The Boring PartsFederalLocal · USLocal · Canada

Geary County, Kansas

Recent Geary County public meeting topics include budget & taxes, contracts & procurement, public safety, roads & infrastructure, water & utilities, resolutions & ordinances.

Topics found in recent meetings

Recent Geary County meeting summaries, agendas, and minutes

Get Geary County meeting alerts

One email when Geary County posts a new agenda or minutes. Free, unsubscribe anytime.

Municipal budget

US Census Annual Survey of Local Government Finances
Total revenue$55.3M (FY2023)
Total spending$32.9M (FY2023)
Taxes$20.7M (FY2023)
Debt outstanding$29.4M (FY2023)
Spending per resident$916 (FY2023)

Recent meetings

Mon Jul 20, 2026

Commissioners

Commission to review updates and hear public comment

The Geary County Commission will review weekly updates from the Human Resources Director and Public Works Superintendent. The meeting includes a closed executive session regarding non-elected personnel and a period for public comment.

commissionpublic-workshrexecutive-sessionpublic-comment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 20th, 2026 10:00-10:15 Commission review and update 10:15-10:30 Crystal Malchose, HR Director, Weekly Report 10:30-10:45 Crystal Malchose, HR Director – Executive Session for Non-Elected Personnel 10:45-11:00 Jeremie Myers, Public Works Superintendent, Bi-Weekly Report 11:00-11:15 Public Comment (5 minutes per person) 11:15 Adjourn
Thu Jul 16, 2026

Commissioners

Commissioners to discuss 2027 budget and mill rate increase

The Geary County Commission will hold a work session to review the proposed 2027 budget, which includes a request for a mill rate of 60.962, an increase of 4.661 mills over the 2026 budget. The session will cover appropriations, transfers, and revenue adjustments across various county funds.

budgettaxesfinancemill-levygeneral-fundwork-session
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 16th, 2026 Budget Work Session 3:00-4:30 Budget work session #5 MEETING: July 16, 2026 SUBJECT: 2027 Budget Work Session #5 PRESENTER: Tami Robison, Finance Director BACKGROUND The Development Worksheet, page 1, reflects actual expenditures for 2025, the 2026 expenditure budget and the 2027 proposed budget for the General fund by department. The transfers and appropriation requests are listed separately. These same categories are provided for the following funds: Debt Service, Capital Improvement, County Facilities, Special Bridge, Economic Development and the Health Department. On the left side of page 2 of the Development Worksheet, 2026 General fund budgeted revenue and 2027 proposed budgeted revenue is reflected. The right side of the page provides a summary of 2026 and 2027 General fund expenditures from page 1 and the budgeted value of a mill which is used to calculate ad valorem needs. Appropriation requests by agency are also included on a separate worksheet which includes the request history back to 2023 and denotes which funds have historically supported these requests. DISCUSSION The final day to notify the County Clerk of intent to exceed RNR is July 20, 2026. Total mills needed after the adjustments from the July 14 work session is 60.962 which equates to an increase of 4.661 mills from the 2026 budget and exceeds revenue neutral. [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 14, 2026

Commissioners

Commissioners review 2027 county budget and mill rate increase

The Geary County Commissioners will hold a budget work session to review the proposed 2027 General Fund budget. The session will examine changes that raise the required mill rate by 5.603 mills, a $732,923 decrease in the revenue‑neutral mill rate, and adjustments to appropriations and transfers across multiple departments. They will consider a 5 % administration fee of about $52,822 for court trustees, VIN, 911 and Lake Patrol, and additional revenue options such as renting county buildings, meeting space, and equipment. The agenda notes the July 20, 2026 deadline to notify the County Clerk of intent to exceed the revenue‑neutral requirement.

budgetfinancetaxesmill-rateadministration-feesrevenue
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 14th, 2026 Budget Work Session 1:30-4:30 Budget work session #4 MEETING: July 14, 2026 SUBJECT: 2027 Budget Work Session #4 PRESENTER: Tami Robison, Finance Director BACKGROUND The Development Worksheet, page 1, reflects actual expenditures for 2025, the 2026 expenditure budget and the 2027 proposed budget for the General fund by department. The transfers and appropriation requests are listed separately. These same categories are provided for the following funds: Debt Service, Capital Improvement, County Facilities, Special Bridge, Economic Development and the Health Department. On the left side of page 2 of the Development Worksheet, 2026 General fund budgeted revenue and 2027 proposed budgeted revenue is reflected. The right side of the page provides a summary of 2026 and 2027 General fund expenditures from page 1 and the budgeted value of a mill which is used to calculate ad valorem needs. Appropriation requests by agency are also included on a separate worksheet which includes the request history back to 2023 and denotes which funds have historically supported these requests. DISCUSSION The final day to notify the County Clerk of intent to exceed RNR is July 20, 2026. Based on presentation requests and other adjustments made for a schedule change from a 37.5 hour to 40 hour work week in the Attorney’s office which equates to an increase of [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 13, 2026

Commissioners

Commission to review 2025 audit and receive routine reports

The Geary County Commission will conduct a routine meeting with updates from the HR director and sheriff, and a presentation of the 2025 audit by an outside CPA. No major decisions or public hearings are scheduled; the agenda consists primarily of informational items and public comment.

county-commissionauditreportspublic-comment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 13th, 2026 10:00-10:15 Commission review and update 10:15-10:30 Crystal Malchose, Human Resources Director, Weekly Update 10:30-10:45 Sheriff Nate Boeckman, Bi-Weekly Report 10:45-11:00 Jacob Kujath, James Gordon & Associates, CPA-Present 2025 Audit 11:00-11:15 Public Comment (5 minutes per person) 11:15 Adjourn
Wed Jul 8, 2026

Commissioners

Geary County holds 2027 budget work session

The County Commission is reviewing proposed budgets for 2027, including the General Fund and special districts. The Finance Director presented a proposed General Fund mill levy of 64.124, which exceeds the revenue neutral rate.

budgettax-ratefire-districtlibrarywater-sewer
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 8", 2026 1:30-3:30 Budget work session Geary County 2027 NOTICE OF BUDGET AND RATE HEARING Prior Year Actual 2025 | Current Vi Estimate 2026 Proposed Budget Year 2027 Actual ‘Actual | Budget July 1,2026 | Proposed Expenditures | Tax | Expenditures | Tax | Authority for |Aountof2026) “pointed | Bétimated Tax |. Revenve cyst Ratet Rate* | Expenditures {Ad Valorem Tex! oration Rates | Neutral Rare Special District Fumds Fire District #1 (730) 391,009 | 5.074 331,004 | 7.050 395,020 548,045 | 69,108,296 7930 6.758] [Water District #2 (784) 12,182 | __7.874 26,045 | __ 7.234) 68,556 6695 | __ 1,015,177 6.595] 6.595 Sewer District #4 (785) 31,910 | 18.171 37,598 | 16.692 244.279 15.450 | 1,015.17 15.219 15219 Dorothy Bramloge Library (008) 120,000 | — 1.313} 120,000 | _ 1.229] 130,000 723,963 | 91,008,437 1362 1175 a A 0 0 0 0 n 0 0 nq 0 0 0 0 0 0 n @ 0 0 0 0 n r) n 0 0 0 0 r 0 Q ny 0 @ 0 0 r 0 0 0 ° 0 0 n 0 0 r) 0 0 0 0 0 0 0 0 0 r) ry 0 ¢ 0 0 r 0 @ 0 0 n a 0 0 0 @ 0 0 0 Q 0 0 0 0 r q @ 0 0 ° 0 0 @ 0 0 0 r) 0 0 0 Q 0 0 0 0 0 r n @ 0 r ny 0 @ 0 r n 0 0 0 Q r oO oO i‘) o i] “Tax rates are expressed in mills *¢Revenue Neutral Rate as defined by KSA 79-2988 Clerk Page No. Follow procedure in KSA 79-2988 to exceed RNR Follow procedure in KSA 79-2988 to exceed RNR State of Kansas County Special Distret 2026 Fire Budget Worksheet Revenue Sources Expenditures _DelqComp _Ad Valorem Tax Rate 2022 Budget 129,639 26 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 6, 2026

Commissioners

County Commission holds budget work session, considers RFP for courthouse project

The Geary County Commission will meet for a budget work session from 2-5 PM after a morning of regular business. Items include a report on the drunk driving prevention program, monthly financials, opening RFPs for the courthouse boiler room double door project, and considering an appropriation resolution and EDC board appointments. A public comment period is scheduled at noon.

budgetcounty-commissionpublic-worksrfpcourthousedrunk-driving-preventioneconomic-development
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 6th, 2026 9:30-9:45 Krista Blaisdell, County Attorney, conference room project update 10:00-10:15 Commission review and update 10:15-10:30 Crystal Malchose, HR Director, Drunk Driving Prevention Program 10:30-10:45 Tami Robison, Finance Director-Monthly Financials 10:45-11:00 Garry Berges, Emergency Management Director, Rural Fire Chief-Monthly Report 11:00-11:30 Jeremie Myers, Public Works Superintendent-Bi-Weekly Report, Opening RFP’s for Courthouse boiler room double door project 11:30-11:45 Appropriation Resolution/EDC Resolution, EDC Board Appointments 11:45-12:00 Jacqie Reisinger, Register of Deeds, Quarterly Report 12:00 Public Comment (5 minutes per person) 12:15 Recess until budget work session 2:00-5:00 Budget work session Composition of Cash Balances and Investments Geary County As Of: 6/30/2026 Net Bank Balance Investments Cash on Hand/ In Transit Total Cash and Cash Items Cash on Hand Bank $10,550.00 $0.00 $0.00 $10,550.00 Certificate of Deposit CENTRAL NATIONAL BANK $0.00 $6,000,000.00 $0.00 $6,000,000.00 Demand and Time Deposits CENTRAL NATIONAL BANK $33,886,188.04 $0.00 $0.00 $33,886,188.04 State Investment Pool OMIP $0.00 $1,893,632.23 $0.00 $1,893,632.23 $33,896,738.04 $41,790,370.27$7,893,632.23 $0.00 Page 1 of 17/2/2026 8:15:35 AM Report ID: BKLT30 trobison52Operator: TREASURER'S DUPLICATE STMT AND VOUCHERS SHEET AND VOUCHERS DAILY STATEMENT June 30 2026 GEARY COUNTY TREASU [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026

Commissioners

✓ Decided: Joint meeting discusses future structure of Chamber of Commerce and organizations

The City and County commissioners met to discuss operational scenarios for the Chamber of Commerce, EDC, MAC, and CVB. Discussion focused on whether these entities should fall under city or county control and the need for new board member appointments. No formal votes or substantive decisions were recorded during this meeting.

📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
SPECIAL CITY/COUNTY/CHAMBER JOINT MEETING MINUTES June 29", 2026 County Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont City Commissioners Present: Mayor Terry Butler, Pat Landes, Sam Yoskowitz, Kelly Niemczyk, Richard Pinaire County Counselor: Betsy Edwards City Attorney: Britain Stites Also present: Therese Hoff, Deputy County Clerk, Tami Robison, Geary County Finance Director, Kim Zimmermanm, City Manager, Mike Montoya-Attorney for the Chamber, Ashley King-Chamber President, Ron Johnson-EDC/Chamber, Jim Schmidt-Chamber/JC 1st Geary County Commission Chairman Tremont called the Joint meeting to order at 6:30 p.m. The pledge of allegiance was recited, Updates & comments by Junction City Area Chamber of Commerce Chairperson and Interim President of Operations, Ashley King and Attorney Mike Montoya. Mr. Montoya discussed different scenarios of operation for the Chamber of Commerce-put the MAC under the City, CVB under the County and the EDC under the City. Commissioner Giordano would like to see it the way it was previously. Mr. Johnson said there needs to be an independent director-not the EDC or Chamber director, the job needs to be separated, there is too much for a person to do both. There could be a sales tax implemented to fund the Chamber. Mayor Butler asked about the terms of office for the board members and term limits. It was a consensus of the group that new board members need to be appointed for the members whose term has expired, When [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 22, 2026

Commissioners

Commissioners to review 2027 budget with proposed 7.823 mill tax increase

The Geary County Commission will review the 2027 budget development worksheet, which proposes a total mills of 64.124, an increase of 7.823 mills from 2026, exceeding revenue neutral. The board will also consider a proposed moratorium on alternative energy and data center development. Other agenda items include an executive session on the interlocal agreement with the Chamber of Commerce and City of Junction City, and reports from the HR director, sheriff, and health department.

budgettax-increasezoningmoratoriumalternative-energydata-centersexecutive-sessionpublic-hearing
✓ Decided: Commission approves temporary moratorium on energy and data center developments

