Geary County, Kansas
Get Geary County meeting alerts
One email when Geary County posts a new agenda or minutes. Free, unsubscribe anytime.
Municipal budget
Total revenue$55.3M (FY2023)
Total spending$32.9M (FY2023)
Taxes$20.7M (FY2023)
Debt outstanding$29.4M (FY2023)
Spending per resident$916 (FY2023)
Recent meetings
Mon Jul 20, 2026
Commissioners
Commission to review updates and hear public comment
The Geary County Commission will review weekly updates from the Human Resources Director and Public Works Superintendent. The meeting includes a closed executive session regarding non-elected personnel and a period for public comment.
- Crystal Malchose, HR Director, to present a weekly report
- Jeremie Myers, Public Works Superintendent, to present a bi-weekly report
- Executive session for non-elected personnel
- Public Comment period (5 minutes per person)
commissionpublic-workshrexecutive-sessionpublic-comment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 20th, 2026
10:00-10:15 Commission review and update
10:15-10:30 Crystal Malchose, HR Director, Weekly Report
10:30-10:45 Crystal Malchose, HR Director – Executive Session for Non-Elected Personnel
10:45-11:00 Jeremie Myers, Public Works Superintendent, Bi-Weekly Report
11:00-11:15 Public Comment (5 minutes per person)
11:15 Adjourn
Thu Jul 16, 2026
Commissioners
Commissioners to discuss 2027 budget and mill rate increase
The Geary County Commission will hold a work session to review the proposed 2027 budget, which includes a request for a mill rate of 60.962, an increase of 4.661 mills over the 2026 budget. The session will cover appropriations, transfers, and revenue adjustments across various county funds.
- Mill rate increase to 60.962
- Transfer to Economic Development decreased by $23,000
- Transfer to Health Dept. Fund increased to $395,782
- PILT funding increased by $40,000
- Schedule change from 37.5 to 40-hour work week removed
budgettaxesfinancemill-levygeneral-fundwork-session
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 16th, 2026
Budget Work Session
3:00-4:30 Budget work session #5
MEETING: July 16, 2026
SUBJECT: 2027 Budget Work Session #5
PRESENTER: Tami Robison, Finance Director
BACKGROUND
The Development Worksheet, page 1, reflects actual expenditures for 2025, the 2026 expenditure
budget and the 2027 proposed budget for the General fund by department. The transfers and
appropriation requests are listed separately. These same categories are provided for the following
funds: Debt Service, Capital Improvement, County Facilities, Special Bridge, Economic
Development and the Health Department.
On the left side of page 2 of the Development Worksheet, 2026 General fund budgeted revenue
and 2027 proposed budgeted revenue is reflected. The right side of the page provides a summary
of 2026 and 2027 General fund expenditures from page 1 and the budgeted value of a mill which
is used to calculate ad valorem needs.
Appropriation requests by agency are also included on a separate worksheet which includes the
request history back to 2023 and denotes which funds have historically supported these requests.
DISCUSSION
The final day to notify the County Clerk of intent to exceed RNR is July 20, 2026.
Total mills needed after the adjustments from the July 14 work session is 60.962 which equates
to an increase of 4.661 mills from the 2026 budget and exceeds revenue neutral.
[Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 14, 2026
Commissioners
Commissioners review 2027 county budget and mill rate increase
The Geary County Commissioners will hold a budget work session to review the proposed 2027 General Fund budget. The session will examine changes that raise the required mill rate by 5.603 mills, a $732,923 decrease in the revenue‑neutral mill rate, and adjustments to appropriations and transfers across multiple departments. They will consider a 5 % administration fee of about $52,822 for court trustees, VIN, 911 and Lake Patrol, and additional revenue options such as renting county buildings, meeting space, and equipment. The agenda notes the July 20, 2026 deadline to notify the County Clerk of intent to exceed the revenue‑neutral requirement.
- Proposed 5.603‑mill increase to fund 2027 budget, decreasing revenue‑neutral mill rate by $732,923
- 5 % administration fee estimated at $52,822 for court trustees, VIN, 911 and Lake Patrol
- Revenue ideas: rent for outside agencies using county buildings, meeting‑space rentals, equipment rentals
- Attorney’s office schedule change adds $30,272; Emergency Management job reclassification; Public Works wage adjustment; Silver‑Haired Legislature appropriation added
- Appropriations decreased $392,777 and transfers/reserves decreased $325,000, with department budget changes (e.g., Attorney $1,695,005, Emergency Management $215,278)
budgetfinancetaxesmill-rateadministration-feesrevenue
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 14th, 2026
Budget Work Session
1:30-4:30 Budget work session #4
MEETING: July 14, 2026
SUBJECT: 2027 Budget Work Session #4
PRESENTER: Tami Robison, Finance Director
BACKGROUND
The Development Worksheet, page 1, reflects actual expenditures for 2025, the 2026 expenditure
budget and the 2027 proposed budget for the General fund by department. The transfers and
appropriation requests are listed separately. These same categories are provided for the following
funds: Debt Service, Capital Improvement, County Facilities, Special Bridge, Economic
Development and the Health Department.
On the left side of page 2 of the Development Worksheet, 2026 General fund budgeted revenue
and 2027 proposed budgeted revenue is reflected. The right side of the page provides a summary
of 2026 and 2027 General fund expenditures from page 1 and the budgeted value of a mill which
is used to calculate ad valorem needs.
Appropriation requests by agency are also included on a separate worksheet which includes the
request history back to 2023 and denotes which funds have historically supported these requests.
DISCUSSION
The final day to notify the County Clerk of intent to exceed RNR is July 20, 2026.
Based on presentation requests and other adjustments made for a schedule change from a 37.5
hour to 40 hour work week in the Attorney’s office which equates to an increase of
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 13, 2026
Commissioners
Commission to review 2025 audit and receive routine reports
The Geary County Commission will conduct a routine meeting with updates from the HR director and sheriff, and a presentation of the 2025 audit by an outside CPA. No major decisions or public hearings are scheduled; the agenda consists primarily of informational items and public comment.
- Presentation of 2025 audit by James Gordon & Associates CPA
county-commissionauditreportspublic-comment
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 13th, 2026
10:00-10:15 Commission review and update
10:15-10:30 Crystal Malchose, Human Resources Director, Weekly Update
10:30-10:45 Sheriff Nate Boeckman, Bi-Weekly Report
10:45-11:00 Jacob Kujath, James Gordon & Associates, CPA-Present 2025 Audit
11:00-11:15 Public Comment (5 minutes per person)
11:15 Adjourn
Wed Jul 8, 2026
Commissioners
Geary County holds 2027 budget work session
The County Commission is reviewing proposed budgets for 2027, including the General Fund and special districts. The Finance Director presented a proposed General Fund mill levy of 64.124, which exceeds the revenue neutral rate.
