recommended moving the Athletic Council policy to the procedure manual.

Wed Mar 12, 2025

Appointments Committee

Appointments Committee to interview and discuss five mayoral appointments

The Appointments Committee will interview two appointees for City Engineer and Veterans' Agent, then discuss confirmation of all five appointments including three Council on Aging members. All terms expire January 16, 2028.

appointmentscity-engineerveteranscouncil-on-aginggardner
✓ Decided: Committee recommends Robert Oliva as City Engineer

The Appointments Committee voted to recommend Robert Oliva's appointment as City Engineer to the full Council. The committee requested more time on four other appointments (Corey Hasselman, Ron G. Darmetka, Paul Leone, Paul Crowley) pending writeups from the Mayor. Resignations and new hires in several departments were reported.

Tue Mar 11, 2025

Planning Board

Planning Board to review proposed self-storage facility on Manca Drive

The Gardner Planning Board will discuss a proposed self-storage facility and a zoning amendment for a historical preservation project. The board will also address a technical amendment regarding the Compass Lane Subdivision.

zoningland-usehistorical-preservationsubdivision
✓ Decided: Planning Board continues Manca Drive self-storage to public hearing

The Planning Board voted 3-0 to continue the proposed West Mini Storage facility on Manca Drive to a public hearing, after reviewing plans for 7 buildings with 169 units. The board also voted 3-0 to schedule a public hearing for April 22, 2025, on a zoning amendment for a historical preservation project. Additionally, the board approved an amendment to the Compass Lane Subdivision restrictive covenant and consultant provision.

Mon Mar 10, 2025

Golf Commission

Golf Commission to elect officers, review financials

The Golf Commission will consider approving past meeting minutes, elect officers, receive updates from the pro manager and superintendent, and review financials and expense reports. The agenda is largely procedural with no specific new business items listed.

golfcommissionmeetingfinancialsofficers
✓ Decided: Golf Commission elects officers, approves financials showing small loss

The Gardner Golf Commission elected Jeff Gallant as Chairman, Alek Dernalowicz as Assistant Financial Chair, and Mike Budwick as Secretary, all by 4-0 votes. They approved the financial report showing total revenue of $771,000 and expenses of $774,000, a small loss of about $3,000. The commission also accepted the January 27, 2025 minutes and tabled the December 16, 2025 minutes.

Mon Mar 10, 2025

School Committee

Gardner School Committee to vote on policies, school improvement plans, and field trips

The committee will hold a second reading and vote on several policies, including non-discrimination, harassment, school committee powers, background checks, and residency proof. It will also vote on school improvement plans for Gardner High School, Gardner Academy, Gardner Middle School, and Gardner Elementary School. Overnight and day field trips for middle and high school students require approval. Informational updates on kindergarten registration, curriculum, grants, and special education will be presented.

school-committeepoliciesschool-improvementfield-tripsbudgetnon-discriminationbackground-checkskindergarten-registration
✓ Decided: School Committee approves policies, school improvement plans, and four field trips

The Gardner School Committee approved a consent agenda including minutes and five warrants totaling about $1.55 million, with Mayor Nicholson abstaining. It adopted seven policies on a second reading, approved School Improvement Plans for all four schools, and approved four field trips for Gardner Middle and High Schools. The committee also heard reports on facilities, finances, and student activities, and received updates on kindergarten registration and superintendent goals.

Mon Mar 10, 2025

Conservation Commission

Commission to hold hearing on Greenwood Memorial Pool demolition and pavilion construction

The Gardner Conservation Commission will hold public hearings on several wetland-related projects, including the demolition of Greenwood Memorial Pool, a transmission line refurbishment, a new home on Betty Spring Road, and tree removal at Snake Pond Road. They will also vote on past minutes, discuss enforcement orders, and debrief a professional conference.

wetlandsconservation-commissionpublic-hearinggreenwood-pooltransmission-linetree-removalconstruction
✓ Decided: Conservation Commission approves Greenwood Memorial Pool demolition and pavilion construction

The Gardner Conservation Commission approved the demolition of the Greenwood Memorial Pool and construction of a new pavilion at 69 Park Street, voting 5-0. The commission also amended an enforcement order related to the Sludge Landfill and continued several hearings, including those for 125 Snake Pond Road, 0 Betty Spring Rd, and the New England Power transmission line, to later meetings.

Wed Mar 5, 2025

Cemetery Commission

Cemetery Commission to review finances and bandstand update

This is a routine meeting of the Gardner Cemetery Commission. The board will approve prior meeting minutes, review the cemetery department's financial statement, and receive an update from the Bandstand Committee. The department head will also report on the conditions of municipal grounds and the cemetery.

cemeterymunicipal-groundsbandstandfinancial-reportcommission-meeting
✓ Decided: Cemetery Commission approves prior meeting minutes

The Gardner Cemetery Commission met on March 5, 2025, and approved the minutes from the December 18, 2024 meeting. No other substantive decisions were recorded; the agenda included financial statements, updates, and committee reports, but no votes or actions on those items were noted in the minutes.

Wed Mar 5, 2025

Airport Commission

Airport Commission to discuss runway and master plan updates

The Gardner Airport Commission will meet to approve minutes from the previous meeting and discuss old business, including updates on the runway, master plan, and environmental assessment. The Airport Manager will report on facility updates, guard system counts, and a budget review. New business and the next meeting date will also be addressed.

airportrunwaymaster-planenvironmental-assessmentbudgetfacilitiessecurity
✓ Decided: Commission approves $226,900 grant application for airport environmental study

The Airport Commission voted to accept Gale Associates' fee of $221,400 for the Environmental Assessment and Obstruction Analysis, and to forward the grant application totaling $226,900 to Mayor Nicholson for final approval. The grant includes FAA, MassDOT, and city shares, with completion expected possibly by August 2025 and up to 18 months for the work. The commission also approved the minutes from the February 5, 2025 meeting.