The Commission approved a 12-month moratorium on applications for alternative energy facilities and data center developments. They also authorized a meeting with the Chamber of Commerce and the Mayor of Junction City to discuss an interlocal agreement. Additionally, the Commission reviewed the 2027 budget development worksheet and scheduled a work session.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 22nd, 2026 10:00-10:15 Commission review and update 10:15-10:30 Crystal Malchose, HR Director-Weekly Update 10:30-10:45 Executive Session per K.S.A. 79-4319(b)(2) for legal matters pertaining to the interlocal agreement with the Junction City Area Chamber of Commerce and the City of Junction City. 10:45-11:00 Nate Boeckman, SheriƯ, Bi-Weekly Report 11:00-11:45 Tami Robison, Finance Director-Budget Worksession-2027 Valuation, Budget Developmental Worksheet 11:45-12:00 Charles Martinez, Health Department Director, Monthly Meeting 12:00 Public Comment (5 minutes per person) 12:15-12:30 Troy Livingston, GIS/Zoning Director-Proposed moratorium on alternative energy and data center development 12:30 Adjourn MEETING: June 22, 2026 SUBJECT: 2027 Development Worksheet PRESENTER: Tami Robison, Finance Director BACKGROUND The Development Worksheet, page 1, reflects actual expenditures for 2025, the 2026 expenditure budget and the 2027 proposed budget for the General fund by department. The transfers and appropriation requests are listed separately. These same categories are provided for the following funds: Debt Service, Capital Improvement, County Facilities, Special Bridge, Economic Development and the Health Department. On the left side of page 2 of the Development Worksheet, 2026 General fund budgeted revenue and 2027 proposed budgeted revenue is reflected. The right side [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES June 22", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Giordano: Stated last Wednesday, Vicki Schmidt, candidate for governor was in the city, some leaders in the community were invited to talk to Ms. Schmidt about concerns in the community. Stated on Thursday, she was invited by Senator Marshall’s office to be at a round table with HUD, SBA, and USDA-talked about projects and concerns-water, housing, childcare, infrastructure-resources were provided. EPA just came out with some grants, she talked about Laurel Canyon and the needs there. It was good information and a good meeting. Ascher: Attended a Flint Hills MPO meeting-the financials look good. A program called Fort Riley Safe Passage for the soldiers-vouchers are issued to soldiers for captains and lower rank, 2- $30 vouchers per year, help them get transportation to Manhattan and Junction City, and not drive impaired. They had 585 rides worth $13,000.00. It is working really well. Attended a PBC meeting-Jeff Kline, Maintenance Supervisor with the hospital gave an update on deferred maintenance- all big central electrical projects are done, next job is plumbing, sinks, toilets to be completed next spring [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 15, 2026

Commissioners

County to decide on $12,400 bridge inspection agreement with KDOT

The Geary County Commission will review and possibly approve a federal-aid bridge inspection master agreement with KDOT for 2026, covering multiple bridges at a total county cost of $12,400. The meeting also includes weekly updates from HR and Public Works, followed by public comment.

county-commissionbridgesinfrastructurepublic-workskdotbudgetgeary-county
✓ Decided: Commissioners approve local emergency and several public works agreements

The Geary County Commission approved a State of Local Emergency due to recent storms. Additional actions included approving water system grant agreements, road closures, and safety resolutions.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 15th, 2026 10:30-10:45 Commission review and update 10:45-11:00 Crystal Malchose, HR Director, Weekly Update 11:00-11:30 Jeremie Myers, Public Works Administrator-Bi-Weekly Report 11:30-11:45 11:45-12:00 12:00-12:15 Public Comment (5 minutes per person) 12:15 Adjourn Agreement 177-14 Geary County Bridge Number Type Location Description Estimated Cost (County's Share) 000310873604441 NSTM 4.0S OF JUNCTION CITY 000310879404545 NSTM 5.5S 3.0E OF WREFORD UW (Underwater) 106 C-4906-04 PH (Pin and Hanger) 106 C-4864-03 NSTM (Nonredundant Steel Tension Member) 106 KA-4089-03 EL (Element Level data collection) Issued: By: Bridge Section, KDOT- Bureau of Local Projects $6,550.00 $5,850.00 "Special Attachment No. 2" FEDERAL - AID BRIDGE INSPECTION Statewide Bridge Inspection Master Agreement 2026 Structure List $12,400.00 Type: 6/2/2026 Lynn Berges
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES June 15", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont (on vacation) Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Vice-Chairman Giordano called the County Commission meeting to order at 10:30 a.m. The pledge of allegiance was recited. Garry Berges, Emergency Management Director presented a proclamation of a State of Local Emergency for Geary County, Kansas because of the recent storms. Commissioner Ascher moved to approve Resolution 6-15-2026: a proclamation of a State of Local Disaster Emergency for Geary County; Commissioner Giordano seconded and both voted aye. Mr. Berges left the meeting. Commission review and update: Ascher-No meetings last week. Attended the Juneteenth event. Stated the Chamber of Commerce Chairman sent out an update on what is going on at the Chamber-a CPA has been hired and is going to review the financials and an attorney has been hired. Giordano-Attended Lt. General Matt Hardman’s going away ceremony at Fort Riley. Attended the employee .task force meeting-the HR Director will give a report. Attended the childcare coalition meeting, they are working with providers and assisting them. Attended the Juneteenth event. Crystal Malchose, HR Director gave the weekly report: e Reminded the commission that this Friday, June 19, the county offices will be closed for the Juneteenth holiday. e Employee training day is scheduled [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 11, 2026

Commissioners

County Commission holds budget work session with department requests

This is a budget work session where department heads present their funding requests for the upcoming fiscal year. No votes or decisions are scheduled; the meeting is for discussion and information gathering only.

budgetcounty-commissionwork-sessionpublic-safetyhealth-department
✓ Decided: Commissioners review various 2027 budget requests during work session

The Geary County Commission held a budget work session to review requested funding amounts for several departments and services. No formal votes or decisions were recorded during this meeting.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Budget Work Session Schedule June 11th, 2026 1:30 p.m. Budget request presentation-Garry Berges, Curt Janke-Rural Fire/Emergency Management 1:40 p.m. Budget request presentation-Courtney Gilbert-Elections/Clerk 1:50 p.m. Budget request presentation-Troy Livingston-GIS/Planning, Zoning, Sanitation 1:55 p.m. Budget request presentation-Travis Lilly-Appraiser 2:05 p.m. Budget request presentation-Charles Martinez-Health Department 2:20 p.m. Budget request presentation-Crystal Malchose- Human Resources 2:30 p.m. Budget request presentation-Tami Robison-CIP , General Services, Special Bridge, Finance, Commissioners, EDC, Opioid, Debt Service, Special Alcohol, CVB 3:00 p.m. Budget request presentation-Judge Sexton, Nikki Davenport, Stephanie Petrie-District Court, Court Trustee 3:15 p.m. Budget request presentation-Nate Boeckman-SheriƯ 3:30 p.m. Budget request presentation-Jeremie Myers, Kalyn Ross-Noxious Weed, Waste Disposal, Landfill, Public Works, Water/Sewer Districts, Parks/Rec, Cloud County Community College, Facilities 4:00 p.m. Budget request presentation-Krista Blaisdell-County Attorney
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
BUDGET WORK SESSION MEETING OF THE GEARY COUNTY COMMISSION MINUTES June 11%, 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor (absent) ' Chairman Tremont called the County Commission meeting to order at 1:30 p.m. Members of the public arriving at the meeting: Gary Olds, Lisa Eickholt, Gerald Gerloff Garry Berges, Emergency Management Director/Rural Fire Chief and Assistant Director Curt Janke, 2027 budget request - Rural Fire District: $595,020.00 Emergency Management: $291,956.00 Courtney Gilbert, Clerk/Elections- 2027 budget request — Clerk: $264,579.00 Election: $213,454.00 Troy Livingston, GIS Director Planning/Zoning/Sanitation- 2027 budget request - $306,759.00 Travis Lilly, County Appraiser- 2027 budget request - $656,171.00 Charles Martinez, Health Department Director - 2027 budget request - $329,802.00 Crystal Malchose, Human Resources Director - 2027 budget request - $388,402.00 Tami Robison, Finance Director - 2027 Finance Office budget request - $382,361.00 2027:BOCC budget request - $192,975.00 2027 General Services budget request - $12,782,013 2027 Debt Services budget request - $4,682.909.00 2027 Economic Development budget request - $507,183.00 2027 Special Alcohol budget request - $100,999.00 2027 Opioid budget request - $128,432.00 2027 CIP - $2,981,826.00 2027 Special Bridge budget request - $911,431.00 2027 CVB budget request - $1,126,699 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 8, 2026

Commissioners

Commission holds executive session on Interlocal Agreement legal matters

The Geary County Commissioners will meet to review routine reports and then enter an executive session to discuss legal issues concerning the Interlocal Agreement with Junction City and its Chamber of Commerce. After the session, public comment is scheduled, followed by a series of budget request presentations covering departments such as the Mainstreet project, Emergency Shelter, Pawnee Mental Health, Library, and Register of Deeds. The agenda also includes a Treasurer’s daily cash and investment statement for May 29, 2026.

budgetlegalinterlocal-agreementfinanceexecutive-sessionpublic-comment
✓ Decided: Commission expresses no confidence in EDC Director and restricts Chamber funding

The Commission issued a vote of no confidence in the EDC Director and ordered the cessation of all non-essential fund disbursements to the Chamber. Additionally, the Board voted to prepare notice to renegotiate or terminate the interlocal agreement governing the Chamber, EDC, and MAC.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 8th, 2026 10:00-10:15 Commission review and update 10:15-10:30 Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 Tami Robison, Finance Director, Financial Reports 10:45-11:00 11:00-11:15 Nate Boeckman, SheriƯ-Bi-Weekly Report 11:15-11:45 Executive Session under 75-4319(b)(2)-Discuss legal matters related to the Interlocal Agreement between Geary County, Junction City and the Junction City Area Chamber of Commerce 11:45-12:00 12:00-12:15 Public Comment (5 minutes per person) 12:15 Adjourn 5:00 p.m. Budget request presentation-Mainstreet-Jordan McCann 5:15 p.m. Budget request presentation-Emergency Shelter-Debbie Savage 5:30 p.m. Budget request presentation-Pawnee Mental Health-Michael Rezkalla 5:50 p.m. Budget request presentation-Library-Donna Porter 6:00 p.m. Budget request presentation-Register of Deeds-Jacqie Reisinger 6:10 p.m. Budget request presentation-Community Involvement Team-Laura Rhodes, Cayla Da Giau 6:20 p.m. Budget request presentation-EDC, MAC, Chamber-Mickey Dean 6:50 p.m. Budget request presentation-Jana Williams, Kent Glasscock, Flint Hills Regional Council 6:55 p.m. Budget request presentation-JC EMS-Jason Lankas 7:10 p.m. Budget request presentation-Big Lakes-Liz Holle 7:25 p.m. Budget request presentation-Area Agency on Aging-=Julie Govert Walter TREASURER'S DUPLICATE STMT AND VOUCHERS SHEET AND VOUCHERS DAILY STATEMENT May 29 2026 GEARY COUNTY TREASURER SHERRI CH [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES June 8%, 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: e Tremont-Did not have any meetings last week. She thought the first budget work session went well last week, wished there were more public there. Sad weekend with the little boy that was missing-proud of our law enforcement and community that pulled together to assist with the search. Ascher-Did not have any meetings last week. He also stated he was proud of the groups that pulled together to assist with the search. Giordano-Spoke to the Sheriff’s Department about the search for the missing boy, there were hundreds of people helping. Stated her and Tami Robison, Finance Director spoke to the Landlord Association. Attended the CVB meeting-The new director will be starting soon, and they discussed how to bring more people to the community. Last year the first quarter was the worst year Geary County had for TGT collection since 2020. Attended the ribbon cutting to Flint & Vine-very nice addition to the area. Henry Petty arrived at the meeting. Deputy Clerk Hoff asked to amend the agenda. Commissioner Giordano moved to amend the agenda to add an executive session under 75-4319(b) (2) legal matters related to R [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 3, 2026

Commissioners

Budget worksession features 15 agency presentations for Geary County

The Geary County Commission holds a budget worksession to hear funding requests from multiple agencies, including Juvenile Detention, Flint Hills Regional Leadership, Extension & Free Fair, Opera House, Historical Society, ATA Bus, Senior Citizens Center, FHMPO, and others. Presentations are scheduled in 10- to 15-minute slots from 5:00 p.m. to 7:40 p.m. No votes or decisions are scheduled; this is a discussion and information-gathering session.

budgetcounty-commissionjuvenile-detentionpublic-transitsenior-serviceshistorical-societycommunity-events
✓ Decided: Commission meeting adjourned without any decisions on 2027 funding requests