- Proposed 2027 General Fund expenditures of $33,434,247
- Proposed 2027 Fire District #1 budget of $548,045 with a 7.930 mill levy
- Proposed 2027 Water District #2 budget of $68,556
- Proposed 2027 Sewer District #4 budget of $244,279
- Proposed 2027 Dorothy Bramloge Library budget of $130,000
budgettax-ratefire-districtlibrarywater-sewer
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 8", 2026
1:30-3:30
Budget work session
Geary County 2027
NOTICE OF BUDGET AND RATE HEARING
Prior Year Actual 2025 | Current Vi Estimate 2026 Proposed Budget Year 2027
Actual ‘Actual | Budget July 1,2026 | Proposed
Expenditures | Tax | Expenditures | Tax | Authority for |Aountof2026) “pointed | Bétimated Tax |. Revenve
cyst Ratet Rate* | Expenditures {Ad Valorem Tex! oration Rates | Neutral Rare
Special District Fumds
Fire District #1 (730) 391,009 | 5.074 331,004 | 7.050 395,020 548,045 | 69,108,296 7930 6.758]
[Water District #2 (784) 12,182 | __7.874 26,045 | __ 7.234) 68,556 6695 | __ 1,015,177 6.595] 6.595
Sewer District #4 (785) 31,910 | 18.171 37,598 | 16.692 244.279 15.450 | 1,015.17 15.219 15219
Dorothy Bramloge Library (008) 120,000 | — 1.313} 120,000 | _ 1.229] 130,000 723,963 | 91,008,437 1362 1175
a A 0 0 0
0 n 0 0 nq
0 0 0 0 0
0 n @ 0 0
0 0 n r) n
0 0 0 0 r
0 Q ny 0 @
0 0 r 0 0
0 ° 0 0 n
0 0 r) 0 0
0 0 0 0 0
0 0 r) ry 0
¢ 0 0 r 0
@ 0 0 n a
0 0 0 @ 0
0 0 Q 0 0
0 0 r q @
0 0 ° 0 0
@ 0 0 0 r)
0 0 0 Q 0
0 0 0 0 r
n @ 0 r ny
0 @ 0 r n
0 0 0 Q r
oO oO i‘) o i]
“Tax rates are expressed in mills
*¢Revenue Neutral Rate as defined by KSA 79-2988
Clerk
Page No.
Follow procedure in KSA 79-2988 to exceed RNR
Follow procedure in KSA 79-2988 to exceed RNR
State of Kansas
County Special Distret
2026 Fire Budget Worksheet
Revenue Sources Expenditures _DelqComp _Ad Valorem Tax Rate
2022 Budget 129,639 26
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 6, 2026
Commissioners
County Commission holds budget work session, considers RFP for courthouse project
The Geary County Commission will meet for a budget work session from 2-5 PM after a morning of regular business. Items include a report on the drunk driving prevention program, monthly financials, opening RFPs for the courthouse boiler room double door project, and considering an appropriation resolution and EDC board appointments. A public comment period is scheduled at noon.
- Budget work session from 2:00-5:00 PM
- Opening RFP for courthouse boiler room double door project
- Appropriation Resolution and EDC Resolution with EDC Board Appointments
- Drunk Driving Prevention Program presentation
- Monthly Financials report by Finance Director
budgetcounty-commissionpublic-worksrfpcourthousedrunk-driving-preventioneconomic-development
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda July 6th, 2026
9:30-9:45 Krista Blaisdell, County Attorney, conference room project update
10:00-10:15 Commission review and update
10:15-10:30 Crystal Malchose, HR Director, Drunk Driving Prevention Program
10:30-10:45 Tami Robison, Finance Director-Monthly Financials
10:45-11:00 Garry Berges, Emergency Management Director, Rural Fire Chief-Monthly Report
11:00-11:30 Jeremie Myers, Public Works Superintendent-Bi-Weekly Report, Opening RFP’s for Courthouse
boiler room double door project
11:30-11:45 Appropriation Resolution/EDC Resolution, EDC Board Appointments
11:45-12:00 Jacqie Reisinger, Register of Deeds, Quarterly Report
12:00 Public Comment (5 minutes per person)
12:15 Recess until budget work session
2:00-5:00 Budget work session
Composition of Cash Balances and Investments
Geary County
As Of: 6/30/2026
Net Bank Balance Investments
Cash on Hand/
In Transit Total
Cash and Cash Items
Cash on Hand Bank $10,550.00 $0.00 $0.00 $10,550.00
Certificate of Deposit
CENTRAL NATIONAL BANK $0.00 $6,000,000.00 $0.00 $6,000,000.00
Demand and Time Deposits
CENTRAL NATIONAL BANK $33,886,188.04 $0.00 $0.00 $33,886,188.04
State Investment Pool
OMIP $0.00 $1,893,632.23 $0.00 $1,893,632.23
$33,896,738.04 $41,790,370.27$7,893,632.23 $0.00
Page 1 of 17/2/2026 8:15:35 AM
Report ID: BKLT30
trobison52Operator:
TREASURER'S DUPLICATE STMT AND VOUCHERS SHEET
AND VOUCHERS DAILY STATEMENT June 30 2026
GEARY COUNTY TREASU
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026
Commissioners
✓ Decided: Joint meeting discusses future structure of Chamber of Commerce and organizations
The City and County commissioners met to discuss operational scenarios for the Chamber of Commerce, EDC, MAC, and CVB. Discussion focused on whether these entities should fall under city or county control and the need for new board member appointments. No formal votes or substantive decisions were recorded during this meeting.
- No substantive decisions were made during this meeting
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
SPECIAL CITY/COUNTY/CHAMBER JOINT MEETING MINUTES
June 29", 2026
County Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
City Commissioners Present: Mayor Terry Butler, Pat Landes, Sam Yoskowitz, Kelly Niemczyk, Richard
Pinaire
County Counselor: Betsy Edwards
City Attorney: Britain Stites
Also present: Therese Hoff, Deputy County Clerk, Tami Robison, Geary County Finance Director, Kim
Zimmermanm, City Manager, Mike Montoya-Attorney for the Chamber, Ashley King-Chamber
President, Ron Johnson-EDC/Chamber, Jim Schmidt-Chamber/JC 1st
Geary County Commission Chairman Tremont called the Joint meeting to order at 6:30 p.m.