Tue Mar 4, 2025

School Subcommittees

Finance Subcommittee to review FY26 budget sheets

The Gardner Public Schools Finance Sub-Committee will meet to review routine financial matters, including expense reports, project updates, and gifts and donations. The main item of business is a review of the draft FY26 budget sheets.

financebudgetschoolseducationgardner
✓ Decided: Gardner school finance subcommittee reviews FY26 budget with $882K deficit

The Finance Sub-Committee reviewed the FY26 budget, noting a current deficit of -$882,531, driven almost entirely by indirect costs, particularly health insurance. Expense drivers include custodial contract, transportation, and Chromebooks, while gas and plowing line items are negative due to increased usage and storms. No formal decisions were made beyond approving the previous meeting's minutes.

Tue Mar 4, 2025

School Subcommittees

Gardner school facilities sub-committee meets for routine updates

The Gardner Public Schools Facilities Sub-Committee is meeting on March 4, 2025, to discuss general agenda items including approval of minutes, old business, a projects update, and new business. No specific projects, dollar amounts, or actionable items are listed on the agenda; it is a procedural update meeting.

schoolsfacilitiesmeetingsgardner
✓ Decided: Gardner school facilities committee reviews snow costs, auditorium progress

The Gardner Public Schools Facilities Sub-Committee met on March 4, 2025, and unanimously approved the minutes from the December 4, 2024 meeting. They reviewed a snow contractor report covering December 5, 2024 through February 27, 2025, with a total cost of $92,193.60, and discussed the near-completion of the GHS auditorium, which awaits final paint touchup and installation of technical equipment. The committee also noted the replacement of 24 hand dryers at GHS and GMS.

Mon Mar 3, 2025

City Council

Gardner City Council to consider zoning changes for historic preservation

The City Council will discuss an amendment to the Zoning Ordinance to allow for 'Historic Preservation Projects' via special permit. The body will also consider an order of taking for easements on Elm Street for the Safe Routes to School Project.

zoningeminent-domainroadshistoric-preservationcommunity-development
✓ Decided: Council advances CDBG steering committee ordinance to final vote

The Gardner City Council voted 8-0 to send an ordinance creating a Community Development Block Grant Steering Committee to its second and final printing. The council also referred a zoning amendment for historic preservation projects to the Planning Board for further study. A request for more time on an eminent domain taking for the Safe Routes to School project was granted.

Fri Feb 28, 2025

Gardner Redevelopment Authority

Gardner board to vote on urban renewal projects and new director

The Gardner Redevelopment Authority will meet to approve minutes from August 2024, discuss urban renewal projects (Rear Main, 140 South Main Street, Summit Industrial Park), review financials and broker services, consider renewal of liability insurance, nominate new officers, and appoint an executive director. This is a regular business meeting with multiple decisions.

redevelopmenturban-renewalmain-streetindustrial-parkinsuranceofficersexecutive-directorfinances
✓ Decided: GRA appoints Jason Stevens as Executive Director, elects new officers

The Gardner Redevelopment Authority approved minutes, discussed the Rear Main Project's unforeseen subsurface conditions requiring a ~$800,000 geogrid fix, and made several administrative decisions. They elected a new slate of officers, appointed Jason Stevens as Executive Director, and assigned him responsibility for renewing public officials liability insurance. No substantive project approvals or denials occurred; most items were updates or procedural.

Thu Feb 27, 2025

Gardner Housing Authority

Housing authority meets for routine business, reports, and invoices

The Gardner Housing Authority will hold a regular meeting to approve minutes from the prior meeting, receive the Executive Director's report, and review an invoice history report. No significant actions, contracts, or policy changes are on the agenda; the meeting is primarily procedural.

housing-authoritymeetinggovernancegardner
Wed Feb 26, 2025

Finance Committee

Finance Committee to consider eminent domain for Elm Street Safe Routes to School project

The committee will consider an order authorizing the mayor to take temporary and permanent easements by eminent domain for the Safe Routes to School project on Elm Street. It will also review a communication from the mayor regarding the state's certification of the city's property assessment ratios. Additionally, the committee will continue discussions on a salary study and the city's health insurance trust fund.

financeeminent-domainsafe-routes-to-schoolsalarieshealth-insuranceproperty-assessment
✓ Decided: Finance Committee recommends eminent domain easements for Elm Street project

The Finance Committee voted to recommend the City Council adopt an order for taking easements by eminent domain for the Safe Routes to School project on Elm Street. The committee also recommended placing the mayor's communication about the FY24 trust fund on file. Two other agenda items were discussed with no decisions made.

Wed Feb 26, 2025

Williams-Rockwell

Foundation committee to vote on investment update and school grant application

The Williams-Rockwell Educational Gift Foundation Committee will hold a meeting to discuss and vote on a Raymond James investment update and a review of the 2024-2025 school year grant application. The committee will also approve minutes from the previous meeting and set the date for the next meeting.

foundationeducationgrantsinvestmentcommittee
✓ Decided: Committee accepts financial report, awards $208,855.75 in grants

The Williams-Rockwell Educational Gift Foundation Committee accepted the financial report for the Raymond James managed account and approved the 2024/2025 grant awards totaling $208,855.75, with 56% going to Arts and 44% to General. The meeting was otherwise procedural, with no other substantive decisions.

Tue Feb 25, 2025

Retirement Board

Retirement Board to handle approvals, investment review, and COLA discussion

The Gardner Contributory Retirement Board is meeting to approve routine items including January 2025 meeting minutes, December 2024 permanent minutes, and the pre-close trial balance, general ledger, and bank reconciliation. They will also approve accounts payable and payroll warrants, review the PRIT statement for January 2025 and PERAC correspondence, and discuss disability retirements in process. A vote on the Cost of Living Adjustment (COLA) for Fiscal Year 2026 is scheduled for the March 26, 2025 meeting. New business includes approving retirements and acknowledging deceased members.

retirementfinancecity-gardnerboard-meetinginvestmentspensionpublic-records
✓ Decided: Board approves $760,831.52 warrant and grants three retirements

The Gardner Contributory Retirement Board approved the February 2025 warrant totaling $760,831.52, covering pension payroll and vendor payments. The board also granted superannuation retirement benefits to three members, approved the December 2024 financial reports, and reviewed investment performance and PERAC correspondence.