The Geary County Commission met on June 3, 2026, heard public comments on numerous 2027 funding requests, and discussed the source of some funds. No approvals, denials, or votes on any of the listed requests were recorded. The meeting was adjourned at 8:15 p.m.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Budget Worksession Schedule June 3rd, 2026 5:00 p.m. Budget request presentation-Juvenile Detention-Angela Hamilton/Shawn Brandmahl 5:10 p.m. Budget request presentation-Flint Hills Regional Leadership-Jack Lindquist 5:20 p.m. Budget request presentation-Extension & Free Fair-Ginger Kopfer 5:35 p.m. Budget request presentation-Opera House-Ellie Dillon 5:45 p.m. Budget request presentation-Historical Society-Heather Hagedorn, Bill Powers 5:55 p.m. Budget request presentation-ATA Bus-Anne Smith, Rebecca Doehling, Daphne McNelly 6:15 p.m. Budget request presentation-Senior Citizens Center-Sally Jardine, Joe Mitchell 6:25 p.m. Budget request presentation-FHMPO-Jared Tremblay 6:35 p.m. Budget request presentation-Three Rivers-Erica Christie, Barb Kephart, Ashley Wolfrum 6:45 p.m. Budget request presentation-Becky Osbourn 6:55 p.m. Budget request presentation-Sherri Childs, Treasurer 7:05 p.m. Budget request presentation-Conservation District-Angela Beavers, Rod Gfeller, Shelby Richling, Gary Schellhorn, Brandon Dibben, Scott Miller, Bethanee Yarnell 7:15 p.m. Budget request presentation-Community Corrections Recovery Court-Chrysann Phipps 7:25 p.m. Budget request presentation-Freedom Fest-Nathan Butler, Bob Story 7:40 p.m. Budget request presentation-Harmony Center & Fest-Martine Chery
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES June 3rd, 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk Chairman Tremont called the County Commission meeting to order at 5:00 p.m. The pledge of allegiance was recited. Members of the public arriving at the meeting: Henry Petty, Lisa Eickholt, Gerald Gerloff, Gary Olds North Central Kansas Regional Juvenile Detention Facility, Angela Hamilton- 2027 request-$247,292.08 Flint Hills Regional Leadership Program, Jack Lindquist 2027 request-$1,000.00 Extension Office-Ginger Kopfer, Renae Riedy, Verle Amthauer, Josh Haynes 2027 request-$374,000.00 4H Fair-Ginger Kopfer, Renae Riedy, Amy Blockcolsky-4H Fair 2027 request-$18,000.00 CL Hoover Opera House-Ellie Dillon, Executive Director 2027 request-$60,000.00 Geary County Historical Society-Heather Hagedorn, Bill Powers 2027 request-$105,000.00 ATA Bus-Anne Smith, Rebecca Doehling, Daphne McNelly 2027 request-$140,000.00 Senior Citizen Center- Sally Jardine, Amy Osbourn, Joe Mitchell 2027 request-$170,000.00 Flint Hills MPO-Jared Tremblay 2027 request-$1,791.93 Three Rivers-Erica Christie 2027 request-$15,000.00 Circle A Club-Becky Osbourn, Charles Osbourn, Tom Grelk 2027 request-$8,734.00 (Special Alcohol Fund) County Treasurer, Sherri Childs 2027 request-$665,509.00 Community Corrections Recovery Court- Chrysann Phipps 2027 request-$26,000.00 (Opioid Funds) Minutes 06-03-2026 P [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 1, 2026

Commissioners

County Commission to decide on storage facility conditional use permit

The Geary County Commission will hear a recommendation from the Planning Commission to approve a Conditional Use Permit for boat/RV and walk-in storage at 4308 N US77 Hwy, Junction City. The property is zoned Suburban Residential and has been vacant for decades. The Commission will also receive routine departmental reports and a quarterly update from Pawnee Mental Health.

conditional-use-permitzoningstoragepublic-hearingcounty-commissionmental-healthpublic-works
✓ Decided: Commission approved $78,933 LED lighting upgrade for county buildings

The commission voted unanimously to accept a comprehensive LED lighting upgrade for the Courthouse, Office Building and Public Works facilities, allocating $78,933 from the special CIP. Additional approvals included a $250 KDOT right‑of‑way purchase, a $40 fee for undeclared freon units, and several utility easement requests. The meeting also set dates for upcoming budget presentations and a future RFP for a courthouse boiler room project.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 1*, 2026 10:00-10:15 | Commission review and update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report 10:45-11:00_| Garry Berges, Emergency Management Director, Rural Fire Chief, Monthly Report 11:00-11:30 | Jeremie Myers, Public Works Administrator-Bi-Weekly Report 11:30-11:45 | Troy Livingston, GIS/Zoning-Conditional Use request for a storage facility 11:45-12:00_| Pawnee Mental Health-1* Qtr. Update 12:00-12:15 | Public Comment {5 minutes per person) 12:15 Adjourn GEARY COUNTY PLANNING COMMISSION/ BOARD OF ZONING APPEALS STAFF REPORT May 12, 2026 TO: Geary County Planning Commission / Board of Zoning Appeals FROM: Troy Livingston, Director of Planning and Zoning/GIS SUBJECT: GCCU-05-01-26 — Request for a Conditional Use Permit to allow Boat/RV storage on property zoned “SR” Suburban Residential This is the request of Simon Smith, agent on behalf of Michael Smith, owner, requesting a Conditional Use Permit to allow boat/RV storage on property zoned “SR” Suburban Residential District located at 4308 N US77 Hwy, Junction City, Geary County, Kansas. BACKGROUND Mr. Smith contacted my office asking about the possibility of utilizing the property at 4308 N US77 Hwy as boat/RV storage. His intention is to remove all existing structures, do all of the required preparatory dirt work, construct new facilities and use the property for boat/RV storage [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES June 1°, 2026 Commissioners Present: Keith Ascher, Trish Giordano (Joined the meeting by phone), and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. Commissioner Giordano joined the meeting by phone. The pledge of allegiance was recited. Henry Petty arrived at the meeting. Commission review and update: Ascher: Attended the Chamber Board of Directors meeting-the first 40 minutes was executive session, when the meeting resumed there were three motions on the table approved- hire legal counsel for the chamber, have a forensic audit done, board needs training on what the board should be doing. It was decided to get all wrapped up by June 25, then have a special meeting on June 25 at 3:30. Raised $13,000.00 at the golf tournament, new teacher’s breakfast is Wednesday, July 29, 2026 MAC-no director-no report-work through the city. EDC-The Chamber submitted a recommendation to separate from the master agreement, but that was tabled until the special meeting on June 25. There was a brief discussion about the pros and cons of data centers. JC Proud had a clean-up yesterday from 8:00 a.m. to noon. Tremont-Attended the Pawnee Mental Health Board Meeting-mainly talked about finances and budget. Attended the EDC Board meeting-talked about the separation-concerns of both sides, director has too many [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 26, 2026

Commissioners

Public hearing on negotiated sale of 125 E. Elm

The County Commission will hold a public hearing on the negotiated sale of 125 E. Elm under K.S.A. 79-2803(b). They will also review weekly reports from HR and the Sheriff, appoint a Homeless Task Force member, and receive a monthly update from the Health Department. An executive session on non-elected personnel is scheduled.

commissionpublic-hearingproperty-salehealth-departmenthomeless-task-forcepersonnel
✓ Decided: Commission approved $1,000 sale of 125 E. Elm property

The commission accepted a $1,000 bid for the property at 125 E. Elm after a public hearing. Commissioners also appointed Kristy Upham to the Homeless Task Force board and approved a $300 allocation to the RERC from CVB funds. Additional actions included approving agenda amendments, change orders, and the prior meeting minutes.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 26", 2026 10:00-10:15 | Commission review and update 10:15-10:30_| Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45_ | Homeless Task Force Appointment 10:45-11:00 | Nate Boeckman, Sheriff-Bi-Weekly Report 11:00-11:15_ | Charles Martinez, Health Department Director-Monthly meeting 11:15-11:30 | Executive Session-Non-Elected Personnel 11:30-11:45 | Public Hearing for Negotiated Sale of 125 E. Elm under K.S.A. 79-2803(b) 11:45-12:00 12:00-12:15 | Public Comment (5 minutes per person) 12:15 Adjourn Geary County Health Department 1212 West Ash Street P. O. Box 282 Prevent ic Health Junction City, Kansas 66441 26 May 2026 Geary County Board of Health GCPHD Monthly Update 1. Updates Trooper Gate Discussion GCPHD met with Fort Riley Public Health and Mayor Butler to conduct fact-finding regarding the Trooper Gate closure, including its purpose and potential public health impacts. As a result of the meeting, Mayor Butler will explore what would be required to repair the bridge, and Fort Riley Public Health will request additional information from division leadership. GCPHD Leasing Space GCPHD is coordinating a consultation with local realtors to determine a fair market rate for leasing available office space within the Health Department to public health-adjacent agencies. The intent is to utilize unused space to support organizations that align with the social determinants of health model and improve community [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES May 26", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. Citizens arriving at the meeting: Kristy Upham and Henry Petty. The pledge of allegiance was recited. Commission review and update: Giordano: Commissioner Giordano moved to amend the agenda to approve giving the RERC $300 from CVB funds; Chairman Tremont seconded and all voted aye. Attended the Flint Hills Regional Council tabletop exercise event. Garry Berges, Emergency Management has good disaster plans. Attended the Chamber membership meeting- discussion about the finances, concerns how things were handled with MAC and going forward, the Chairman will be discussing things with the entire board this week, Attended the Business During Hours at the Spruce Suites Retirement Living-toured the apartments-very nice and an asset to the community. Stated she thought there were good applicants for the CVB director position and hopes to get it taken care of soon. Tremont-Attended the Juvenile Detention board meeting-they are going to hire Angela Hamilton as the new director starting on October 1, she has been working with current director Brandmahl. Ascher- Attended the Risk Management meeting last week-there is still $700 of RAG money left if any department needs it for safety [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 18, 2026

Commissioners

Commission to appoint Homeless Task Force member

The Geary County Commission will review routine reports and consider an appointment to the Homeless Task Force. An executive session for non-elected personnel recruitment is scheduled. A joint City/County/USD meeting is set for 5:30 PM at the C.L. Hoover Opera House.

appointmenthomeless-task-forceexecutive-sessionrecruitmentjoint-meetingymcapublic-works
✓ Decided: Commission approved $44,020 East Street repair project

The Geary County Commission approved funding for an East Street repair using Shilling Construction, and also approved a $15,000 YMCA equipment request, multiple utility and contract renewals, and tax roll corrections. All motions were moved, seconded, and passed with all commissioners voting aye. The meeting also included an executive session and approval of the prior meeting minutes.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 18", 2026 10:00-10:15 | Commission review and update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45_| Homeless Task Force Appointment 10:45-11:00 | Amber Stanley, CEO-YMCA-Update 11:00-11:30 | Jeremie Myers, Public Works Administrator-Bi-Weekly Report 11:30-11:45_| Executive Session, Non-Elected Personnel, Recruitment 11:45-12:00 12:00-12:15 | Public Comment (5 minutes per person) 12:15 Adjourn 5:30 Joint City/County/USD Meeting-C.L. Hoover Opera House Kansas Department of Agriculture Leafy Spurge (Euphorbia virgate) Canada Thistle (Cirsium arvense) Click on QR Code to learn more about Kansas noxious weeds. Kansas’ Nox Hoary Cress (Lepidium draba L.) Quackgrass (Elymus repens) (Pueraria montana ous Weeds Kudzu Russian Knapweed (Rhaponticum repens) var. lobata) Category B Common Teasel (Dipsacus fullonum) Cutleaf Teasel (Dipsacus laciniatus) Category A: Limited distribution in Kansas, subject to active eradication to prevent establishment. Category B: Discrete distributions in Kansas, subject to control wherever established and subject to active eradication wherever not established. Category C: Well-established in larger populations in Kansas. New populations subject to control efforts and established populations shall be managed by approved control methods. Kansas Department of Agriculture Plant Protection and Weed Control 1320 Research Park Drive Manhattan, KS 66502 785-56 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES May 18", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Ascher-Did not have meetings to attend last week. Congratulations to all the graduates in the area. Attended the Run for the Wall Sunday. CVB received a plaque for sponsorship of the event. Tremont: Attended the EDC Board meeting last Thursday. Discussed-destination boot camp-11 are going to attend, Opportunity zone 2.0-working with the city, budget request from the county for EDC- same as last year. The City Manager talked about the Homeless Task Force appointment; it is an eleven- member board-1 representative from the county to be appointed by the board- Kristy Upham is interested in the position. It is a 3-year term that may be re-appointed. Commissioner Giordano stated the word should be put out to see if anybody is interested in the position- it will be on the agenda next week. The City Manager sent information about the convention center cooperation and escrow agreements- reviewed by Counselor Edwards-office space available in the convention center discussion. Attended the Mainstreet Market on Saturday. Giordano: Attended a childcare round table discussion-it included the city and county and busi [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026