The pledge of allegiance was recited,
Updates & comments by Junction City Area Chamber of Commerce Chairperson and Interim President of
Operations, Ashley King and Attorney Mike Montoya. Mr. Montoya discussed different scenarios of
operation for the Chamber of Commerce-put the MAC under the City, CVB under the County and the
EDC under the City. Commissioner Giordano would like to see it the way it was previously. Mr. Johnson
said there needs to be an independent director-not the EDC or Chamber director, the job needs to be
separated, there is too much for a person to do both. There could be a sales tax implemented to fund the
Chamber. Mayor Butler asked about the terms of office for the board members and term limits. It was a
consensus of the group that new board members need to be appointed for the members whose term has
expired, When
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 22, 2026
Commissioners
Commissioners to review 2027 budget with proposed 7.823 mill tax increase
The Geary County Commission will review the 2027 budget development worksheet, which proposes a total mills of 64.124, an increase of 7.823 mills from 2026, exceeding revenue neutral. The board will also consider a proposed moratorium on alternative energy and data center development. Other agenda items include an executive session on the interlocal agreement with the Chamber of Commerce and City of Junction City, and reports from the HR director, sheriff, and health department.
- Review of 2027 budget development worksheet; proposed 7.823 mill increase to 64.124 mills (over revenue neutral rate of 53.781)
- Proposed moratorium on alternative energy and data center development from GIS/Zoning Director Troy Livingston
- Executive session per K.S.A. 79-4319(b)(2) for legal matters regarding interlocal agreement with Junction City Area Chamber of Commerce and City of Junction City
- Agency appropriation requests include Pawnee Mental Health at $319,200 (52% increase) and ATA Bus at $140,000 (40% increase)
- Sheriff Nate Boeckman bi-weekly report and Health Department Director Charles Martinez monthly meeting
budgettax-increasezoningmoratoriumalternative-energydata-centersexecutive-sessionpublic-hearing
✓ Decided: Commission approves temporary moratorium on energy and data center developments
The Commission approved a 12-month moratorium on applications for alternative energy facilities and data center developments. They also authorized a meeting with the Chamber of Commerce and the Mayor of Junction City to discuss an interlocal agreement. Additionally, the Commission reviewed the 2027 budget development worksheet and scheduled a work session.
- Approved executive session for legal matters regarding interlocal agreement (unanimous)
- Instructed Chairman Tremont to schedule meeting with Chamber of Commerce and Mayor of Junction City (unanimous)
- Approved Resolution 6-22-2026 establishing a 12-month moratorium on alternative energy and data center developments (unanimous)
- Approved Change Order #2026000736 for real estate tax roll correction (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 22nd, 2026
10:00-10:15 Commission review and update
10:15-10:30 Crystal Malchose, HR Director-Weekly Update
10:30-10:45 Executive Session per K.S.A. 79-4319(b)(2) for legal matters pertaining to the interlocal agreement
with the Junction City Area Chamber of Commerce and the City of Junction City.
10:45-11:00 Nate Boeckman, SheriƯ, Bi-Weekly Report
11:00-11:45 Tami Robison, Finance Director-Budget Worksession-2027 Valuation, Budget Developmental
Worksheet
11:45-12:00 Charles Martinez, Health Department Director, Monthly Meeting
12:00 Public Comment (5 minutes per person)
12:15-12:30 Troy Livingston, GIS/Zoning Director-Proposed moratorium on alternative energy and data center
development
12:30 Adjourn
MEETING: June 22, 2026
SUBJECT: 2027 Development Worksheet
PRESENTER: Tami Robison, Finance Director
BACKGROUND
The Development Worksheet, page 1, reflects actual expenditures for 2025, the 2026 expenditure
budget and the 2027 proposed budget for the General fund by department. The transfers and
appropriation requests are listed separately. These same categories are provided for the following
funds: Debt Service, Capital Improvement, County Facilities, Special Bridge, Economic
Development and the Health Department.
On the left side of page 2 of the Development Worksheet, 2026 General fund budgeted revenue
and 2027 proposed budgeted revenue is reflected. The right side
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
June 22", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Giordano: Stated last Wednesday, Vicki Schmidt, candidate for governor was in the city, some leaders in
the community were invited to talk to Ms. Schmidt about concerns in the community.
Stated on Thursday, she was invited by Senator Marshall’s office to be at a round table with HUD, SBA,
and USDA-talked about projects and concerns-water, housing, childcare, infrastructure-resources were
provided. EPA just came out with some grants, she talked about Laurel Canyon and the needs there. It
was good information and a good meeting.
Ascher: Attended a Flint Hills MPO meeting-the financials look good. A program called Fort Riley Safe
Passage for the soldiers-vouchers are issued to soldiers for captains and lower rank, 2- $30 vouchers per
year, help them get transportation to Manhattan and Junction City, and not drive impaired. They had 585
rides worth $13,000.00. It is working really well.
Attended a PBC meeting-Jeff Kline, Maintenance Supervisor with the hospital gave an update on deferred
maintenance- all big central electrical projects are done, next job is plumbing, sinks, toilets to be
completed next spring
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 15, 2026
Commissioners
County to decide on $12,400 bridge inspection agreement with KDOT
The Geary County Commission will review and possibly approve a federal-aid bridge inspection master agreement with KDOT for 2026, covering multiple bridges at a total county cost of $12,400. The meeting also includes weekly updates from HR and Public Works, followed by public comment.
- Agreement 177-14: Statewide Bridge Inspection Master Agreement with KDOT, county share $12,400
- Bridge inspections include NSTM types (3 locations), underwater (UW), pin/hanger (PH), and element-level data collection
- Specific bridge locations: 4.0S of Junction City, 5.5S 3.0E of Wreford, and structure KA-4089-03
- Public comment period scheduled for 12:00-12:15
county-commissionbridgesinfrastructurepublic-workskdotbudgetgeary-county
✓ Decided: Commissioners approve local emergency and several public works agreements
The Geary County Commission approved a State of Local Emergency due to recent storms. Additional actions included approving water system grant agreements, road closures, and safety resolutions.