Mon Feb 24, 2025

Board of Health

Board of Health to review landfill groundwater exceedance of 1,4-Dioxane

The Board of Health will receive information from Civil Environmental Consultants regarding 1,4-Dioxane levels in landfill groundwater. The meeting also includes updates on Health Department staffing and the status of the landfill project.

public-healthlandfillgroundwaterenvironmental-monitoring
✓ Decided: Board hears 1-4 dioxane exceedances at closed landfill; no action taken

The Board of Health received a presentation from environmental consultants CEC on annual groundwater monitoring at the closed landfill on West Street. Testing in April 2024 found 1-4 dioxane above the guideline standard of 0.3 parts per billion in five monitoring wells, but no drinking water or private wells are affected. No formal decisions were made; the board discussed ongoing monitoring and erosion repairs.

Mon Feb 24, 2025

Conservation Commission

Conservation Commission to continue hearing on 170 Mill St contractor building

The Gardner Conservation Commission will discuss enforcement orders, hold hearings on wetland buffer zone projects, and continue a long-pending public hearing for a contractor building at 170 Mill Street. The commission will also consider professional development and approve minutes from prior meetings.

conservationwetlandsenforcementhearingsconstructiontree-removalsingle-family-homecontractor-building
✓ Decided: Conservation Commission continues hearings, enforcement actions to March

The Gardner Conservation Commission met on February 24, 2025, and approved minutes from prior meetings. No certificates of compliance were requested. The commission continued several enforcement matters and hearings to future meetings, including a tree-cutting case at 282 Brookside Drive and a Notice of Intent for a home at 0 Betty Spring Rd. All motions to continue were approved unanimously (6-0).

Fri Feb 21, 2025

Community Development Block Grant Steering Committee

Committee to review and approve FY25 CDBG social service and infrastructure projects

The Community Development Block Grant Steering Committee will hold a public hearing to review and approve FY25 applications. The committee will also receive updates on FY 22/23 and FY 24 grant projects.

cdbginfrastructuredemolitiongrantspublic-hearing
Thu Feb 20, 2025

Board of Assessors

Board of Assessors to review tax abatements and exemptions

The Board of Assessors will review meeting minutes and receive an update on FY2025 omitted or revised bills for nine personal property accounts. The board will then enter an executive session to decide on land applications, exemption applications, and real estate and personal property abatements.

taxesassessmentsexemptionsabatements
✓ Decided: Board approves minutes, handles abatements, enters executive session

The Board of Assessors approved the January 21, 2025 minutes and processed several omitted/revised bills. They entered executive session and did not return to open session, where they reviewed and approved some exemptions and abatements, denied one, and deferred others pending more information.

Wed Feb 19, 2025

Councillor Ronald F. Cormier Memorial Committee

Memorial committee meets to recommend fitting memorial for Councillor Cormier

The Councillor Ronald F. Cormier Memorial Committee is meeting to begin its work of recommending a memorial honoring Councillor Cormier's life and service. The agenda contains only the meeting notice and the committee's charge; no specific proposals or votes are listed.

memorialcommitteegardnerpublic-meeting
✓ Decided: Committee recommends bronze plaque honoring Councillor Cormier

The Committee voted unanimously to recommend a 3D bas-relief bronze plaque to the City Council, memorializing Councillor Ronald F. Cormier's public service. The plaque will be erected in the Council Chamber, as opposed to designating the Chamber in his name. The Chair was authorized to convey the decision and plaque format to the City Council President.

Tue Feb 18, 2025

Economic and Community Development Committee

Ordinance to create Community Development Block Grant Steering Committee

The committee will discuss proposed Ordinance 11498 to amend city code and establish a CDBG Steering Committee with oversight of all CDBG-funded proposals and projects. This follows the Maki Park Report and aims to increase accountability and transparency. The committee will also receive a one-month update from the Director of Community Development and Planning on request by Councillor Kazinskas.

ordinancecommunity-developmentCDBGboards-and-commissionstransparency
✓ Decided: Committee recommends codifying CDBG Steering Committee ordinance

The Economic and Community Development Committee voted 3-0 to recommend sending an ordinance to first printing that would codify the structure and workings of the Community Development Block Grant (CDBG) Steering Committee, aiming to increase accountability and transparency. The committee also voted 3-0 to file a one-month update from the Community Development and Planning Director, which included a field report on the Rear Main Street project, and to recommend the director brief the City Council on the update.

Tue Feb 18, 2025

Appointments Committee

Appointments Committee to interview and discuss 9 mayoral appointments

The Appointments Committee will interview and discuss the confirmation of several mayoral appointments. These include key city leadership roles and various commission and officer positions.

appointmentspolicecity-governmentpublic-safety
✓ Decided: Committee recommends re-appointments for assessor, police chief, deputy chief, and others

The Appointments Committee voted to recommend the Mayor's re-appointments of Christine Oliva Kumar as City Assessor, Eric McAvene as Police Chief, Nicholas Maroni as Deputy Chief of Police, Tina Sbrega as Williams-Rockwell Trustee, Autumn Brown, Alana Meserve, and Cheryl Slack as Animal Control Officers, and Anne Hurst as Disability Commission Member, all for terms expiring January 16, 2028 (or January 15, 2028 for Sbrega). The item for City Engineer Robert Oliva was removed from the calendar due to his unavailability. The committee also accepted the minutes of the January 29 meeting and noted the resignation of License Commission Clerk Meaghan Boudreau.