Commissioners

Commissioners to vote on Sewer #4 Improvement Project resolution

The Geary County Commission will discuss and vote on a resolution for the Sewer #4 Improvement Project. The meeting also includes weekly reports from Human Resources and Finance, a presentation of the KCAMP Risk Management Award, and a period for public comment.

sewerinfrastructurepublic-worksrisk-managementcounty-commissionfinancehuman-resources
✓ Decided: Commission approved loan and funding actions for Sewer #4 improvement

The commission accepted a $136,000 loan resolution, approved the request for obligation of funds, and approved a letter of intent to meet USDA Rural Development conditions for the Sewer #4 project. All three actions were moved, seconded, and passed unanimously. The meeting also approved the new holiday pay policy and the minutes from previous meetings.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 11", 2026 10:00-10:15 | Commission review and update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report & Financial Reports 10:45-11:00 | Patrick Smith, KCAMP Present Risk Management Award 11:00-11:15 | Jeremie Myers-Public Works Administrator-Discussion & Approval of a resolution for Sewer #4 Improvement Project 41:15-11:30 11:30-11:45 11:45-12:00 12:00-12:15 | Public Comment (5 minutes per person) 12:15 Adjourn Geary County Composition of Cash Balances and Investments As Of: 4/30/2026 Cash on Hand/ Net Bank Balance Investments In Transit Total Cash and Cash Items Cash on Hand Bank $10,550.00 $0.00 $0.00 $10,550.00 Certificate of Deposit CENTRAL NATIONAL BANK. $0.00 $6,000,000.00 30.00 $6,000,000.00 Demand and Time Deposits CENTRAL NATIONAL BANK. $30,880,874.15 $0.00 $0.00 $30,880,874.15 State Investment Pool OMIP $0.00 $1,882,481.56 $0.00 $1,882,481.56 $30,891,424.15 $7,882,481.56 $0.00 $38,773.905.71 Operator: frobison52 5/4/2026 11:12:23 AM Page 1 of 1 Report ID: BKLT30 TREASURER’S DUPLICATE STMT AND VOUCHERS SHEET AND VOUCHERS DAILY STATEMENT DAILY COLLECTIONS HEALTH DEPARTMENT TRANSFER STATION ACH MISCELLANEOUS DEPOSITS MORNING BALANCE TOTAL DAY'S PAYMENTS MISCELLANEOUS DEBITS EVENING BALANCE Sports C omplex-CD WASTE DISPOSAL CNB CD CNB-New CD'S OMIP CENTRAL NATIONAL BANK CASH IN DRAWER & PETTY CASH TOTAL April 29 2026 GEARY [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES May 11%, 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commissioner Giordano apologized to the Chairman for taking over the meeting last Monday during the public comment. She felt it was escalating and should be shut down. Chairman Tremont appreciated her stepping up and doing that. Commissioner Giordano moved to amend the agenda to add an executive session for non-elected personnel/recruitment for 15 minutes te include the HR Directer and County Counselor; Chairman Tremont seconded and all voted aye. Commission review and update: Giordano: Attended a Flint Hills Executive Board meeting. Attended the Mainstreet transformation strategy meeting-they asked questions about the community-so they can evaluate and see what we need to work on. Attended a CVB meeting-most of the members attended-several sponsorships in the community were approved. Attended the ECC Ribbon cutting-very well attended event. Ascher-Did not have any meetings last week. Attended the ECC ribbon cutting, impressed with the crowd, well organized event. Tremont-Attended the Mainstreet transformation strategy meeting-good to see so many people getting together to gather ideas or concerns. There were business leaders, ele [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 4, 2026

Commissioners

Commissioners to consider permit for chickens on small lots

The Board of County Commissioners will review a request to allow chickens on properties smaller than 3 acres. The meeting also includes reports from county directors and a liquor license application.

zoningagricultureliquor-licensecounty-property
✓ Decided: Commission lowers chicken acreage limit to 2 acres and approves conditional use permit

The commission accepted Dwane Diah's $1,000 offer to purchase the vacant lot at 125 E. Elm St. and approved new entrance petitions for Milford Lake Road and Humboldt Creek Road. It also accepted a $10,000 compensation from Wildcat Construction for the East Street haul‑route project and approved a $20,529.97 audio‑visual system for the commission and conference rooms, waiving the standard purchase policy. Finally, the commission adopted a resolution lowering the chicken‑keeping acreage threshold to 2 acres and granting a conditional use permit for chickens on the specified area.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 4", 2026 10:00-10:15 Commission Review and Update 10:15-10:30 Crystal Matchose, Human Resources Director, Weekly Report 10:30-10:45 Offer on unsold County Owned Property 10:45-11:00 Garry Berges, Emergency Management Director, Rural Fire Chief-Monthly Report 10:55 Break 11:00-11:30 Jeremie Myers, Public Works Administrator, Bi-Weekly Report 11:30-11:45 Executive Session-Non-Elected Personnel 11:45-12:00 Troy Livingston, GlS/Zoning Director-Conditional Use Permit 12:00-12:15 Public Comment (5 minutes per person) 12:15-12:30 Approval of Cereal Malt Beverage License-Consumption on Premises-Milford State Park Marina 12:30 Adjourn GEARY COUNTY PLANNING COMMISSION/ BOARD OF ZONING APPEALS STAFF REPORT April 14, 2026 TO: Geary County Planning Commission / Board of Zoning Appeals FM: Troy Livingston, Director of Planning and Zoning/GIS SUBJECT: GCCU-04-01-26 — Request for a Conditional Use Permit to allow farm animals/chickens on property less than 3 acres. This is the request of Steven Rickers et al., owners, requesting a Conditional Use Permit to allow chickens on property less than 3 acres. The properties are located from 807 N Milford Lake Rd. to 1109 N Milford Lake Rd., Junction City, Kansas. BACKGROUND My office received a complaint from a Geary County Sheriff's deputy on behalf of a resident in the general vicinity of KS Hwy 18 and N Milford Lake Road. The substance of the complaint was that a neighbor had chi [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES May 4", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Ascher-No meetings this week. Gave a shout out to the Immanuel Lutheran Church who celebrated their 100-year anniversary, Congratulations to them. Tremont-Pawnee Mental Health did not have their regular meeting; it was a celebration event. Giordano-Stated that Michele Rone received the Order of the Sunflower Award. Stated there will be a Primary Tabletop exercise for the OLDCC Grant. Reported there will be a RERC (Recreation Economy for Rural Communities) meeting on May 27&28, will be having a workshop, and she encourages commissioners to attend. Attended the Stormont Vail Derby fundraiser for the cardiac unit-it was a very good event and well attended. Commissioner Ascher gave a shout out to Public Works for all the work they did after all the flooding. Henry Petty arrived at the meeting. Commissioner Giordano said there was a discussion and vote last week about the new hours when Commissioner Ascher wasn’t here, but he said it was ok, he just wants to see what the public thinks about it and it is just a trial run. Maria Berkowitz, citizen arrived at the meeting. Chairman Tremont asked Ms. Berkowitz [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026

Commissioners

Geary County considers 4.5-day work week trial and capital project funding

The Commission will discuss a proposed 6-month trial of a 4.5-day work week to improve employee recruitment and retention. The body will also hold a work session on the Capital Improvement Program (CIP) to review project funding and cash positions.

employee-benefitsbudgetcapital-improvementspublic-worksgovernment-operations
✓ Decided: Commission approved purchase of 301 East 8 St property and related payment

The commission voted to sign closing documents for the property at 301 East 8 Street and to issue a check for $14,628.86 to cover title fees and the purchase balance. Commissioners also approved a $25,000 GIS concrete landing and step replacement, adopted a temporary 4.5‑day work‑week trial for six months, and approved tax‑roll correction change orders. No other actions were taken.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 27", 2026 10:00-10:15 Commission review and update 10:15-10:30 Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 Tami Robison, Finance Director, Weekly Report 10:45-11:00 Tami Robison, Finance Director-2" Qtr. CIP work session 11:00-11:30 Joint Meeting with the Public Building Commission 11:30-11:45 Sheriff Nate Boeckman, Bi-Weekly Report 11:45-12:00 Jason Lankas, Junction City Fire Chief, 1** Quarter Report-EMS 12:00-12:15 Public Comment (5 minutes per person) 12:15-12:30 Proclamation for National Treatment Court Month 12:30-12-45 Executive Session-Non-Elected Personnel 12:45 Adjourn COMMISSION AGENDA REPORT FROM: Tami Robison, Finance Director MEETING: April 27, 2026 SUBJECT: Capstone-Proposed Schedule Change BACKGROUND AND DISCUSSION Competitive pay and benefits are no longer enough to attract and keep quality employees. Because flexibility and work-life balance may be an alternative solution to this, which may also assist in recruiting and retaining quality employees, Geary County has been exploring an adjusted work schedule. However, it is imperative we maintain our current level of service to the citizens. Even after implementing a wage study, enhancing the county’s benefit package, and holding supervisory training multiple times a year, the county is stil] encountering high turnover and difficulty in filling positions. After reaching out for input from other governmental entities concerning this i [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES April 27", 2026 Commissioners Present: Trish Giordano, and Kathy Tremont, Ascher (absent) Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Giordano- Stated Mayor Butler and she attended as members of the Stan Tech team for the comprehensive plan. They met and talked about preliminary things, get acquainted with the community. This is part of the OLDCC grant, information should be going out on public outreach. Report the MAC breakfast was canceled. Attended the grand opening for the Stephen A Cohen veterans’ facility in Manhattan. Tremont: Met with the Sheriff and Pawnee Mental Health-discussed issues, look for better ways to serve the inmates, there needs to be more help from the state, once an individual is incarcerated, Pawnee Mental Health services cease, and it is the county’s responsibility to take care of them. Attended the KCCA conference in Hutchinson and it was very beneficial-they talked about data centers and property tax issues, most counties have the same issues. Chairman Tremont has asked the Finance Director and the Appraiser to put together information about where the taxes are spent and how the Appraiser sets values on property to get out to the public. Jeremie Myers, Public Works Administrator and Kalyn Ross, Administ [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 20, 2026

Commissioners

Health coalition contract terminated; commission hears updates

The commission will hear a health department report that the state terminated the Healthcare Coalition contract, removing a core emergency response component. They will also discuss a CVB marketing grant request from the Junction City Brigade, a potential policy discussion on data centers/solar/wind energy, and consider a $128,000 OPEIS contract for at-risk families. Public works items include access petitions for Kansas Falls Rd and Cutoff Rd, and a recommendation on a mowing contract with Cloud Community College.

public-healthemergency-managementgrantsenergypublic-worksroadscommission
✓ Decided: Commission approved 2026 Federal Funds Exchange and multiple infrastructure contracts

The Geary County Commission approved the 2026 Federal Funds Exchange, allowing the exchange of $176,247.88 in federal funds for $158,623.09 in state transportation dollars. It also approved a new driveway at 6212 Kansas Falls Road, a culvert on Cut‑Off Road, a mowing contract for Cloud County Community College, and an HVAC replacement for the Sheriff’s Office kitchen. All motions were passed unanimously.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 20°, 2026 Night Meeting 6:00-6:15 | Public Comment 6:15-6:45 | Jeremie Myers, Public Works Superintendent, Bi-Weekly Report 6:45-7:00 | Charles Martinez, Health Department Director, Monthly Board of Health Meeting 7:00-7:15 | Commission Review & Update-Request from Junction City Brigade for a CVB Marketing Grant 7:15-7:45 | Discussion-Data Centers, Solar & Wind Energy 7:45-8:15 | Executive Session-Legal Matters pertaining to contracts 8:15 Adjourn GEARY COUNTY PUBLIC WORKS DEPARTMENT Jeremie Myers, Public Works Administrator 310 East 8" Street, Junction City, KS 66441 (785) 238-3612 ll Public Works Board of County Commissioners Meeting Agenda Date of Meeting: April 20", 2026 1. Request and Petition Kansas Falls Rd 2. Request & Petition Cutoff Rd 3.Cloud Community College Mowing Contract Recommendation 4. SO Kitchen HVAC Replacement 5.Teap Study Munson/Ritter 6.Thomas Creek Drainage Structure Replacement 7.City/County Joint Clean Up Update 8.2026 Federal Funds Exchange ll Geary County Public Works Jeremie Myers: Public Works Administrator 310 East 8" Street, Junction city, KS 66441 (785) 238-3612 REQUEST AND PETITION PROJECT ACCESS Name of Requestor Joson /lartLey PropertyLocation 6212 KAVSAS Falcs RD Jwerton Gry 6 6644/ Date Requested CIA 13/2026 Proposed Project_ MEU DRIVEWAY COMES now before the Board of County Commissioners of Geary County, Kansas with plans to construct above mentioned project within Geary County [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED NIGHT MEETING OF THE GEARY COUNTY COMMISSION MINUTES April 20%, 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 6:00 p.m. Arriving at the meeting: Gary Olds, Anthony Berkowitz, Mark Powers, Desree and Randy Pettera, Gerald Gerloff, Dewey Terrill, Dave Schneider The pledge of allegiance was recited. Public Comment (5 minutes per person): Gary Olds: Asked about opening the burn pile at the landfill for more than one Saturday a month, Commissioner Giordano said they are working on it. Discussed the upcoming county budget for 2027-asked about the raise for employees 2% COLA, 3% Step increase (based on performance evaluations), last year it was 1% COLA and 3% Step. Mr. Olds encouraged the commission to think about: talked about revenue coming into the county, wants to keep the expenditures below the revenue for personnel, he said the county is in a better financial position than other cities and counties, also encourage the commission to think about non-profit organizations, they should be raising their own monies. It is not the role of government to fund them. Commissioner Ascher said they ask the other agencies to look for funding other than the county. Mr. Olds said the commission is doing a good job, and the Finance Director is doing a good job. Desree Pettera-On EDC agenda last week, [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 13, 2026