- Approved State of Local Disaster Emergency resolution (2-0)
- Approved Rural Development Water and Waste System Grant Agreement for Laurel Canyon (2-0)
- Accepted Kansas Department of Agriculture inspection paperwork (2-0)
- Accepted KDOT KLBIP report (2-0)
- Approved temporary McNeal Road closure for bridge drilling (2-0)
- Approved employee overtime for storm cleanup on 6-13-2026 (2-0)
- Approved Resolution 6-15-2026A adopting the transportation safety action plan (2-0)
- Approved real estate tax roll change orders and previous meeting minutes (2-0)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 15th, 2026
10:30-10:45 Commission review and update
10:45-11:00 Crystal Malchose, HR Director, Weekly Update
11:00-11:30 Jeremie Myers, Public Works Administrator-Bi-Weekly Report
11:30-11:45
11:45-12:00
12:00-12:15 Public Comment (5 minutes per person)
12:15 Adjourn
Agreement 177-14
Geary County
Bridge Number Type Location Description Estimated Cost
(County's Share)
000310873604441 NSTM 4.0S OF JUNCTION CITY
000310879404545 NSTM 5.5S 3.0E OF WREFORD
UW (Underwater) 106 C-4906-04
PH (Pin and Hanger) 106 C-4864-03
NSTM (Nonredundant Steel Tension Member) 106 KA-4089-03
EL (Element Level data collection)
Issued:
By:
Bridge Section, KDOT- Bureau of Local Projects
$6,550.00
$5,850.00
"Special Attachment No. 2"
FEDERAL - AID BRIDGE INSPECTION
Statewide Bridge Inspection
Master Agreement
2026
Structure List
$12,400.00
Type:
6/2/2026
Lynn Berges
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
June 15", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont (on vacation)
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Vice-Chairman Giordano called the County Commission meeting to order at 10:30 a.m.
The pledge of allegiance was recited.
Garry Berges, Emergency Management Director presented a proclamation of a State of Local Emergency
for Geary County, Kansas because of the recent storms. Commissioner Ascher moved to approve
Resolution 6-15-2026: a proclamation of a State of Local Disaster Emergency for Geary County;
Commissioner Giordano seconded and both voted aye. Mr. Berges left the meeting.
Commission review and update:
Ascher-No meetings last week.
Attended the Juneteenth event.
Stated the Chamber of Commerce Chairman sent out an update on what is going on at the Chamber-a
CPA has been hired and is going to review the financials and an attorney has been hired.
Giordano-Attended Lt. General Matt Hardman’s going away ceremony at Fort Riley.
Attended the employee .task force meeting-the HR Director will give a report.
Attended the childcare coalition meeting, they are working with providers and assisting them.
Attended the Juneteenth event.
Crystal Malchose, HR Director gave the weekly report:
e Reminded the commission that this Friday, June 19, the county offices will be closed for the
Juneteenth holiday.
e Employee training day is scheduled
[Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 11, 2026
Commissioners
County Commission holds budget work session with department requests
This is a budget work session where department heads present their funding requests for the upcoming fiscal year. No votes or decisions are scheduled; the meeting is for discussion and information gathering only.
- Rural Fire/Emergency Management budget request presentation
- Elections/Clerk budget request presentation
- GIS/Planning, Zoning, Sanitation budget request presentation
- Health Department budget request presentation
- Sheriff budget request presentation
budgetcounty-commissionwork-sessionpublic-safetyhealth-department
✓ Decided: Commissioners review various 2027 budget requests during work session
The Geary County Commission held a budget work session to review requested funding amounts for several departments and services. No formal votes or decisions were recorded during this meeting.
- Reviewed 2027 budget requests for various county departments
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Budget Work Session Schedule
June 11th, 2026
1:30 p.m. Budget request presentation-Garry Berges, Curt Janke-Rural Fire/Emergency Management
1:40 p.m. Budget request presentation-Courtney Gilbert-Elections/Clerk
1:50 p.m. Budget request presentation-Troy Livingston-GIS/Planning, Zoning, Sanitation
1:55 p.m. Budget request presentation-Travis Lilly-Appraiser
2:05 p.m. Budget request presentation-Charles Martinez-Health Department
2:20 p.m. Budget request presentation-Crystal Malchose- Human Resources
2:30 p.m. Budget request presentation-Tami Robison-CIP , General Services, Special Bridge, Finance,
Commissioners, EDC, Opioid, Debt Service, Special Alcohol, CVB
3:00 p.m. Budget request presentation-Judge Sexton, Nikki Davenport, Stephanie Petrie-District Court, Court
Trustee
3:15 p.m. Budget request presentation-Nate Boeckman-SheriƯ
3:30 p.m. Budget request presentation-Jeremie Myers, Kalyn Ross-Noxious Weed, Waste Disposal, Landfill,
Public Works, Water/Sewer Districts, Parks/Rec, Cloud County Community College, Facilities
4:00 p.m. Budget request presentation-Krista Blaisdell-County Attorney
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
BUDGET WORK SESSION MEETING OF THE GEARY COUNTY COMMISSION
MINUTES
June 11%, 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor (absent) '
Chairman Tremont called the County Commission meeting to order at 1:30 p.m.
Members of the public arriving at the meeting: Gary Olds, Lisa Eickholt, Gerald Gerloff
Garry Berges, Emergency Management Director/Rural Fire Chief and Assistant Director Curt Janke,
2027 budget request - Rural Fire District: $595,020.00
Emergency Management: $291,956.00
Courtney Gilbert, Clerk/Elections-
2027 budget request — Clerk: $264,579.00
Election: $213,454.00
Troy Livingston, GIS Director Planning/Zoning/Sanitation-
2027 budget request - $306,759.00
Travis Lilly, County Appraiser-
2027 budget request - $656,171.00
Charles Martinez, Health Department Director -
2027 budget request - $329,802.00
Crystal Malchose, Human Resources Director -
2027 budget request - $388,402.00
Tami Robison, Finance Director -
2027 Finance Office budget request - $382,361.00
2027:BOCC budget request - $192,975.00
2027 General Services budget request - $12,782,013
2027 Debt Services budget request - $4,682.909.00
2027 Economic Development budget request - $507,183.00
2027 Special Alcohol budget request - $100,999.00
2027 Opioid budget request - $128,432.00
2027 CIP - $2,981,826.00
2027 Special Bridge budget request - $911,431.00
2027 CVB budget request - $1,126,699
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 8, 2026
Commissioners
Commission holds executive session on Interlocal Agreement legal matters
The Geary County Commissioners will meet to review routine reports and then enter an executive session to discuss legal issues concerning the Interlocal Agreement with Junction City and its Chamber of Commerce. After the session, public comment is scheduled, followed by a series of budget request presentations covering departments such as the Mainstreet project, Emergency Shelter, Pawnee Mental Health, Library, and Register of Deeds. The agenda also includes a Treasurer’s daily cash and investment statement for May 29, 2026.
- Executive session (75-4319(b)(2)) to discuss legal matters of the Interlocal Agreement with Junction City and the Chamber of Commerce
- Budget request presentations for Mainstreet, Emergency Shelter, Pawnee Mental Health, Library, Register of Deeds, Community Involvement Team, EDC/MAC/Chamber, and other agencies
- Treasurer’s daily statement shows total cash and investments of $41,073,619.79 and daily collections of $90,476.34
- Cash items include $600,000 for Sports Complex CD, $200,000 for Waste Disposal CD, and $5,200,000 for new CDs
- General Fund ending balance of $18,618,854.39 after receipts of $20,454,858.37
budgetlegalinterlocal-agreementfinanceexecutive-sessionpublic-comment
✓ Decided: Commission expresses no confidence in EDC Director and restricts Chamber funding
The Commission issued a vote of no confidence in the EDC Director and ordered the cessation of all non-essential fund disbursements to the Chamber. Additionally, the Board voted to prepare notice to renegotiate or terminate the interlocal agreement governing the Chamber, EDC, and MAC.