Tue Feb 18, 2025

Zoning Board

Zoning Board to hear requests for residential builds and signage relief

The Zoning Board of Appeals will hold public hearings on several variance and special permit requests. These include proposals for new single-family homes, a property conversion to a three-family dwelling, and environmental restoration of 20 acres.

zoninghousingvariancesspecial-permitsland-use
✓ Decided: ZBA grants variances for Talcott Ave home, denies farm stand appeal

The Gardner Zoning Board of Appeals granted two variances for a single-family home at 0 Talcott Avenue, approved a special permit for environmental restoration on Keyes Road, and upheld the Building Commissioner's denial of a home occupation farm stand at 877 Timpany Blvd. Several other cases were continued, including a parking compliance issue at 163-165 Pine Street.

Tue Feb 18, 2025

City Council

Council to reallocate $8.16M in bond proceeds and confirm police chief

The City Council will consider reappropriating $8,161,000 in unexpended bond proceeds to other capital projects, discuss a contract with Keller Partners for grant writing and lobbying, and vote on an ordinance adding a Human Resources Manager position. They will also confirm appointments including Eric McAvene as Police Chief and Nicholas Maroni as Deputy Chief, and hear a request for a one-month update from the Community Development and Planning director.

agendaappointmentsbudgetcity-councilpersonnelpublic-safetyreappropriation
✓ Decided: Council reappropriates $8.16M in bond funds for capital projects

The Gardner City Council voted 9-1 to reappropriate $8,161,000 in unexpended bond proceeds from the completed Waterford Street Elementary School project to fund 19 capital projects, including school, community center, and City Hall upgrades. The Council also approved an ordinance adding a Human Resources Manager position to the compensation schedule, confirmed several mayoral appointments, and elected Elizabeth Kazinskas as President Pro-tem. The Health Trust Fund item was removed from the calendar to remain on the Finance Committee agenda for continued discussion.

Tue Feb 18, 2025

License Commission

License Commission to consider new liquor license for Four Seasons Chinese Cuisine

The Gardner Board of License Commission will hold a regular meeting on February 18, 2025, to address several liquor license matters. Key actions include a hearing on a change of manager for the Lithuanian Outing Association, approval of additional 2025 ABCC liquor license renewals for two clubs, and discussion of old business items such as license changes and a new all-alcoholic beverage license for Four Seasons Chinese Cuisine. The commission will also welcome a new clerk.

liquor-licensespublic-hearingslicense-commissionchange-of-managernew-licenserenewalsgardner
✓ Decided: License Commission approves Lithuanian Outing Association manager change

The Gardner License Commission approved a change of manager for the Lithuanian Outing Association and approved the January 14, 2025 meeting minutes. Several liquor license updates were noted, including ABCC approvals for Ovila Case Post 905, Sawa Asian Cuisine, and Gardner Fish and Gun Club. The commission also approved additional 2025 liquor license renewals for Gardner Deep Sea Club and West End Beagle Club.

Tue Feb 18, 2025

Historical Commission

School Street School demolition and artifacts up for discussion at Historical Commission

The Gardner Historical Commission will discuss ongoing projects including the School Street School demolition, which involves a letter from the Massachusetts Historical Commission, and the evaluation of relinquished artifacts from Gardner High School. The agenda also includes updates on city hall artifacts documentation, Old Burying Ground restoration, and a proposed historic preservation zoning amendment related to 100 Central Street. The meeting will begin with approval of prior meeting minutes and administrative matters.

historical-commissiondemolitionpreservationartifactszoningschoolsburying-groundcity-hall
✓ Decided: Historical Commission files School Street School demolition correspondence

The Gardner Historical Commission voted to file correspondence from the Massachusetts Historical Commission regarding the School Street School demolition (MHC# RC.74687). The Commission also discussed artifacts relinquished by Gardner High School, agreeing to evaluate them at the next meeting, and received updates on ongoing projects including City Hall artifact documentation and Greenwood Pool artifact salvage.

Wed Feb 12, 2025

Councillor Ronald F. Cormier Memorial Committee

Committee to discuss memorial for Councillor Ronald F. Cormier

The Councillor Ronald F. Cormier Memorial Committee will meet to discuss recommendations for a memorial. The committee is charged with proposing a fitting tribute to commemorate Councillor Cormier’s life and service to the City of Gardner.

memorialcity-councilgardner
✓ Decided: Committee delays memorial decision, adds roles to plaque text

The Committee agreed to delay a decision on whether to recommend a memorial plaque or chamber designation until the next meeting, allowing the family more time. They voted to include Councillor Cormier's roles as Gardner Redevelopment Authority Chairman and Levi Heywood Memorial Library Board of Trustees Clerk on the plaque. Draft text for both memorial options was reviewed.

Wed Feb 12, 2025

Finance Committee

Finance Committee to discuss $8.16 million bond reappropriation

The Finance Committee will review a proposal to reallocate unexpected bond proceeds to other capital projects. The body will also discuss health insurance payments, a grant writing contract, and a salary study review.

budgetbondscontractshealth-insurancezoning
✓ Decided: Finance Committee recommends $8.16M reallocation of school bond savings

The Finance Committee voted to recommend the City Council approve reallocating $8,161,000 in unspent bond proceeds from the Waterford Street Elementary School project to various capital projects, including school upgrades, community center repairs, and City Hall improvements. The committee also recommended filing the Keller Partners contract, referred two items to the new Economic and Community Development Committee, and discussed the health insurance trust fund, which had recovered to $1.4 million. No final decisions were made; all items are recommendations to the full City Council.