Commissioners

Geary County Commissioners to review budget schedule and department reports

The County Commission will meet to receive weekly and quarterly reports from the Human Resources Director, Finance Director, Register of Deeds, and Sheriff. The Finance Director will present the budget presentation schedule. The meeting also includes an annual meeting with Fair Board representatives.

budgetadministrationpublic-safetyreports
✓ Decided: Commission approved agenda amendment, executive session, and tax‑roll changes

The commission voted to amend the agenda to add a 15‑minute executive session for non‑elected personnel, with all three commissioners voting aye. They then approved entering that executive session, again with unanimous approval. The board also approved Change Orders #20260000694‑2026000708 to correct clerical errors in the real estate and personal property tax rolls. Finally, the commissioners approved the minutes from the April 6, 2026 meeting.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 13", 2026 10:00-10:15 | Commission review and update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45_| Tami Robison, Finance Director, Financial Reports, Budget presentation schedule 10:45-11:00 | Jacqie Reisinger, Register of Deeds, Quarterly Report 11:00-11:05 | Break 11:05-11:20 | Sheriff Nate Boeckman-Bi-Weekly Report 11:30-11:45 | Fair Board Representatives, Annual Meeting 11:45-12:00 12:00-12:15 | Public Comment {5 minutes per person) 12:15 Adjourn TREASURER'S DUPLICATE STMT AND VOUCHERS SHEET AND VOUCHERS DAILY STATEMENT DAILY COLLECTIONS HEALTH DEPARTMENT TRANSFER STATION ACH MISCELLANEOUS DEPOSITS MORNING BALANCE TOTAL DAY'S PAYMENTS MISCELLANEOUS DEBITS EVENING BALANCE Sports C omplex-CD WASTE DISPOSAL CNB CD ' CNB-New CD'S OMIP CENTRAL NATIONAL BANK CASH IN DRAWER & PETTY CASH TOTAL MARCH 31 2026 GEARY COUNTY TREASURER SHERRI CHILDS 74,481.56 799.68 79,380.09 37,093,803.66 37,248,464.99 10,681.17 901,880.09 36,335,903.73 CASH AND CASH ITEMS $600,000.00 200,000.00 5,200,000.00 1,882,481.56 28,442,872.17 10,550.00 36,335,903.73 Fund Status Report Geary County Selected Fund Type: ALL Report Selection Criteria: Include Encumbrances? NO Fiscal Year: 2026 From Date: 1/1/2026 Include Pri Yr Ltablilities? NO From Period: 1 Thru Date: 3/31/2026 Printed In Alpha by Fund Name? NO . . Exclude Additional Cash? NO To Period: 3 Option: Date Range Include Pending Cash? ~NO Exclud [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES April 13", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Ascher: Did not have any meetings Attended the Little Theatre- Rock of Ages-said it was very good, lots of talent in the area. Tremont: Attended the EDC Advisory Board Meeting-Vet Epic program will be coming up in the future, Destination Bootcamp, Energy issues, ongoing challenges. | Chairman Tremont attended the Employee Task Force meeting-talked about looking for lunch and learn topics, HR director brought up the benefits-any concerns, asked their co-workers if they want anything changed, no complaints or concerns. Data center conversation-seems to be a lot of information going on now, lots of counties are fighting them coming in to their communities, Saline County placed a moratorium of construction of data centers and’ nuclear centers in the unincorporated areas of the county, where there is no power and water, would cost a lot to bring it in. Legislation-property tax bill was passed late, she talked to Representative Butler and Representative Chauncey and they both voted no, it would make additional work on the clerk and treasurers, people want their taxes to be lowered, but the legislature didn’t g [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 6, 2026

Commissioners

Commissioners to set 2027 budget baseline and personnel cost estimates

The Geary County Commission will review the 2027 budget baseline, including a proposed 2% cost-of-living adjustment and a $25 employer match for employee retirement contributions. The meeting also includes a proclamation for the Purple Heart Trail and an executive session regarding non-elected personnel.

budgetpersonnelcolaretirementproclamationexecutive-session
✓ Decided: Commission approved King Construction’s revised flyover project plan

The commission approved King Construction’s revised proposal for the I‑70 flyover (K‑18/170) project. They also approved a $10,500 change order for new siding on Fire Station #4, a $2,000 grant to Run for the Wall, and acceptance of a $40,409 bid for 2026 Noxious Weed supplies. Additionally, the commission authorized the application for a state grant to build a new communications tower and approved APAC’s $2.95‑per‑gallon MC‑800 chip‑seal oil quote. All motions were moved by Commissioner Ascher, seconded by Chairman Tremont, and passed unanimously.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 6", 2026 Commissioner Giordano will not be in attendance 10:00-10:15 | Commission review and update 10:15-10:30 | Crystal Malchose, Human Resource Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly report-Budget Baseline Discussion, Financial reports, Run for the Wall funding request on behalf of the CVB 10:45-11:00 | Garry Berges, Emergency Management Director/ Rural Fire Chief-Monthly Report 11:00-11:30 | Jeremie Myers, Public Works Superintendent-Bi-Weekly Report-Open quotes for Cloud County Community College Mowing at 11:00 a.m. 11:30-11:35 | Break 11:35-11:45 | Purple Heart Trail Proclamation 11:45-12:00 | Executive Session-Non-Elected Personnel 12:00-12:15 | Public Comment (5 minutes per person) 12:15 Adjourn MEETING: April 6, 2026 SUBJECT: 2027 Budget Baseline PRESENTER: Tami Robison, Finance Director BACKGROUND I am requesting your assistance in setting the 2027 Budget Baseline. The following are examples for consideration and discussion: --Present budgets reflecting departmental needs being aware of the current economic conditions and tax sentiment of the public. --Present budgets reflecting statutory requirements and business needs. --All budgets are requested to be flat. --All budgets are requested to be reduced. --Non-essential purchases are not to be included. --Only critical, essential, and emergency purchases should be part of the budget. --Do not include requests for new [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES April 6", 2026 Commissioner’s Present: Keith Ascher, Kathy Tremont, Trish Giordano (on vacation) Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Arriving at the meeting: Representative Shaun Chauncey, Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Ascher: Attended the PBC meeting on March-26-Ken Mortenson oversees the PBC financials-the company that assists with the collection of bad debt, Haase & Long is just going to take it all over, they get a percentage of collections, which they are still collecting. Attended the Chamber Board of Directors meeting on March 26-received the audit-it was recommended a secondary person review and do the reconciliation of the numbers. Chamber Golf Tournament will be May 1, 2026. MAC-Armed Forces Day is May 16, 2026. First ID reunion will be June 24 through June 28, 2026. Stated there will be lots of Change of Commands between May and July. Attended Steve Meyer’s retirement party and he thanked Mr. Meyer for his years of service. Tami Robison, Finance Director and Crystal Malchose, HR Director arrived at the meeting. Tremont: Attended Steve Meyer’s retirement party. Stated the Pawnee Mental Health board members will be having a retreat on May 7. Stated she was invited by the Geary County Extension Agent to attend a meeting with the Extension, [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026

Commissioners

Mon Mar 23, 2026

Commissioners

Commission approves eRecording system contract and Fire Station #4 bid

The Geary County Commission will review a $18,105 contract for an eRecording system, approve a bid for Fire Station #4, and discuss the 2027 budget timeline. The meeting includes department head updates and a public comment session.

budgetfire-stationhiringpublic-hearingrecordingtechnologytransportation
✓ Decided: Commission approved $18,105 eRecording system purchase

Commissioners Giordano and Ascher moved to approve the purchase of an eRecording product from Harris Recording Solutions at a cost of $18,105 with a $2,500 maintenance fee; the motion was seconded and all three commissioners voted aye. They also moved to open an executive session for legal matters concerning contract services, which was seconded and approved unanimously. No other substantive actions were taken during the meeting.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 23", 2026 10:00-10:15 | Commission review and update 10:15-10:30_| Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Weekly Report 10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Report 11:00-11:15 11:15-11:30 | Jacqie Reisinger, Register of Deeds, eRecording Discussion & Approval 11:30-12:00 | Jordan McCann-Junction City Mainstreet-2025 Impact and 1* Quarter Update 12:00-12:15 | Public Comment (5 minutes per person) 12:15-12:45_ | Department Head Meeting-Discussion of: finance&travel policy, non-county employees in county vehicles, tax statements/deeds issue, department heads purchase-needs commission approval, budget timeline 12:45-1:00 | Garry Berges, Emergency Management Director, Rural Fire Chief, Approval of bid for Fire Station #4 1:00-1:15 | Executive session-non-elected personnel 1:15 Adjourn 2 ESTO Sree 1655 pecan GEARY COUNTY KANSAS Geary County 2027 Internal Budget Calendar Date Activity March 23, 2026 [Distribute 2027 budget calendar to department heads and Commission for review @ Apr 6 Finalize 2027 budget baseline estimates with BOCC Apr 7-10 Finance Director to formulate 2027 budget baseline estimates as applicable Apr 17 Finance to forward preliminary personnel reports to departments for review/verification CPI-U for December annual from Bureau of Labor Statistics included in reports as guideline based on BOCC decision On or before Apr 21 |Finance [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES March 23", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Chairman Tremont Congratulated Commissioner Giordano on her marriage. Commissioner Giordano moved to add an executive session for legal matters to discuss contract services, to include the County Counselor and the Finance Director; Commissioner Ascher seconded and all voted aye. Commission review and update: Chairman Tremont Congratulated Commissioner Giordano on her marriage. Tremont: Attended a juvenile detention board meeting. Discussed the upcoming KCCA conference on April 22-24 in Hutchinson, are any commissioners going? She is going to try to attend, she reviewed the agenda and thought there were going to be good topics at it. Commissioner Ascher can’t go. Giordano: Did not have any report since she was on vacation. Ascher: Congratulations to Commissioner Giordano. The PBC meeting will be this week. The next MPO meeting will be in April. Commissioner Ascher asked about the legislature-anything going on? Chairman Tremont said $B284-bill that proponents for rural hospitals under duress, reducing prescription drugs, the property tax bill didn’t pass, there are lots of amendments to the property tax bills, SB 404-Treasurer’s b [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 16, 2026

Commissioners

Geary County Commissioners to review health updates and public works bids

The Board of Commissioners will receive a monthly update from the Health Department and a radio update from the Sheriff and Fire Chief. The Public Works Director will present a bi-weekly report and open bids for chemicals.

public-healthpublic-worksemergency-servicesgrantsinfrastructure
✓ Decided: Commission approved $1.69 M 800‑radio system grant application