- Approved pay grade increase for Kimberly Roberts (3-0)
- Approved new policy allowing employment of 16 and 17 year olds for specific clerical roles (3-0)
- Passed vote of no confidence in EDC Director Mickey Dean (3-0)
- Ceased all non-essential disbursements to the Chamber (3-0)
- Approved notice to renegotiate or terminate the Chamber interlocal agreement (3-0)
- Approved June 1, 2026 meeting minutes (3-0)
- Approved June 3, 2026 budget work session minutes (3-0)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 8th, 2026
10:00-10:15 Commission review and update
10:15-10:30 Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 Tami Robison, Finance Director, Financial Reports
10:45-11:00
11:00-11:15 Nate Boeckman, SheriƯ-Bi-Weekly Report
11:15-11:45 Executive Session under 75-4319(b)(2)-Discuss legal matters related to the Interlocal Agreement
between Geary County, Junction City and the Junction City Area Chamber of Commerce
11:45-12:00
12:00-12:15 Public Comment (5 minutes per person)
12:15 Adjourn
5:00 p.m. Budget request presentation-Mainstreet-Jordan McCann
5:15 p.m. Budget request presentation-Emergency Shelter-Debbie Savage
5:30 p.m. Budget request presentation-Pawnee Mental Health-Michael Rezkalla
5:50 p.m. Budget request presentation-Library-Donna Porter
6:00 p.m. Budget request presentation-Register of Deeds-Jacqie Reisinger
6:10 p.m. Budget request presentation-Community Involvement Team-Laura Rhodes, Cayla Da Giau
6:20 p.m. Budget request presentation-EDC, MAC, Chamber-Mickey Dean
6:50 p.m. Budget request presentation-Jana Williams, Kent Glasscock, Flint Hills Regional Council
6:55 p.m. Budget request presentation-JC EMS-Jason Lankas
7:10 p.m. Budget request presentation-Big Lakes-Liz Holle
7:25 p.m. Budget request presentation-Area Agency on Aging-=Julie Govert Walter
TREASURER'S DUPLICATE STMT AND VOUCHERS SHEET
AND VOUCHERS DAILY STATEMENT May 29 2026
GEARY COUNTY TREASURER
SHERRI CH
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
June 8%, 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
e Tremont-Did not have any meetings last week. She thought the first budget work session went
well last week, wished there were more public there.
Sad weekend with the little boy that was missing-proud of our law enforcement and community
that pulled together to assist with the search.
Ascher-Did not have any meetings last week. He also stated he was proud of the groups that
pulled together to assist with the search.
Giordano-Spoke to the Sheriff’s Department about the search for the missing boy, there were
hundreds of people helping.
Stated her and Tami Robison, Finance Director spoke to the Landlord Association.
Attended the CVB meeting-The new director will be starting soon, and they discussed how to
bring more people to the community. Last year the first quarter was the worst year Geary County
had for TGT collection since 2020.
Attended the ribbon cutting to Flint & Vine-very nice addition to the area.
Henry Petty arrived at the meeting.
Deputy Clerk Hoff asked to amend the agenda. Commissioner Giordano moved to amend the agenda
to add an executive session under 75-4319(b) (2) legal matters related to R
[Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 3, 2026
Commissioners
Budget worksession features 15 agency presentations for Geary County
The Geary County Commission holds a budget worksession to hear funding requests from multiple agencies, including Juvenile Detention, Flint Hills Regional Leadership, Extension & Free Fair, Opera House, Historical Society, ATA Bus, Senior Citizens Center, FHMPO, and others. Presentations are scheduled in 10- to 15-minute slots from 5:00 p.m. to 7:40 p.m. No votes or decisions are scheduled; this is a discussion and information-gathering session.
- Juvenile Detention budget request presented by Angela Hamilton and Shawn Brandmahl
- Flint Hills Regional Leadership budget request by Jack Lindquist
- ATA Bus budget request by Anne Smith, Rebecca Doehling, and Daphne McNelly
- Senior Citizens Center budget request by Sally Jardine and Joe Mitchell
- Freedom Fest budget request by Nathan Butler and Bob Story
budgetcounty-commissionjuvenile-detentionpublic-transitsenior-serviceshistorical-societycommunity-events
✓ Decided: Commission meeting adjourned without any decisions on 2027 funding requests
The Geary County Commission met on June 3, 2026, heard public comments on numerous 2027 funding requests, and discussed the source of some funds. No approvals, denials, or votes on any of the listed requests were recorded. The meeting was adjourned at 8:15 p.m.
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Budget Worksession Schedule
June 3rd, 2026
5:00 p.m. Budget request presentation-Juvenile Detention-Angela Hamilton/Shawn Brandmahl
5:10 p.m. Budget request presentation-Flint Hills Regional Leadership-Jack Lindquist
5:20 p.m. Budget request presentation-Extension & Free Fair-Ginger Kopfer
5:35 p.m. Budget request presentation-Opera House-Ellie Dillon
5:45 p.m. Budget request presentation-Historical Society-Heather Hagedorn, Bill Powers
5:55 p.m. Budget request presentation-ATA Bus-Anne Smith, Rebecca Doehling, Daphne McNelly
6:15 p.m. Budget request presentation-Senior Citizens Center-Sally Jardine, Joe Mitchell
6:25 p.m. Budget request presentation-FHMPO-Jared Tremblay
6:35 p.m. Budget request presentation-Three Rivers-Erica Christie, Barb Kephart, Ashley Wolfrum
6:45 p.m. Budget request presentation-Becky Osbourn
6:55 p.m. Budget request presentation-Sherri Childs, Treasurer
7:05 p.m. Budget request presentation-Conservation District-Angela Beavers, Rod Gfeller, Shelby Richling,
Gary Schellhorn, Brandon Dibben, Scott Miller, Bethanee Yarnell
7:15 p.m. Budget request presentation-Community Corrections Recovery Court-Chrysann Phipps
7:25 p.m. Budget request presentation-Freedom Fest-Nathan Butler, Bob Story
7:40 p.m. Budget request presentation-Harmony Center & Fest-Martine Chery
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
June 3rd, 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk
Chairman Tremont called the County Commission meeting to order at 5:00 p.m.
The pledge of allegiance was recited.