Wed Feb 12, 2025

Disability Commission

Gardner Disability Commission to host Q&A with state official

The Disability Commission will hold a question and answer session with Jeff Dougan, Assistant Director for Community Services from the Massachusetts Office on Disability. The commission will also discuss new members and social media.

disability-servicescommunity-servicesgovernment-administration
Tue Feb 11, 2025

License Commission

Four Seasons Chinese Cuisine seeks new all-alcohol license at Gardner License Commission

The Gardner License Commission will hold a public hearing on a change of manager for Lithuanian Outing Association and review multiple liquor license matters. Old business includes approved changes for Ovila Case VFW, Sawa Asian Cuisine's change of location, and a new license application from Four Seasons Chinese Cuisine, which is in final ABCC review. New business includes approval of additional 2025 ABCC liquor license renewals for Gardner Deep Sea Club and West End Beagle Club, plus appointment of a new commission clerk.

liquor-licensespublic-hearingscommission-meetinggardner
Tue Feb 11, 2025

Planning Board

Planning Board to review Compass Lane Subdivision proposal

The Planning Board will discuss a proposed subdivision on Compass Lane by Private Oversight, LLC as old business and approve minutes from December 10, 2024. No other significant items are on the agenda.

planningsubdivisiongardnercompass-lane
✓ Decided: Planning Board approves Compass Lane subdivision project

The Gardner Planning Board approved the proposed Compass Lane subdivision project, located on the south side of West Broadway near the Templeton town line, in a 3-0 vote. The approval follows revisions addressing concerns from the City Engineer and Review Engineer, with two formal waivers requested for HDP pipes and drain manhole sumps. The board also approved the minutes from the December 10, 2024 meeting and discussed the Hazard Mitigation Plan, noting a committee has not yet been formed.

Mon Feb 10, 2025

School Committee

Committee to vote on policy adoptions, school choice for 2025-26

The School Committee will consider a consent agenda including a $100,000 grant and warrants totaling approximately $1.66 million, plus a $75,000 scholarship donation. Discussion items include first readings of several policies, second readings requiring votes on student health services, immunization, fees, and other policies. Votes are also scheduled on school choice acceptance, the 2025-2026 meeting schedule, and the annual calendars for 2025-2026 and 2026-2027.

school-committeepoliciesbudgetgrantsschool-choiceimmunizationstudent-feescalendar
✓ Decided: School Committee approves policies, calendars, and $100K grant

The Gardner School Committee approved the consent agenda, including acceptance of $100,000 in grant funds and ratification of warrants totaling over $1.6 million. They also adopted several policies, removed a redundant policy, approved the 2025-2026 School Choice Acceptance, the meeting schedule, and the two-year school calendar. All votes were unanimous with Mayor Nicholson abstaining.

Mon Feb 10, 2025

Conservation Commission

Conservation Commission to review gravel pit stabilization and building projects

The Conservation Commission will hold public hearings regarding three separate land-use projects. The body is reviewing requests for tree removal, gravel pit stabilization, and the construction of a contractor building.

wetlandszoningenvironmentpublic-hearings
✓ Decided: Conservation Commission approves $600 for MACC conference attendance

The Gardner Conservation Commission approved spending up to $600 to cover conference fees for members attending the MACC conference on March 1, 2025. Several enforcement orders and hearings were continued to future meetings, including the Sludge Landfill enforcement order and hearings for 125 Snake Pond Road and 170 Mill Street. No certificates of compliance or minutes were considered.

Thu Feb 6, 2025

Historical Commission

Historical Commission to discuss historic preservation zoning amendment

The Gardner Historical Commission will hold a special meeting to discuss a proposed Historic Preservation Zoning Amendment. The meeting is open to the public and will take place at the Gardner Museum.

historical-commissionhistoric-preservationzoningpublic-meeting
Wed Feb 5, 2025

Airport Commission

Airport Commission to discuss runway and master plan updates

The Airport Commission will meet for a regular session, including approval of past minutes, old business items such as updates on Gale Associates, the runway, and the master plan, and the airport manager's report covering guard system counts, facility updates, and a budget review. New business and the next meeting date will also be addressed. The agenda is largely procedural with no votes on major actions expected.

airportcommissionrunwaymaster-planbudgetfacilitiesminutes
Mon Feb 3, 2025

City Council

Council to consider $100K borrowing for middle school roof study

The Gardner City Council will discuss and possibly vote on several items: a $100,000 borrowing order for a feasibility study and schematic design of the Middle School Roof Replacement Project in partnership with the Massachusetts School Building Authority, a proposal to amend council rules to add a Committee on Economic and Community Development, an ordinance to add a Human Resources Manager position to the city's compensation schedule, and appointments to local inspector and assistant city clerk positions. The meeting will also include reading of minutes from December 2, 2024, and communications from the mayor regarding health insurance payments.

budgetschoolspersonnelgovernment-operationsappointmentshealth-insurancerules
✓ Decided: Council approves $100K for Gardner Middle School roof study

The Gardner City Council approved a $100,000 appropriation for a feasibility study and schematic design of a roof replacement project at Gardner Middle School, with borrowing authorized and potential MSBA grant eligibility. The Council also approved changes to its rules to create a new Committee on Economic and Community Development, confirmed two appointments, and sent an ordinance to first printing to add a Human Resources Manager position.

Thu Jan 30, 2025

Traffic Commission

Traffic Commission to vote on 60-day trial for Douglas Street after discussion

The Gardner Traffic Commission will discuss and vote on a 60-day trial on Douglas Street, including sending it to public safety. Other items include discussions on Holy Family signage, 25 MPH zones, winter parking ban procedures, parking restrictions near West Broadway and Union St, and a parking meter update.

trafficparkingspeed-zoneswinter-bansignagepublic-safetydouglas-street
✓ Decided: Traffic Commission changes Holy Family school drop-off signage on Regan Street

The Traffic Commission voted unanimously to change the no-parking sign on Regan Street from 8am-4pm to 7am-4pm to accommodate Holy Family School drop-off and pick-up. They also voted to send a letter to Public Safety recommending a hybrid winter parking ban. The commission agreed to revisit 25 MPH zones and parking restrictions on West Broadway and Union St at the next meeting.