The Geary County Commission voted to approve the fire department’s application for a $1.69 million 800‑radio system upgrade grant. They also approved a speed‑limit reduction on Rucker and Munson Roads, a culvert placement on Mockingbird Road, a letter of support for Stormont Vail, a firewall service agreement for the Transfer Station, a new hot‑water heater for the Health Department, and a revised crack‑seal material purchase. All votes were unanimous.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 16", 2026 NIGHT MEETING 6:00-6:15 | Public Comment (5 minutes per person) 6:15-6:30 | Charles Martinez, Health Department Director, Monthly meeting 6:30-6:45 | Nate Boeckman, Sheriff and Jason Lankas, Junction City Fire Chief-800 radio update 6:45-7:00 | Commission review and update 7:00-7:30 | Jeremie Myers, Public Works Director-Bi-Weekly Report, Open bids for chemicals 7:45 Adjourn Geary County Health Department 1212 West Ash Street P. O. Box 282 Public Health Junction City, Kansas 66441 16 March 2026 Geary County Board of Health GCPHD Monthly Update 1. Program Updates Public Health Infrastructure Grant Update The issue in KGMS has been resolved, and we are now able to submit the Budget Modification Request (BMR). Once KDHE approves the BMR in KGMS, we will be able to complete the Financial Status Report (FSR) and proceed with reimbursement. Annual Grants Applications Submission The department has successfully submitted all required annual grant applications, including PHEP, State Formula, IAP, and OPEIS funding. These applications ensure continued support for core public health services, preparedness activities, and community health programs for the upcoming funding cycle. Building Bridges Learning Community Grant GCPHD was selected as one of 10 health departments nationwide to participate in the Building Bridges Learning Community. This six-month, $10,000 grant focuses on strengthening relationships with community pa [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES March 16", 2026 NIGHT MEETING Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk Chairman Tremont called the County Commission meeting to order at 6:00 p.m. The pledge of allegiance was recited. Public Comment (5 minutes per person): No one was in attendance for public comment. Charles Martinez arrived at the meeting. Commissioner Ascher moved to open the meeting as the County Board of Health; Commissioner Giordano seconded and all voted aye. Charles Martinez, Health Department Director, gave the monthly report: Public Health Infrastructure Grant Update-The issue in KGMS has been resolved, and the Health Department is now able to submit the Budget Modification Request. Once KDHE approved the BMR in KGMS, the Financial Status Report can be completed, and they will proceed with reimbursement. Annual Grants Applications Submission- The department has successfully submitted all required annual grant applications, including PHEP, State Formula, IAP, and OPEIS funding. These applications ensure continued support for core public health services preparedness activities, and community health programs for the upcoming funding cycle. Building Bridges Learning Community Grant-the Health Department was selected as one of 10 health departments nationwide to participate in the Building Bridges Learning Community. This six-month, $10,000.00 grant focuses o [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026

Commissioners

County opens RFP for new Fire Station #4

The Geary County Commissioners will consider several operational items, including approving a memorandum of understanding for a regional tabletop exercise and reviewing weekly reports from HR, finance, the sheriff and other departments. They will discuss the open request for proposals to build Fire Station #4, review FY27 adult and juvenile budget and compensation plans for Community Corrections, and consider a marketing campaign for the county. The meeting also includes a signature on a health department grant paperwork request.

public-safetybudgetgrantsemergency-servicescommunity-correctionsmarketing
✓ Decided: Commission approved FY27 adult and juvenile budgets and comprehensive plans

The commission unanimously approved the FY27 adult budget and the FY27 juvenile budget. They also approved the FY27 adult comprehensive plan and the FY27 juvenile comprehensive plan. Additional approvals included a memorandum of agreement for a regional tabletop exercise, attendance at a CPM leadership course for the county appraiser and register of deeds, and tax‑roll correction change orders. All motions were passed with all commissioners voting aye.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 9", 2026 10:00-10:15 | Commission review and update-Approve MOU for participation in a regional Tabletop Exercise, OLDCC IR Grant 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Weekly Report 10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Report 11:00-11:15 | Bukaty representatives, Benefits update 11:15-11:30 | Jacqie Reisinger, Register of Deeds-CPM Course 11:30-11:45 | Garry Berges, Emergency Management/Rural Fire Chief-Open RFP’s for Fire Station #4 11:45-12:00 | Representative of 4H/Senior Citizens Building Committee, Annual Report 12:00-12:15 | Public Comment (5 minutes per person) 12:15-12:30 | Chrysann Phipps, Community Corrections Director-FY27 Adult and Juvenile budgets and comp plans 12:30-1:00 | Marketing Campaign Discussion for Geary County 1:00-1:15 Charles Martinez, Health Department Director-Signature on grant paperwork request 1:15 Adjourn Geary County Composition of Cash Balances and Investments As Of: 2/27/2026 Cash on Hand/ Net Bank Balance Inyestments In Transit Total Cash and Cash Items Cash on Hand Bank $10,550.00 $0.00 $0.00 $10,550.00 Certificate of Deposit CENTRAL NATIONAL BANK $0.00 $6,425,000.00 $0.00 $6,425,000.00 Demand and Time Deposits CENTRAL NATIONAL BANK $29,754,803.41 $0.00 $0.00 $29,754,803.41 State Investment Pool OMIP $0.00 $1,871,200.99 $0.00 $1,871,200,99 $29.765,353.41 $8.296,200,99 $0.00 1,554.4 Operat [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES March 9", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Tremont-attended County Day at the Capitol last week, was able to talk to the legislators. EDC board meeting-the second Epic Challenge event will be on June 23 from 5:30 p.m. to 8:00 p.m. They talked about coordinating more efforts with the Chamber, getting new members and working with businesses. , : Ascher: Did not have any meetings. Received complaints from citizens about Boller Road because of the construction. Giordano: She was invited to an open house for the new military family clinic in Manhattan, which is a grant funded program for veterans and their families and much needed in the community. Attended County Day at the Capitol, Geary County was very well represented. Attended the CVB board meeting-marketing campaign was discussed, something we need to move forward with, wants the whole community involved. Attended the Mo Town show at the Opera House-very good show, Stated there were lots of good events going on in the community including the Murder Mystery and the Comedy Show. Discussed the regional tabletop exercise funded through the OLDCC installation resilience grant. Flint Hills Regional Counci [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 2, 2026

Commissioners

County Commission to consider funding intent for Sewer No. 4

The Geary County Commissioners will review routine reports and consider several public‑works actions. Items include petitions for Budden Road and Cedar Road and for Thomas Creek Road, a noxious‑weed management plan and chemical bid, a funding intent letter for Sewer No. 4, and a recommendation for a crack‑seal quote. The board will also confirm the hiring of a Facilities Manager/Assistant Public Works Administrator.

public-worksinfrastructurewaterroadsenvironmenthiring
✓ Decided: Commission approved Feld Fire $696,189.73 air pack contract

The Geary County Commission approved the low bid from Feld Fire for air packs at $696,189.73. It also approved the Cox Communications fiber request, a waterline request from Morris County Rural Water District, the 2026 Noxious Weed Management Plan, a $15,876 crack‑sealing material quote, and a $930,963 sewer‑funding notice. All motions passed unanimously.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 2", 2026 10:00-10:15 | Commission review and update 10:15-10:30_| Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 10:45-11:00 | Garry Berges, Emergency Management Director/ Rural Fire Chief-Monthly Report, Opening of Air Pack bids 11:00-11:30 | Jeremie Myers, Public Works Administrator, Bi-Weekly Report 11:30-11:45 | Executive Session-Non-Elected Personnel 11:45-12:00 12:00-12:15 | Public Comment (5 minutes per person) 12:15-12:30 Adjourn GEARY COUNTY PUBLIC WORKS DEPARTMENT Jeremie Myers, Public Works Administrator 310 East 8" Street, Junction City, KS 66441 (785) 238-3612 ll = wo a o>) N Public Works Board of County Commissioners Meeting Agenda Date of Meeting: March 2, 2026 . Action Item: Request & Petition; Budden Rd & Cedar Rd . Action Item: Request & Petition; Thomas Creek Rd . Action Item: Noxious Weed Annual Report & Management Plan . Noxious Weed Chemical Bid Open . Sewer No. 4 Funding Intent Letter . Crack Seal Quote Recommendation . Facilities Manager / Assistant Public Works Administrator Position Filled
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES March 2", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Tremont-Attended Pawnee Mental Health board meeting-discussed evaluation of the CEO. Ascher-Stated the joint meeting with the city/school/county last week went well, lots of information. Attended High Five Fridays at Westwood School. Tremont-Had a meeting to encourage feedback, and prompt conversations for growth in the community with economic development. Stated the joint meeting went well and the Public Works Director gave a good report and will continue to attend the joint meetings. Giordano-Attended the joint city/county/school district meeting. She thinks it is important to get together to discuss things and throw out ideas. Attended the Kansas Automobile Dealers Association Legislative Conference-a chance to meet with legislators-talked about the 3% cap on appraisals-if it goes over 3%, it will need to go to a vote. Attended marketing campaign meeting with Terry Butler involved. Regional economic rural recreation meeting-talked about outdoor recreation assets, what is in the community, what we would like to see in the community-need to work on it. Chairman Tremont and Commissioner Giordano are a [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 23, 2026

Commissioners

County approves $175,584 for three new sheriff patrol vehicles

The Geary County Commissioners will review routine reports from Human Resources, Finance and the Sheriff, and discuss the 2025 year‑to‑date budget expenditures and revenues. They will consider a Capital Improvement Program request to purchase three outfitted patrol vehicles for the Sheriff’s Office at a total cost of $175,584. The meeting also includes a special CIP work session, an executive session on non‑elected personnel, and a public comment period.

capital-improvementlaw-enforcementbudgetfinancepublic-commentexecutive-session
✓ Decided: Commission approved $175,584 purchase of three sheriff patrol vehicles

The commission approved several items, including adding agenda items, sponsoring a Crimestoppers banquet table, purchasing a commercial property, and buying three new patrol vehicles for $175,584.06. They also approved tax‑roll correction change orders, the minutes from the February 17 meeting, and authorized two executive sessions. All motions passed unanimously.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 23", 2026 10:00-10:15 Commission Review and Update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report 10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Report 11:00-11:30 | Travis Lilly, County Appraiser, mailing of value notices update 11:30-11:45 | Special CIP Work Session 11:45-12:00 | Executive session-Non-Elected Personnel 12:00-12:15 | Public Comment 12:15-12:30 | ADJOURN 2025 YTD EXPENDITURE BUDGET ACTIVITY % of Year: 100% FUND EXPEND Jan-Feb AVAILABLE # FUND BUDGET Jan Feb Mar Apr May Jun Jul Aug Sept Ost Nov Dee 25 Total BUDGET __% USED 001 __ GEARY COUNTY GENERAL FUND (anended) 36015262 5,463,619 2,688,441 1,683,652 1,842,949 1,781,942 1,551,508 3,827,372 1,970,516 2,072,946 1,607,072 1,613,709 1,959,804 635,174 28,655,832 7356430 79.57% 002 APPRAISERS FUND - - - - - - - - - - - - - - - - 003 © ROAD & BRIDGE - - - : - - - - - - - - - - - - 004 SPECIAL BRIDGE 732,879 - - 18,560 - 1,260 - 5,150 - - - - - 1160 26,130 106,749 3.57% 005 NOXIOUS WEED - - : - - - - - - - - - - - - - 006 = HEALTH DEPARTMENT 1,084,138 90,538-=57,634 60,269 71,386 «69,170 58,868 © 61,086 8.8 51,465 51,685 41,961 «41,290 3,530 757,693 326,445 69.89% 007 EXTENSION OFFICE . : : - : - - - - - - - - - - - 008 = LIBRARY 120,000 62,446 . 8,481 1,559 - 27,330 - - 16541 3,127 - 315 - 120,000 - 10.00% 010 PAWNEE MENTAL. HEALTH - - . - - - - - - - - - - - . - Otl ELECTION - - [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES February 23, 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards, County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commissioner Ascher moved to amend the agenda to add an executive session for legal contracts after public comment; Commissioner Giordano seconded-and all voted aye. Chairman Tremont moved to amend the agenda to add Crimestoppers banquet sponsorship discussion; Commissioner Giordano seconded and all voted aye. Commission review and update: Ascher: Attended the Risk Management meeting last week. Mr. Berges pointed out that the last time the Everbridge test was done, there was only about 50% participation. He is going to try again and hopefully will get more. . Stated the Severe Weather training will be Monday, March 16, 2026, at 7:00 p.m. at the 4H-Senior Center. Stated fire alarm testing will be done. It will not be done when the public is in the building. Stated Public Works has a new Facebook page. Attended the MPO organizational meeting. There are quite a few new participants on the board. They had election of officers-Commissioner Ford from Riley County will be the chairman again, Commissioner Ascher is vice chair. They received an update on the I70-K.18 interchange-amount now is $35.2 million dollars. Giordano: Attended a [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026

Commissioners

Commissioners to consider tourism travel and solid waste plan

The Board of County Commissioners will review reports from human resources, health, and public works. Key decisions include a request for the CVB Director to attend a trade show and the adoption of the 2025 Solid Waste Management Plan annual review.

tourismwaste-managementpublic-healthroadsbudget
✓ Decided: Commission approved off‑system bridge project, land purchase, and multiple contracts