Members of the public arriving at the meeting: Henry Petty, Lisa Eickholt, Gerald Gerloff, Gary Olds
North Central Kansas Regional Juvenile Detention Facility, Angela Hamilton-
2027 request-$247,292.08
Flint Hills Regional Leadership Program, Jack Lindquist
2027 request-$1,000.00
Extension Office-Ginger Kopfer, Renae Riedy, Verle Amthauer, Josh Haynes
2027 request-$374,000.00
4H Fair-Ginger Kopfer, Renae Riedy, Amy Blockcolsky-4H Fair
2027 request-$18,000.00
CL Hoover Opera House-Ellie Dillon, Executive Director
2027 request-$60,000.00
Geary County Historical Society-Heather Hagedorn, Bill Powers
2027 request-$105,000.00
ATA Bus-Anne Smith, Rebecca Doehling, Daphne McNelly
2027 request-$140,000.00
Senior Citizen Center- Sally Jardine, Amy Osbourn, Joe Mitchell
2027 request-$170,000.00
Flint Hills MPO-Jared Tremblay
2027 request-$1,791.93
Three Rivers-Erica Christie
2027 request-$15,000.00
Circle A Club-Becky Osbourn, Charles Osbourn, Tom Grelk
2027 request-$8,734.00 (Special Alcohol Fund)
County Treasurer, Sherri Childs
2027 request-$665,509.00
Community Corrections Recovery Court- Chrysann Phipps
2027 request-$26,000.00 (Opioid Funds)
Minutes 06-03-2026 P
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 1, 2026
Commissioners
County Commission to decide on storage facility conditional use permit
The Geary County Commission will hear a recommendation from the Planning Commission to approve a Conditional Use Permit for boat/RV and walk-in storage at 4308 N US77 Hwy, Junction City. The property is zoned Suburban Residential and has been vacant for decades. The Commission will also receive routine departmental reports and a quarterly update from Pawnee Mental Health.
- Conditional Use Permit GCCU-05-01-26 for boat/RV and walk-in storage at 4308 N US77 Hwy, Junction City
- Public Works bi-weekly report and Emergency Management monthly report
- Pawnee Mental Health 1st quarter update
- Public comment period (5 minutes per person)
conditional-use-permitzoningstoragepublic-hearingcounty-commissionmental-healthpublic-works
✓ Decided: Commission approved $78,933 LED lighting upgrade for county buildings
The commission voted unanimously to accept a comprehensive LED lighting upgrade for the Courthouse, Office Building and Public Works facilities, allocating $78,933 from the special CIP. Additional approvals included a $250 KDOT right‑of‑way purchase, a $40 fee for undeclared freon units, and several utility easement requests. The meeting also set dates for upcoming budget presentations and a future RFP for a courthouse boiler room project.
- Approved LED lighting upgrade for county buildings ($78,933) (aye)
- Approved $250 payment to KDOT for right‑of‑way at Station #4 (aye)
- Approved resubmission of 2025 EMPG paperwork (aye)
- Approved Carlyon & Sons power line easement request (aye)
- Approved Rural Water District water line easement request (aye)
- Approved $40 fee for undeclared freon units at transfer station (aye)
- Approved additional chemical purchase request ($7,140.68) (aye)
- Approved conditional use permit for boat/RV storage at 4308 N US 77 Hwy (aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda June 1*, 2026
10:00-10:15 | Commission review and update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report
10:45-11:00_| Garry Berges, Emergency Management Director, Rural Fire Chief, Monthly Report
11:00-11:30 | Jeremie Myers, Public Works Administrator-Bi-Weekly Report
11:30-11:45 | Troy Livingston, GIS/Zoning-Conditional Use request for a storage facility
11:45-12:00_| Pawnee Mental Health-1* Qtr. Update
12:00-12:15 | Public Comment {5 minutes per person)
12:15 Adjourn
GEARY COUNTY
PLANNING COMMISSION/
BOARD OF ZONING APPEALS
STAFF REPORT
May 12, 2026
TO: Geary County Planning Commission / Board of Zoning Appeals
FROM: Troy Livingston, Director of Planning and Zoning/GIS
SUBJECT: GCCU-05-01-26 — Request for a Conditional Use Permit to allow Boat/RV storage on
property zoned “SR” Suburban Residential
This is the request of Simon Smith, agent on behalf of Michael Smith, owner, requesting a Conditional Use
Permit to allow boat/RV storage on property zoned “SR” Suburban Residential District located at 4308 N US77
Hwy, Junction City, Geary County, Kansas.
BACKGROUND
Mr. Smith contacted my office asking about the possibility of utilizing the property at 4308 N US77 Hwy as boat/RV
storage. His intention is to remove all existing structures, do all of the required preparatory dirt work, construct
new facilities and use the property for boat/RV storage
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
June 1°, 2026
Commissioners Present: Keith Ascher, Trish Giordano (Joined the meeting by phone), and Kathy
Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
Commissioner Giordano joined the meeting by phone.
The pledge of allegiance was recited.
Henry Petty arrived at the meeting.
Commission review and update:
Ascher: Attended the Chamber Board of Directors meeting-the first 40 minutes was executive session,
when the meeting resumed there were three motions on the table approved- hire legal counsel for the
chamber, have a forensic audit done, board needs training on what the board should be doing. It was
decided to get all wrapped up by June 25, then have a special meeting on June 25 at 3:30.
Raised $13,000.00 at the golf tournament, new teacher’s breakfast is Wednesday, July 29, 2026
MAC-no director-no report-work through the city.
EDC-The Chamber submitted a recommendation to separate from the master agreement, but that was
tabled until the special meeting on June 25.
There was a brief discussion about the pros and cons of data centers.
JC Proud had a clean-up yesterday from 8:00 a.m. to noon.
Tremont-Attended the Pawnee Mental Health Board Meeting-mainly talked about finances and budget.
Attended the EDC Board meeting-talked about the separation-concerns of both sides, director has too
many
[Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 26, 2026
Commissioners
Public hearing on negotiated sale of 125 E. Elm
The County Commission will hold a public hearing on the negotiated sale of 125 E. Elm under K.S.A. 79-2803(b). They will also review weekly reports from HR and the Sheriff, appoint a Homeless Task Force member, and receive a monthly update from the Health Department. An executive session on non-elected personnel is scheduled.
- Public hearing for negotiated sale of 125 E. Elm under K.S.A. 79-2803(b)
- Homeless Task Force appointment
- Crystal Malchose, HR Director, weekly report
- Nate Boeckman, Sheriff, bi-weekly report
- Executive session on non-elected personnel
commissionpublic-hearingproperty-salehealth-departmenthomeless-task-forcepersonnel
✓ Decided: Commission approved $1,000 sale of 125 E. Elm property
The commission accepted a $1,000 bid for the property at 125 E. Elm after a public hearing. Commissioners also appointed Kristy Upham to the Homeless Task Force board and approved a $300 allocation to the RERC from CVB funds. Additional actions included approving agenda amendments, change orders, and the prior meeting minutes.