Thu Jan 30, 2025

School Subcommittees

Gardner School Finance Subcommittee to review expenses, projects

The Gardner Public Schools Finance Sub-Committee is meeting to discuss routine financial oversight items including expense report review, project updates, and gifts/donations. No specific votes or dollar amounts are listed on the agenda.

schoolfinancebudgetexpensesgardner
✓ Decided: School finance subcommittee accepts $75K scholarship donation

The Gardner School Finance Sub-Committee approved a $75,000 donation from the First Congregational Church of Gardner for Gardner High School scholarships. They also approved the minutes from the December 4, 2024 meeting and reviewed expense reports and revolving funds, noting no new negative line items. The next meeting is scheduled for March 4, 2025.

Thu Jan 30, 2025

Gardner Housing Authority

Gardner Housing Authority to hold regular meeting January 30, 2025

The Gardner Housing Authority will meet to review the Executive Director's report and an invoice history report. The body will also consider the minutes from the December 17, 2024 meeting.

housingpublic-recordsadministration
Wed Jan 29, 2025

Appointments Committee

Committee to interview two city appointees for inspector and clerk

The Appointments Committee will interview and discuss two mayoral and city clerk appointments: Scott Chatigny for Local Inspector and Jayen S. Kumar for Assistant City Clerk. The committee may vote to confirm the appointments, with terms expiring in 2027 and 2028 respectively.

appointmentscity-councilpersonnellocal-inspectorassistant-city-clerk
✓ Decided: Committee recommends confirming Chatigny as Local Inspector and Kumar as Assistant City Clerk

The Appointments Committee voted to recommend to the full City Council the confirmation of Scott Chatigny as Local Inspector and Jayen S Kumar as Assistant City Clerk. Both appointments were approved unanimously by the committee members present. No other substantive decisions were made.

Wed Jan 29, 2025

Finance Committee

Finance Committee to consider $100K borrowing for middle school roof study

The Gardner Finance Committee will discuss and potentially recommend action on several new items, including a $100,000 borrowing order for a feasibility study and schematic design of the middle school roof replacement, discussions on internal working groups reviewing a salary study, a communication from the mayor on health insurance payments and trust fund, and an ordinance to add a Human Resources Manager position. The committee will also review minutes from December 2024 and consider a subcommittee proposal to require monthly CDBG Steering Committee meetings. A report on the Maki Park investigation is referred to finance.

financebudgetschoolspersonnelhealth-insuranceborrowingsalary-studycdbg
✓ Decided: Finance Committee recommends $100K loan for middle school roof study

The Finance Committee voted to recommend the City Council approve borrowing $100,000 for a feasibility study and schematic design of the Gardner Middle School roof replacement project, with potential MSBA grant funding. It also recommended adding a Human Resources Manager position to the compensation schedule at an annual salary of $63,316. The committee voted to file a communication from the mayor regarding health insurance payments and the trust fund, and kept several items on the agenda for further discussion.

Wed Jan 29, 2025

Retirement Board

Retirement Board to elect Chairperson and review investments

The Gardner Contributory Retirement Board will meet to elect a Chairperson for the term of February 1, 2025, through January 31, 2026. The board will also review the December 2024 investment statement and process retirement approvals.

retirementfinancegovernanceinvestments
✓ Decided: Gardner Retirement Board approves 3.0% COLA for FY2026

The Gardner Contributory Retirement Board approved a 3.0% Cost of Living Adjustment (COLA) for FY2026, exceeding the 2.5% Social Security increase. The board also approved the monthly warrant totaling $638,594.92, the November 2024 trial balances and bank reconciliations, and an amendment to the Board Administrator's contract regarding fringe benefits. Denise Merriam was re-elected as Chairperson for a one-year term.

Mon Jan 27, 2025

Golf Commission

Gardner Golf Commission to review financials and approve minutes at Jan. 27 meeting

The Golf Commission is meeting to approve the December 16, 2024 meeting minutes, receive updates from Pro Manager Dan Berry and Superintendent Bill Frank, discuss correspondence from Paul Jaillet and Lynn & Sommay Sayarath, and review financials including an expense report. No major policy decisions or items with dollar amounts are on the agenda.

golfcommissionfinancialsadministrativegardner
Mon Jan 27, 2025

Board of Health

Board reviews tobacco violation at Anthony's Packag Store

The Gardner Board of Health meets to review minutes from December 9, 2024, and conduct a tobacco violation hearing for James Kraskouskas at Anthony's Packag Store. The agenda includes updates on the landfill erosion control project, environmental monitoring, food establishments, and sanitary housing inspections. The board will also discuss Saturday hours of operation for the transfer station.

public-healthtobaccolandfillsanitationhousing
✓ Decided: Board reduces Anthony's Package Store suspension to 1 day

The Board of Health voted unanimously to reduce Anthony's Package Store's 3-day tobacco sales suspension to 1 day, with the remaining 2 days held in abeyance for 36 months, citing no prior violations in 15 years. The board also approved the December 9, 2026 minutes and re-elected Sue Avallone as chair. Other updates included ongoing landfill pump repairs, new food establishment openings, and a planned inclement weather policy for the transfer station.

Mon Jan 27, 2025

Councillor Ronald F. Cormier Memorial Committee

Committee meets to discuss memorial for Councillor Ronald F. Cormier

The Councillor Ronald F. Cormier Memorial Committee is meeting to discuss recommendations for a memorial. The committee's purpose is to propose a fitting commemoration of Councillor Cormier's life and service to the City of Gardner.

memorialcity-councilgardner
✓ Decided: Committee recommends bronze bas-relief plaque for late Councillor Cormier

The inaugural meeting of the Councillor Ronald F. Cormier Memorial Committee was held on January 27, 2025. The committee voted unanimously to recommend a cast bronze bas-relief plaque with fitting text to honor Councillor Cormier, and deferred a decision on whether to recommend naming the City Council Chamber in his honor. The committee also voted to instruct the Clerk to prepare draft text for the plaque for consideration at its next meeting on February 12, 2025.