The Geary County Commission approved a bridge agreement worth up to $800,000, a land purchase at 301 E 8th St., and several service contracts including a lock service, generator maintenance, and a culvert replacement. It also approved a $3,695 trade‑show booth for the CVB, a $17,980 engineering report for the Kansas Falls Road project, and adopted the 2025 Solid Waste Management Annual Review Plan.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 17°, 2026 Night Meeting 6:00-6:15 Commission Review and Update 6:15-6:30 Crystal Malchose, Human Resources Director, Weekly Report 6:30-6:45 Raquel Cinco, CVB Director, request approval to attend a trade show 6:45-7:00 Charles Martinez, Health Department Director, Monthly Report 7:00-7:30 Jeremie Myers, Public Works Administrator, Bi-Weekly Report 7:30-7:45 Discussion on allocation funding for Mud Bogg and Blues & BBQ 7:45-8:00 Public Comment 8:00-8:15 Adjourn + ESTD Samm 61855 Reese Sed GEARY COUNTY KANSAS CONVENTION & VISITORS BUREAU February 9, 2026 Board of County Commissioners, T respectfully request approval to attend the Travel & Adventure Show on April 11-12 at the Colorado Convention Center in Denver, CO. This event will provide valuable opportunities to promote Geary County as a visitor destination, gain insight into current travel trends and consumer interests. The registration fee has been discounted from $4,495 to $3,695 as an incentive to have the Geary County CVB return to the show. The advisory board made a motion to approve this travel at its meeting on February 4+h, Attendance will support ongoing tourism promotion efforts to enhance outreach for the county. Thanks for your consideration. 222 W 6" St, Junction City, KS 66441 | 785-238-2885 | visitgearycounty.com Geary County Health Department 1212 West Ash Street s P. O. Box 282 Public Health Junction City, Kansas 66441 17 February 2026 Geary County [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES February 17", 2026 Commissioners Present: Keith Ascher (arrived at 6:40pm), Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor Gerald Gerloff Chairman Tremont called the County Commission meeting to order at 6:00 p.m. The pledge of allegiance was recited. Commission review and update: Giordano: e Lunch meeting with Jeremie Myers, Ray Ibarra and Kim Zimmerman to touch base on the Joint City/County clean up and East St. East St. belongs to the county, and the county will address that. e Attended the Childcare Coalition meeting, Geary County’s Childcare Coalition became a “childcare champion”, first county in the state to receive that title based on meeting the requirements for training, resources and support. e Attended the MAC meeting, they talked about the parades and thought that two parades in a short time is very taxing, however, they would like to potentially have a Veteran’s Summit to recognize the Veteran’s. Commissioner Giordano brought up issues about MAC finances and how they ended 2025 -$18,000. They have now received their appropriation from the City and the County so they are now positive, however, they need to find out where the deficiencies are and how they can be corrected going forward. e Alan Bontrager would like to have a marketing campaign to promote Geary County. The CVB should be leading this project. Commissioner Giordano would l [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026

Commissioners

County Commissioners consider vacation of Walker Road

The Geary County Commission will review a road viewing and consider a vacation of Walker Road, followed by a public hearing on the same matter. Updates from the Human Resources and Finance directors, as well as a bi‑weekly report from Sheriff Nate Boeckman, will be presented. The board will discuss issues related to the county jail and Pawnee Mental Health services, and consider a travel request from the Convention & Visitors Bureau director.

roadhearingjailmental-healthtravelfinance
✓ Decided: Commission approved Walker Road vacation and key financial actions

The commission accepted the road viewers' recommendation and approved the certificate of viewing for Walker Road. The board agreed to pay $145,000 to the City of Junction City for EMS services. Change Orders 2026000039‑2026000062 were approved, and the minutes from 02/02/2026 were adopted.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 9", 2026 9:00-10:00 | Road Viewing-Walker Road Vacation 10:00-10:15 | Public Hearing-Road Viewing and vacation on Walker Road 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Update 10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Update 10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Update, and Sheriff’s Dept. end of year accomplishments 11:00-11:15 | Discussion on the Jail and Pawnee Mental Health 11:15-11:30 | Raquel Cinco, CVB Director, Request approval for travel to a trade show 11:30-11:45 11:45-12:00 | Commission review and update 12:00-12:15 | Public Comment 12:15-12:30 Adjourn é GEARY COUNTY, KANSAS SHERIFF NATE BOECKMAN 2025 Accomplishments Geary County Sheriff’s Office CALEA Accreditation In 2025, the Geary County Sheriff's Office achieved National CALEA Accreditation, becoming the only active Sheriff’s Office in Kansas to earn this prestigious distinction. CALEA accreditation is the result of a comprehensive and rigorous evaluation process that measures an agency’s performance against internationally recognized standards for professionalism, accountability, and service delivery. With this achievement, the Sheriff's Office is now the first and only Sheriff’s Office in Kansas to hold dual accreditation from both CALEA and KLEAP. This milestone represents a significant accomplishment in law enforcement and underscores the agency’s continued commitment to transparency, ethical policing, and orga [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES February 9", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. The road viewing for the Walker Road vacation was held at 9:00 a.m. Arriving at the public hearing for vacation of Walker Road: Jeremie Myers, Public Works Administrator Bobby Miller, road viewer Chairman Tremont opened the Public Hearing for a vacation on Walker Road: Bobby Miller, Alan Hildebrand and Terry Heldstab were appointed as road viewers. The road viewers agreed that the road vacation would have no adverse effect on any landowners. Certificate of viewing was presented by Mr. Miller. Commissioner Ascher moved to accept the road viewers recommendation and approve the certificate of viewing for Walker Road, Commissioner Giordano seconded, all voted in favor aye Crystal Malchose, Human Resources Director, gave the weekly report: e Employee task force meeting is this week, commissioner Ascher will be attending ¢ Lunch and learn, presented by Commerce Bank will be held on February 12" 2026, in the conference room. e Congratulated employees, Jayme Coffey and Raquel Cinco on graduating from the Flint Hills Regional Leadership program. Tami Robison, Finance Director, gave the bi-weekly report: e Presented CIP project funding docum [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 2, 2026

Commissioners

Commissioners consider OPEI grant and public works projects

The Board of County Commissioners will review a letter of intent for the Healthy Families OPEI Program grant. The meeting includes reports from county directors and discussions on public works infrastructure and speed limits.

public-healthroadsgrantsinfrastructuretaxes
✓ Decided: Commission approved $696,189 Feld Fire air pack purchase

The commission approved several contracts and plans, including a $696,189.73 air‑pack purchase from Feld Fire, a Cox Communications fiber‑optic bore request, and a waterline project for Morris County Rural Water District #1. They also adopted the 2026 Noxious Weed Management Plan, approved a $15,876 crack‑sealing material quote from Crafco, and authorized a $930,963 sewer‑funding notice. Additional actions included approving a tax‑roll correction change order and adopting the February 23 meeting minutes.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 2", 2026 10:00-10:15 | Commission review and update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Update 10:30-10:45 | Garry Berges, Emergency Management Director/Rural Fire Chief, Monthly Report 10:45-11:15 | Jeremie Myers, Public Works Administrator, Bi-weekly report 11:15-11:30 | Executive Session with Public Works, KOMA 79-4319(b) (6) 11:30-11:45 | Mike Rezkalla, CEO Pawnee Mental Health Services, update 11:45-12:00 | Betsy Edwards, County Counselor, Transient Guest Tax Charter Resolution 12:00-12:10 | Public Comment 12:10-12:25 | Raquel Cinco, CVB Director, Monthly Update 12:25-12:35 | Charles Martinez, Health Department Director, GCPHD Letter of Intent 12:35-12:50 | Executive Session, Contract Services Adjourn GEARY COUNTY PUBLIC WORKS DEPARTMENT Jeremie Myers, Public Works Administrator 310 East 8" Street, Junction City, KS 66441 (785) 238-3612 ll Public Works Board of County Commissioners Meeting Agenda Date of Meeting: Feb 2, 2026 1. Request & Petitions - Lower Budden Road Entrance & RWD #1 Humboldt 2. USDA Acceptance of Environmental Assessment & Notice of Availability 3. KLBIP Application - Lower McDowell Creek Bridge 4. City/County Joint Clean Up Week 5. Munson / Rucker Road Speed Limits 6. SNICE Update 7. Executive Session Request KOMA 79-4319(b) (6) Preliminary Discussion of Acquisition of Real Property; 10 minutes Geary County Health Department 1212 West Ash Street P. O. Box 282 P [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES March 2", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update: Tremont-Attended Pawnee Mental Health board meeting-discussed evaluation of the CEO. Ascher-Stated the joint meeting with the city/school/county last week went well, lots of information. Attended High Five Fridays at Westwood School. Tremont-Had a meeting to encourage feedback, and prompt conversations for growth in the community with economic development. Stated the joint meeting went well and the Public Works Director gave a good report and will continue to attend the joint meetings. Giordano-Attended the joint city/county/school district meeting. She thinks it is important to get together to discuss things and throw out ideas. Attended the Kansas Automobile Dealers Association Legislative Conference-a chance to meet with legislators-talked about the 3% cap on appraisals-if it goes over 3%, it will need to go to a vote. Attended marketing campaign meeting with Terry Butler involved. Regional economic rural recreation meeting-talked about outdoor recreation assets, what is in the community, what we would like to see in the community-need to work on it. Chairman Tremont and Commissioner Giordano are a [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026

Commissioners

Commission will consider funding for sheriff’s patrol vehicles and computers

The commissioners will hold a Capital Improvement Program (CIP) work session to review the county's cash position and a $970,584 list of non‑funded projects, including the sheriff’s request for three patrol vehicles and ten computers. They will also discuss a possible 3% cap on property valuations proposed by state legislators and consider a City/County Jail and Dispatch Agreement. Additional items include routine reports from department heads and public comment.

capital-improvementpolicebudgetvaluation-capjail-agreement
✓ Decided: Commission approved jail‑dispatch service‑exchange agreement with Junction City

The commission approved an agreement to exchange jail and dispatch services with the City of Junction City, with all three commissioners voting aye. They also approved change orders 2026000032‑2026000033, the prior meeting minutes, and Cereal Malt Beverage licenses for two RV parks. A $20,000 CIP request for ten new sheriff's office computers was approved unanimously, while the request for three new patrol cars was tabled. The board voted no on paying retired directors insurance.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 26", 2026 10:00-10:15 | Commission review & update 10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report 10:45-11:00 | CIP work session with Tami Robison, Finance Director 11:00-11:30 | Joint Meeting with the Public Building Commission 11:30-11:45 | Chief Lankas, Junction City Fire Chief, 1° Quarter Update 12:00-12:15 | Public Comment (5 minutes per person) 12:15-12:30 | Discussion of potential 3% cap on valuations (state legislators) with County Appraiser, Travis Lilly 12:30-12:45 | Sheriff Nate Boeckman, Bi-Weekly Report 12:45-1:00 | City/County Jail and Dispatch Agreement 1:15-1:30 Department Head Meeting Adjourn COMMISSION AGENDA REPORT FROM: Tami Robison, Finance MEETING: Director January 26, 2026 SUBJECT: CIP Work Session BACKGROUND This is the first CIP work session for 2026 which will include the CIP cash position updated with estimated project costs as of January 6, the updated 2026 Non-Funded CIP Project List (attached) and Funding Authorization Forms (attached) for consideration in activating CIP projects. The 2025-year CIP cash position is as follows: 2025 Beginning Cash Balance $ 3,571,080 PLUS Interest 121,283 Taxes ° 2,058 Purple Wave & Scrap Iron sales 27,340 Insurance & Other Reimbursements 204,142 State Historical Grant 77,616 Land Sale (K18/I70) 28,037 Transfer in from General Fund $ 1,572,500 Total Resources Available $ [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES January 26", 2026 Commissioners Present: Keith Ascher (arrived at 11:00am), Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission review and update Giordano: Attended the MAC breakfast Attended The Regional Growth Summit, comments that it was informative, believes that Geary County should have been better represented and advertised. Gave appreciation to Geary County and City of Junction City Public Works for working hard and long hours to clear the roads. Ascher: Attended the MPO meeting last week, focus right now is on HWY 24 corridor in Pottawatomie County, putting in a second bridge over the river. Attended the Chamber of Commerce meeting, Ashley King is the chair for 2026. Attended the annual soil conservation dinner. Tremont: . Attended the juvenile detention meeting and the board voted no to pay the retired directors insurance. Attended the MAC breakfast. Attended the soil conservation annual meeting and dinner, first time attending and it was informative. Attended The Regional Growth Summit on Friday with Commissioner Giordano, Mrs. Robison, Ms. Edwards. Commented that Geary County needs to do a better job at selling itself and promoting what is happening in Geary County. Crystal Malchose, Human Resources Director, ga [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026

Commissioners

Commission will approve Fireman Relief Association document

The Geary County Commissioners will review recent updates, approve the Fireman Relief Association document, and hear a weekly HR update. An executive session will evaluate non‑elected personnel. Reports from Public Works and the Health Department will be presented, including a $137,098.57 PHIG grant update and influenza surveillance data.

commissionbudgethealthpublic-workspersonnel
✓ Decided: County approved $28,720 elevator repairs for four county elevators