- Approved $300 RERC allocation from CVB funds (all aye)
- Approved agenda amendment to add CIC discussion (all aye)
- Appointed Kristy Upham to Homeless Task Force board (all aye)
- Opened meeting as County Board of Health (all aye)
- Accepted $1,000 bid for 125 E. Elm property (all aye)
- Approved Change Order #2026000726-2026000729 (all aye)
- Approved minutes from May 18, 2026 (all aye)
- Approved motion to end meeting as County Board of Health (all aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 26", 2026
10:00-10:15 | Commission review and update
10:15-10:30_| Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45_ | Homeless Task Force Appointment
10:45-11:00 | Nate Boeckman, Sheriff-Bi-Weekly Report
11:00-11:15_ | Charles Martinez, Health Department Director-Monthly meeting
11:15-11:30 | Executive Session-Non-Elected Personnel
11:30-11:45 | Public Hearing for Negotiated Sale of 125 E. Elm under K.S.A. 79-2803(b)
11:45-12:00
12:00-12:15 | Public Comment (5 minutes per person)
12:15 Adjourn
Geary County
Health Department
1212 West Ash Street
P. O. Box 282
Prevent ic Health Junction City, Kansas 66441
26 May 2026
Geary County Board of Health
GCPHD Monthly Update
1. Updates
Trooper Gate Discussion
GCPHD met with Fort Riley Public Health and Mayor Butler to conduct fact-finding regarding the Trooper
Gate closure, including its purpose and potential public health impacts. As a result of the meeting, Mayor
Butler will explore what would be required to repair the bridge, and Fort Riley Public Health will request
additional information from division leadership.
GCPHD Leasing Space
GCPHD is coordinating a consultation with local realtors to determine a fair market rate for leasing
available office space within the Health Department to public health-adjacent agencies. The intent is to
utilize unused space to support organizations that align with the social determinants of health model and
improve community
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
May 26", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
Citizens arriving at the meeting: Kristy Upham and Henry Petty.
The pledge of allegiance was recited.
Commission review and update:
Giordano: Commissioner Giordano moved to amend the agenda to approve giving the RERC $300
from CVB funds; Chairman Tremont seconded and all voted aye.
Attended the Flint Hills Regional Council tabletop exercise event. Garry Berges, Emergency Management
has good disaster plans.
Attended the Chamber membership meeting- discussion about the finances, concerns how things were
handled with MAC and going forward, the Chairman will be discussing things with the entire board this
week,
Attended the Business During Hours at the Spruce Suites Retirement Living-toured the apartments-very
nice and an asset to the community.
Stated she thought there were good applicants for the CVB director position and hopes to get it taken care
of soon.
Tremont-Attended the Juvenile Detention board meeting-they are going to hire Angela Hamilton as the
new director starting on October 1, she has been working with current director Brandmahl.
Ascher- Attended the Risk Management meeting last week-there is still $700 of RAG money left if any
department needs it for safety
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 18, 2026
Commissioners
Commission to appoint Homeless Task Force member
The Geary County Commission will review routine reports and consider an appointment to the Homeless Task Force. An executive session for non-elected personnel recruitment is scheduled. A joint City/County/USD meeting is set for 5:30 PM at the C.L. Hoover Opera House.
- Homeless Task Force appointment
- Executive session for non-elected personnel recruitment
- Joint City/County/USD meeting at C.L. Hoover Opera House at 5:30 PM
- Public Works bi-weekly report by Jeremie Myers
- YMCA update by CEO Amber Stanley
appointmenthomeless-task-forceexecutive-sessionrecruitmentjoint-meetingymcapublic-works
✓ Decided: Commission approved $44,020 East Street repair project
The Geary County Commission approved funding for an East Street repair using Shilling Construction, and also approved a $15,000 YMCA equipment request, multiple utility and contract renewals, and tax roll corrections. All motions were moved, seconded, and passed with all commissioners voting aye. The meeting also included an executive session and approval of the prior meeting minutes.
- Approved $15,000 YMCA equipment request (all voted aye)
- Approved Cox Communications conduit and fiber request (all voted aye)
- Approved Cox Communications conduit, vaults, and fiber on Old Hwy 77 (all voted aye)
- Approved Craig Royse culvert request on Easy Jacks Road (all voted aye)
- Approved renewal of Thermal Comfort Air preventative maintenance contracts (all voted aye)
- Approved renewal of Siemen’s fire alarm monitoring contract for sheriff's office (all voted aye)
- Approved $4,300 surge protector replacement at Sewer #4 Laurel Canyon (all voted aye)
- Approved $44,020 East Street repair with Shilling Construction (all voted aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 18", 2026
10:00-10:15 | Commission review and update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45_| Homeless Task Force Appointment
10:45-11:00 | Amber Stanley, CEO-YMCA-Update
11:00-11:30 | Jeremie Myers, Public Works Administrator-Bi-Weekly Report
11:30-11:45_| Executive Session, Non-Elected Personnel, Recruitment
11:45-12:00
12:00-12:15 | Public Comment (5 minutes per person)
12:15 Adjourn
5:30 Joint City/County/USD Meeting-C.L. Hoover Opera House
Kansas
Department of Agriculture
Leafy Spurge
(Euphorbia virgate)
Canada Thistle
(Cirsium arvense)
Click on QR Code to
learn more about Kansas
noxious weeds.
Kansas’ Nox
Hoary Cress
(Lepidium draba L.)
Quackgrass
(Elymus repens)
(Pueraria montana
ous Weeds
Kudzu
Russian Knapweed
(Rhaponticum repens)
var. lobata)
Category B
Common Teasel
(Dipsacus fullonum)
Cutleaf Teasel
(Dipsacus laciniatus)
Category A: Limited distribution in Kansas, subject to
active eradication to prevent establishment.
Category B: Discrete distributions in Kansas, subject
to control wherever established and subject to active
eradication wherever not established.
Category C: Well-established in larger populations in
Kansas. New populations subject to control efforts and
established populations shall be managed by approved
control methods.
Kansas Department of Agriculture
Plant Protection and Weed Control
1320 Research Park Drive
Manhattan, KS 66502
785-56
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
May 18", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Ascher-Did not have meetings to attend last week.
Congratulations to all the graduates in the area.
Attended the Run for the Wall Sunday. CVB received a plaque for sponsorship of the event.