Mon Jan 27, 2025

Conservation Commission

Commission reviews wetland permits for 125 Snake Pond Rd and Keyes Rd gravel pit

The Gardner Conservation Commission will hold public hearings on three wetland-related projects. It will review a request to remove trees near a wetland at 125 Snake Pond Road and a gravel pit stabilization project off Keyes Road. The commission will also continue discussion on a contractor building at 170 Mill Street, which has been pending since September 2023.

zoningwetlandsenvironmentpublic-hearingland-use
✓ Decided: Commission issues standard order for Keyes Road gravel pit stabilization

The Gardner Conservation Commission voted unanimously to close the hearing and issue a standard Order of Conditions for the gravel pit stabilization project off Keyes Road (DEP#160-0673), filed by BSC Group on behalf of North County Land Trust. The commission also continued enforcement order discussions for the sludge landfill and 36 Nicolle Terrace, and continued hearings for 125 Snake Pond Road and 170 Mill Street to future meetings. No certificates of compliance were requested.

Thu Jan 23, 2025

Gardner Housing Authority

Housing Authority meets to approve minutes and hear reports

This is a procedural meeting of the Gardner Housing Authority. The board will vote to open the meeting, approve minutes from December 17, 2024, receive the Executive Director’s report, and review the invoice history report before adjourning. No substantive policy decisions or public hearings are on the agenda.

housing-authorityproceduralgardner
Wed Jan 22, 2025

Historical Commission

Historic Preservation Zoning Amendment for 100 Central Street project discussed

The Gardner Historical Commission will hear a presentation on a proposed Historic Preservation Zoning Amendment related to the 100 Central Street project. The commission will also review prior meeting minutes, discuss FY2026 budget preparation, and receive updates on ongoing preservation projects including the Old Burying Ground restoration and demolition-related artifact handling.

historical-commissionhistoric-preservationzoningbudgetold-burying-grounddemolitioncity-hall-artifacts
✓ Decided: Historical Commission reviews proposed zoning amendment for 100 Central Street

The Gardner Historical Commission heard a presentation from Attorney Christine Tree on a proposed Historic Preservation Zoning Amendment that would allow the ZBA to grant special permits for historic preservation projects, including at 100 Central Street. The Commission took no formal action on the proposal, but will discuss it further at a special meeting on February 6. The Commission also voted to submit a FY2026 budget request including $15,000 for gravestone restoration.

Wed Jan 22, 2025

School Subcommittees

Gardner Public Schools Policy Subcommittee to review district policies

The Policy Subcommittee will meet to review several district policies. These include legal status, non-discrimination, and school admissions procedures.

educationschool-policyadministrationlegal-compliance
✓ Decided: Policy subcommittee advances 6 policy changes to full committee

The Gardner Public Schools Policy Subcommittee reviewed multiple policies and voted unanimously to send six items to the February full School Committee meeting for first reads, including revisions to Policy AC (Non-Discrimination and Harassment) and new proof of residency forms. Four policies were deemed redundant and will not be recommended for adoption. No final decisions were made; all actions are recommendations pending full committee approval.

Tue Jan 21, 2025

Zoning Board

Zoning Board to review 20-acre environmental restoration and multiple variance requests

The Gardner Zoning Board of Appeals will hold public hearings on eight cases, including an update on a special permit violation, a request to convert a two-family dwelling to three-family at 75 Oak Street, several variance requests for building setbacks and signage, and a proposal to restore 20 disturbed acres on Keyes Road. The board will also handle announcements and approval of previous meeting minutes.

zoningboard-of-appealspublic-hearingsvariancesspecial-permitsenvironmental-restorationhousing
Tue Jan 21, 2025

City Council

Council to consider budget, HR manager, and grant writing contract

The Gardner City Council will consider several financial and personnel items at its Jan. 21 meeting, including a proposed new Human Resources Manager position and a contract for grant writing services. The council will also discuss the FY2026 budget, collective bargaining with the Teamsters, and a land donation for the Elm Street Safe Routes to School project. Additionally, the council will hear an update on the Community Development and Planning Department and a proposal to amend council rules to add a new committee.

budgetfinancehuman-resourcescontractsroadspublic-safetyeconomic-development
✓ Decided: Council creates new HR Manager position, accepts Elm Street land donation

The Gardner City Council voted unanimously to create a new Human Resources Manager position, consolidating two existing HR roles at no extra cost. It also accepted a land donation on Elm Street valued at $10,500 for the School Department, with one councilor recusing. Several communications were placed on file, including updates on Rome Square and Greenwood Pool projects, and a proposal to add a Committee on Economic and Community Development was moved to the next meeting.

Tue Jan 21, 2025

Board of Assessors

Board of Assessors to elect chairman and review tax exemptions

The Board of Assessors will nominate and elect a chairman for the new year. The body will review excise tax commitments and provide updates on FY2025 bills and website updates. An executive session is scheduled to act on land applications, exemption applications, and property abatements.

taxesassessmentsexemptionsgovernment-administration
✓ Decided: Gardner Board of Assessors re-elects LeBlanc chairman, approves abatements

The Board of Assessors re-elected Charles LeBlanc as chairman and approved the December 3, 2024 minutes. They signed 2024 and 2025 excise tax warrants, reviewed the 2025 real estate tax billing, and approved several abatements and Chapter Land applications in executive session.