The commission unanimously approved using the Facility Fund to correct code compliance issues on four county‑owned elevators at a total cost of $28,720. It also approved Old Trooper membership dues of $450, a request and petition, tree‑removal quotes, and change orders. The board of public health was opened and later closed in the same meeting. Minutes from the January 12 meeting were approved.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 20", 2026 NIGHT MEETING 6:00-6:15 Commission review and update 6:15-6:20 Garry Berges, Emergency Management Director, Approve and signing of the Fireman Relief Association document 6:20-6:30 Crystal Malchose, Human Resources Director, Weekly Update 6:30-7:00 Executive Session, Non-elected personnel / dept head evaluation 7:00-7:30 Jeremie Myers, Public Works Administrator, Bi-Weekly Report 7:30-8:00 Charles Martinez, Health Department Director, Monthly Report Public Comment (5 minutes per person) Adjourn Geary County Health Department 1212 West Ash Street P. O. Box 282 Public Health Junction City, Kansas 66441 20 January 2026 Geary County Board of Health GCPHD Monthly Update 1. Monthly Situation PHIG The PHIG grant was fully approved on December 31, confirming that Geary County will receive the entire allocation of $137,098.57, with no loss of funding. A Budget Modification Request (BMR) was submitted on January 12 to align the grant with updated guidance and reporting requirements. We are currently awaiting KDHE’s release of the Financial Status Report (FSR) so the remaining $43,294.29 for Quarter 4 of 2025 can be processed and reimbursed. At this point, the grant is in good standing, and all required actions on our end have been completed. Influenza Season Since the end of December, Geary County has experienced a measurable increase in reported influenza activity following relatively low levels earlier in the season, consi [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES January 20", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor Chairman Tremont called the County Commission meeting to order at 6:00 p.m. The pledge of allegiance was recited. Commission review and update: Giordano: Ms. Robison, Ms. Edwards and Commissioner Giordano spoke to Lead JC about County Leadership. Attended the employee task force meeting. Attended the dinner for the Brigade Baseball team. Attended the Flint Hills Regional Council Meeting, they hired two grant writers on a contract basis as needed, mentioned EMS has received a $700,000 grant. Attended the Martin Luther King JR celebration. Attended Local Health Equity Action Team meeting, with some funding they provided some cold weather gear, they are looking to get some additional funding to assist people with getting their GED. Mentioned Old Troopers have asked the board to renew their membership. Commission Ascher moved to approve the Old Trooper Dues for $450.00 for 2026, Commissioner Giordano seconded, all voted in favor aye Ascher: Attended the PBC meeting, Jeff Kline came to give an update about the Hospital, states $57,000 was received in accounts receivable last month. Attended the Seals and Crofts show at the Opera House. Tremont: Attended the Martin Luther King Jr celebration as well. Mentioned January 28" is Local Government Day at [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026

Commissioners

Geary County Commissioners to consider GAAP financial reporting waiver

The Board of County Commissioners will discuss the reorganization of the commission and a resolution to exempt the county from certain generally accepted accounting principles (GAAP) for 2026 financial reports. The meeting includes reports from the Finance, Human Resources, and GIS directors, as well as the Sheriff and Register of Deeds.

financeaccountinggovernment-administrationbudget
✓ Decided: Commissioners approve GAAP waiver and 5% Cox franchise fee

The commission voted unanimously to approve a GAAP waiver for 2026 and a 5% franchise fee for Cox Communications' expansion. They also reappointed John Moyer to the Public Building Commission, approved the minutes from 01/05/2026, and confirmed all leadership nominations for 2026. The 911 Board was tabled pending a decision on its future.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 12", 2026 10:00-10:15_ | Commission review and update 10:15-10:30_| Reorganization of the County Commission 10:30-10:45 | Crystal Malchose, Human Resources Director, Weekly Report 10:45-11:15 | Tami Robison, Finance Director, Bi-Weekly Report - 2026 GAAP Waiver and PBC reappointments 11:15-11:30 | Troy Livingston, GIS Director, Letter of support for Flint Hills Rural Electric Coop. 11:30-11:45 | Sheriff Nate Boeckman, Bi-Weekly Report 11:45-12:00 | Jacqie Reisinger, Register of Deeds, Quarterly/Year End Report 12:00-12:15 | Public Comment (5 minutes per person) 12:30-1:30 | Executive Session, Non-Elected Personnel, Dept. Head Evaluations Adjourn RESOLUTION NO. 01-12-2026 A RESOLUTION EXEMPTING GEARY COUNTY, KANSAS, FROM THE PROVISIONS OF K.S.A. 75-1120a (a). WHEREAS, the County of Geary is now subject to the provisions of K.S.A. 75-1120a(a). WHEREAS, the Board of County Commissioners of Geary County, Kansas, has determined that the financial statements and financial reports prepared in conformity to generally accepted accounting principles as promulgated by the National Committee on Govemmental Accounting and the American Institute of Certified Public Accountants are not relevant to the requirements of the cash basis and budget laws of this State and are of no significant value to the governing body or members of the general public of Geary County, Kansas. WHEREAS, there are no revenue bond resolutions or any other resolu [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
NS ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES Jemmary 12", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert, Cle, Betsy Edwards County Counselor ‘ Chairman Ascher called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission Review and Update: Giordano: Attended the CVB Board meeting, they appreciated the financials being sent to them. Attended the EDC Meeting, commented that-East St. is going to be completed. Tremont: Nothing to report Ascher: Attended the victory with Honors at Ft Riley for the outgoing Chief of Staff and it was a very nice ceremony. The incoming Chief of Staff was also there, and Commissioner Ascher met him. The three road viewers have agreed to do it with no compensation. Reorganization.of the Commission with County Clerk, Courtney Gilbert: Commissioner Giordano moved to nominate Commissioner Tremont as Chairman for 2026, Commissioner Ascher seconded, all in favor voted aye Chairman Tremont moved to nominate Commissioner Giordano as Vice-Chairman for 2026, Commissioner Ascher seconded, all in favor voted aye | | | Commissioner Giordano moved to nominate Commissioner Ascher to serve on the Public Building Commission (PBC) for 2026, Chairman Tremont seconded, all in favor voted aye Commissioner Ascher moved to nominate Chairman T; ‘remont to serve on the EDC Board for 2026, Commissioner Giordano seconded, all in favor voted [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026

Commissioners

Commission adopts Kansas Hazard Mitigation Plan and reviews key infrastructure items

The Geary County Commission will officially adopt the Kansas Homeland Security Region I Hazard Mitigation Plan. The meeting also includes appointing road viewers for a vacation request of the right‑of‑way at Walker Road and Walker Access Road North, and updates on public works projects such as the Kaw Valley contract to replace the McNeal Bridge. Additional agenda items cover a household hazardous waste assessment, an Energy Efficiency & Conservation Block Grant program update, and a Kansas Local Bridge Rating Program update.

hazard-mitigationroadsbridgeswaste-managementenergy-efficiencypublic-works
✓ Decided: Commission approved a $74,872 bridge replacement contract with Kaw Valley

The Geary County Commission unanimously approved several items, including a $74,872 contract with Kaw Valley for the McNeil Road bridge replacement and a $98,834 design cost. It also adopted the 2025 Kansas Region Hazard Mitigation Plan, approved a $20,067.50 assessment for the Big Lakes hazardous waste program, and authorized a sole‑source purchase of fire‑department air‑pac equipment. Additional approvals covered a transfer‑station fee increase, tax‑roll correction change orders, and the meeting minutes from December 22, 2025.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 5‘, 2026 10:00-10:15 | Commission review and update 10:15-10:30_ | Crystal Malchose, Human Resources Director, Weekly Report 10:30-10:45 | Schedule & appoint road viewers for the request of vacation of certain Geary County Right-of-Way- located at intersection of Walker Road and /Walker Access Road North, Geary County Kansas, Section 2 Township 11 South, Range 5 East 10:45-11:00 | Garry Berges, Emergency Management Director, Rural Fire Chief-Monthly Report 11:00-11:30 | Jeremie Myers, Public Works Administrator, Bi-Weekly Report 11:30-11:45 | Raquel Cinco, CVB Director, Monthly Update 11:45-12:00 12:00-12:15 | Public Comment (5 minutes per person) 12:15-12:30 Adjourn Region | Resolution Officially Adopting the 2025 KS Region | Hazard Mitigation Plan Resolution # : Adopting the Kansas Homeland Security Region I Hazard Mitigation Plan Whereas, the (Name of Government/District/Organization) recognizes the threat that natural hazards pose to people and property within our community; and Whereas, undertaking hazard mitigation actions will reduce the potential for harm to people and property from future hazard occurrences; and ' Whereas, the U.S. Congress passed the Disaster Mitigation Act of 2000 (“Disaster Mitigation Act”) emphasizing the need for pre-disaster mitigation of potential hazards; Whereas, the Disaster Mitigation Act made available hazard mitigation grants to state and local governments; and ‘Whereas, an adopte [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES January 5", 2026 Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor Chairman Ascher called the County Commission meeting to order at 10:00 a.m. The pledge of allegiance was recited. Commission Review and Update: Tremont: Nothing to report Ascher: Nothing to report Giordano: Noted evaluations of department heads will begin soon, suggesting an executive session with fellow commissioners to discuss prior to meeting with department heads. ATA Bus and K18 connector between Junction City and Manhattan started January 1%, 2026. Commissioner Tremont moved to amend the agenda today to do an executive session for 15 minutes with HR director to discuss evaluations from 11:45am — Noon, Commissioner Giordano seconded, all voted in favor aye Crystal Malchose, Human Resources Director, gave the weekly report: « Out of office notifications were presented and signed by commissioners. ® Nex-Tech is updating their domain name system. e Atthe KAC annual conference meeting, a commissioner from Pottawatomie asked Mrs. Malchose to share with the commissioners a framework for county property tax relief packet, Commissioner Giordano recommended commissioners to send this to state representatives. e Everbridge test wasn’t great, HR and Emergency Management are working to update contact information, due to the Holiday participation may [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026

Commissioners

Geary County Emergency Services report $320,350 loss in 2025

The Commissioners will review the 2025 Geary County Emergency Services report. The report lists 126 total fire calls, details fire type counts, and records a total dollar loss of $320,350. It also shows 1,062.5 fire‑ground hours logged by command staff and volunteer firefighters.

emergency-managementfirebudgetpublic-safetydata-report
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Emergency Management ¢ Rural Fire Department EMERGENCY PLANNING & RESOURCES &) GEARY COUNTY EMERGENCY SERVICES Business Phone: (785) 238-1290 236 E. 8" Street, Junction City, KS 66441 ___ Fax: (785) 238-1373 ; Websitewww.gearycounty.org 2025 FIRE RUNS Total Calls 2025 — 126 106(2024) Fire Types: 2025 2024 Building Fires: 14 8 Vehicle Fires: 20 19 Grass, Brush, Fires: 32 34 Cultivated grain or crop fire: 2 4 Other fires zZ 2 Medical Assist: 20 5 Fuel Spills/Vehicle Accident/ Down Power Line: 9 10 Service Calls 7 8 Good Intent: (includes dispatched & cancelled enroute and controlled burns) 23 16 Severe Weather 4 7 Dollar Loss: Building Fires Vehicle Fires Vegetation Fires Crop Fires Other Fires TOTAL LOSS Responses: Command Staff Volunteer Firefighters . Total Hours on Fire Ground: Command Staff Volunteer Firefighters Total $ 173,000.00 $ 134,500.00 $ 2,500.00 $ 350.00 $ 1,000.00 $ 320,350.00 163 591 754 211.6 hrs 850.9 hrs 1,062.5 hrs Unit Responses 100 Fast Attack 14 102 Heavy Brush 8 104 Pumper 0 106 Heavy Brush 12 108 Fast Attack 11 110 Heavy Brush 2 112 Fast Attack 41 114 Interface Unit 14 116 Pumper 14 101 Pumper 22 103 Pumper 2 105 Heavy Brush 8 107 Heavy Brush 10 109 Interface Unit 15 111 Fast Attack 15 113 Brush Unit 34 115 Tanker 41 117 Pumper 35

Meeting archives

🔗 Embed this city · use the data

Free to reuse under CC BY 4.0 — a link back is appreciated. Paste this into your site:

<iframe src="https://mytown.theboringparts.com/city/gearycounty.gov/embed/" width="100%" height="640" loading="lazy" style="border:1px solid #ddd;border-radius:8px" title="Geary County government meetings"></iframe>
<p>Local government meetings via <a href="https://mytown.theboringparts.com/city/gearycounty.gov/">MyTown</a></p>

The credit line under the iframe is a real link back — keep it and you help others find us (and it satisfies the CC BY attribution). Prefer JSON? meetings.json · full embed & API guide.