Thu Jan 16, 2025

Community Development Block Grant Steering Committee

Gardner CDBG Committee to review FY25 public social service proposals

The Community Development Block Grant Steering Committee will review proposals for FY25 public social services. The body will also discuss grant status and project updates for FY22, FY23, and FY24.

grantssocial-servicescommunity-developmentbudget
Wed Jan 15, 2025

Finance Committee

Finance Committee to discuss new union contract with Teamsters Local 170 inspectors

The Gardner Finance Committee will consider an ordinance requiring monthly CDBG Steering Committee meetings, and review multiple mayoral communications including a new collective bargaining agreement with Teamsters Local 170 for inspectors, a 5-year grant writing contract with Keller Partners Company, and an update on the FY2026 budget. They will also act on an order to create a Human Resources Manager position and accept land for Elm Street resurfacing. A report on the Maki Park Project investigation is referred to the committee.

financebudgetcollective-bargaininggrantshuman-resourcessnow-removalsafe-routes-to-schoolordinance
✓ Decided: Finance Committee recommends creating HR Manager position, accepting land donation

The Finance Committee voted to recommend the City Council adopt an order creating a new Human Resources Manager position and discontinue other HR positions. It also recommended accepting a land donation from the Gardner School Committee for Elm Street resurfacing. All other communications were placed on file, and the Maki Park investigation item was kept on the agenda with a proposal to add a new committee.

Tue Jan 14, 2025

License Commission

License Commission to hear Four Seasons Chinese Cuisine alcohol license request

The Gardner Board of License Commission will hold hearings on a new all alcoholic beverage license for Four Seasons Chinese Cuisine and a one-day license for Whole Food Wine. It will also consider approvals for 2025 liquor license renewals, extensions for two clubs, and updates on pending state ABCC actions. A new clerk will be assigned following a resignation.

licensingalcoholpublic-hearinglicense-renewalcity-of-gardner
✓ Decided: Gardner License Commission approves new liquor license for Four Seasons Chinese Cuisine

The Gardner License Commission approved a new on-premises all-alcoholic beverage license for Four Seasons Chinese Cuisine, a one-day liquor license for Home Fruit Wine's vendor fair, and a Common Victualler License for Tata's Fonda LLC pending required documents. The commission also approved liquor license renewals for four establishments and extensions for two clubs. No other substantive decisions were made.

Tue Jan 14, 2025

Joint Convention

Joint Convention hears State of the City address and Lt. Gov. remarks

The Gardner City Council and School Committee meet jointly for a ceremonial session featuring remarks from Lt. Governor Driscoll and the State of the City Address by Mayor Nicholson. No legislative business or decisions are scheduled.

joint-meetingstate-of-the-citymayorschool-committeeceremonial
Mon Jan 13, 2025

Conservation Commission

Conservation Commission to hold hearings on gravel pit and contractor building projects

The Conservation Commission will hold public hearings regarding two projects involving wetlands and riverfront areas. The body will also address enforcement orders for specific properties.

conservationwetlandspublic-hearingzoning
✓ Decided: Conservation Commission continues Pearl Street gravel pit hearing to Jan. 27

The Gardner Conservation Commission voted 4-0 to continue the public hearing on the Pearl Street gravel pit stabilization project (off Keyes Road) to January 27, 2025, pending a DEP number. They also continued the 170 Mill Street contractor building hearing to the same date. No certificates of compliance or determinations of applicability were requested, and enforcement orders for the Sludge Landfill and 36 Nicolle Terrace reported no changes.

Wed Jan 8, 2025

Airport Commission

Gardner Airport Commission to review runway and master plan updates

The Airport Commission will meet to discuss updates regarding the runway and the airport's master plan. The body will also review the Airport Manager's report and the budget.

airportinfrastructurebudgetaviation
Wed Jan 8, 2025

Disability Commission

Disability Commission to discuss Maki Park, post office accessibility, and hospital partnership

The Gardner Disability Commission will meet on January 8, 2025, to review and approve minutes from October 9, 2024, and discuss old business including Maki Park, new members, and bi-laws. New business items include post office accessibility, handicap parking downtown, and a potential collaboration with Heywood Hospital. The meeting is open to the public.

disability-commissionaccessibilityhandicap-parkingparkshealthcaremeeting-minutes
Tue Jan 7, 2025

School Committee

School Committee to vote on $943k grant, reorganize officers, and approve policy changes

The Gardner School Committee will reorganize officers (Vice Chair, Finance Officer, Secretary) and vote on a consent agenda that includes accepting $943,000 in grant funds and ratifying eight warrants totaling over $3 million. They will also consider supporting an MSBA roof appropriation for the middle school, approving an easement for a Safe Route to School grant at Elm Street, and conduct first readings of 14 policies on student health, fees, and community digital resources. Recognitions for John & Abigail Adams recipients and updates on school improvement plans are also on the agenda.

school-committeebudgetgrantspoliciesfacilitiessafe-routespublic-comment
✓ Decided: School Committee supports Gardner Middle School roof replacement project

The Gardner School Committee voted to support the Gardner Middle School roof replacement project and the appropriation for a feasibility study, allowing the school to enter the MSBA's Accelerated Repair Program. The committee also approved the consent agenda, including $943,000 in grant funds and multiple warrants, and elected new officers for the year. Several policies were adopted or removed, and an easement for the Safe Routes to School project was donated.

Mon Jan 6, 2025

City Council

City Council to elect president, handle routine business

This is a regular meeting of the Gardner City Council. The agenda is largely procedural, including the election of the Council President, approval of prior minutes, and standard administrative items. No specific ordinances, contracts, or public hearings are listed for action.

electioncity-councilorganizationalprocedure
✓ Decided: Gardner City Council elects George Tyros as 2025 Council President

The Gardner City Council held its regular meeting on January 6, 2025, and the only substantive action was the election of a Council President for the year. Councillor George Tyros was nominated and elected by a 10-0 vote (with Tyros abstaining), after which he assumed the chair. No other business was conducted, as there were no minutes to approve, no petitions, no committee reports, and no unfinished business.