Tremont: Attended the EDC Board meeting last Thursday. Discussed-destination boot camp-11 are
going to attend, Opportunity zone 2.0-working with the city, budget request from the county for EDC-
same as last year. The City Manager talked about the Homeless Task Force appointment; it is an eleven-
member board-1 representative from the county to be appointed by the board- Kristy Upham is interested
in the position. It is a 3-year term that may be re-appointed. Commissioner Giordano stated the word
should be put out to see if anybody is interested in the position- it will be on the agenda next week.
The City Manager sent information about the convention center cooperation and escrow agreements-
reviewed by Counselor Edwards-office space available in the convention center discussion.
Attended the Mainstreet Market on Saturday.
Giordano: Attended a childcare round table discussion-it included the city and county and busi
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026
Commissioners
Commissioners to vote on Sewer #4 Improvement Project resolution
The Geary County Commission will discuss and vote on a resolution for the Sewer #4 Improvement Project. The meeting also includes weekly reports from Human Resources and Finance, a presentation of the KCAMP Risk Management Award, and a period for public comment.
- Discussion and approval of a resolution for the Sewer #4 Improvement Project
- KCAMP Risk Management Award presentation by Patrick Smith
- HR Director weekly report by Crystal Malchose
- Finance Director bi-weekly report and financial reports by Tami Robison
- Public comment period (5 minutes per person)
sewerinfrastructurepublic-worksrisk-managementcounty-commissionfinancehuman-resources
✓ Decided: Commission approved loan and funding actions for Sewer #4 improvement
The commission accepted a $136,000 loan resolution, approved the request for obligation of funds, and approved a letter of intent to meet USDA Rural Development conditions for the Sewer #4 project. All three actions were moved, seconded, and passed unanimously. The meeting also approved the new holiday pay policy and the minutes from previous meetings.
- Approved new holiday pay policy with temporary hours (unanimous aye)
- Accepted Loan Resolution for Sewer #4 ($136,000) (unanimous aye)
- Approved Request for Obligation of Funds for Sewer #4 (unanimous aye)
- Approved Letter of Intent to Meet USDA Rural Development Conditions (unanimous aye)
- Approved April 20, 2026 minutes (unanimous aye)
- Approved April 27, 2026 minutes (unanimous aye)
- Approved May 4, 2026 minutes (unanimous aye)
- Extended executive session 10 minutes (unanimous aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 11", 2026
10:00-10:15 | Commission review and update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report & Financial Reports
10:45-11:00 | Patrick Smith, KCAMP Present Risk Management Award
11:00-11:15 | Jeremie Myers-Public Works Administrator-Discussion & Approval of a resolution for Sewer #4
Improvement Project
41:15-11:30
11:30-11:45
11:45-12:00
12:00-12:15 | Public Comment (5 minutes per person)
12:15 Adjourn
Geary County
Composition of Cash Balances and Investments
As Of: 4/30/2026
Cash on Hand/
Net Bank Balance Investments In Transit Total
Cash and Cash Items
Cash on Hand Bank $10,550.00 $0.00 $0.00 $10,550.00
Certificate of Deposit
CENTRAL NATIONAL BANK. $0.00 $6,000,000.00 30.00 $6,000,000.00
Demand and Time Deposits
CENTRAL NATIONAL BANK. $30,880,874.15 $0.00 $0.00 $30,880,874.15
State Investment Pool
OMIP $0.00 $1,882,481.56 $0.00 $1,882,481.56
$30,891,424.15 $7,882,481.56 $0.00 $38,773.905.71
Operator: frobison52 5/4/2026 11:12:23 AM Page 1 of 1
Report ID: BKLT30
TREASURER’S DUPLICATE STMT AND VOUCHERS SHEET
AND VOUCHERS DAILY STATEMENT
DAILY COLLECTIONS
HEALTH DEPARTMENT
TRANSFER STATION ACH
MISCELLANEOUS DEPOSITS
MORNING BALANCE
TOTAL
DAY'S PAYMENTS
MISCELLANEOUS DEBITS
EVENING BALANCE
Sports C omplex-CD
WASTE DISPOSAL CNB CD
CNB-New CD'S
OMIP
CENTRAL NATIONAL BANK
CASH IN DRAWER & PETTY CASH
TOTAL
April 29 2026
GEARY
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
May 11%, 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commissioner Giordano apologized to the Chairman for taking over the meeting last Monday during the
public comment. She felt it was escalating and should be shut down. Chairman Tremont appreciated her
stepping up and doing that.
Commissioner Giordano moved to amend the agenda to add an executive session for non-elected
personnel/recruitment for 15 minutes te include the HR Directer and County Counselor; Chairman
Tremont seconded and all voted aye.
Commission review and update:
Giordano: Attended a Flint Hills Executive Board meeting.
Attended the Mainstreet transformation strategy meeting-they asked questions about the community-so
they can evaluate and see what we need to work on.
Attended a CVB meeting-most of the members attended-several sponsorships in the community were
approved.
Attended the ECC Ribbon cutting-very well attended event.
Ascher-Did not have any meetings last week.
Attended the ECC ribbon cutting, impressed with the crowd, well organized event.
Tremont-Attended the Mainstreet transformation strategy meeting-good to see so many people getting
together to gather ideas or concerns. There were business leaders, ele
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 4, 2026
Commissioners
Commissioners to consider permit for chickens on small lots
The Board of County Commissioners will review a request to allow chickens on properties smaller than 3 acres. The meeting also includes reports from county directors and a liquor license application.
- Conditional Use Permit for chickens on properties from 807 N Milford Lake Rd. to 1109 N Milford Lake Rd.
- Cereal Malt Beverage License application for Milford State Park Marina
- Offer on unsold County Owned Property
- Weekly report from Human Resources Director Crystal Matchose
- Bi-Weekly report from Public Works Administrator Jeremie Myers
zoningagricultureliquor-licensecounty-property
✓ Decided: Commission lowers chicken acreage limit to 2 acres and approves conditional use permit
The commission accepted Dwane Diah's $1,000 offer to purchase the vacant lot at 125 E. Elm St. and approved new entrance petitions for Milford Lake Road and Humboldt Creek Road. It also accepted a $10,000 compensation from Wildcat Construction for the East Street haul‑route project and approved a $20,529.97 audio‑visual system for the commission and conference rooms, waiving the standard purchase policy. Finally, the commission adopted a resolution lowering the chicken‑keeping acreage threshold to 2 acres and granting a conditional use permit for chickens on the specified area.
- Accepted Dwane Diah's $1,000 offer for 125 E. Elm St. (all voted aye)
- Approved new entrance petition on Milford Lake Road (all voted aye)
- Approved new entrance petition on Humboldt Creek Rd (all voted aye)
- Accepted $10,000 compensation from Wildcat Construction for East Street project (all voted aye)
- Approved REDI Systems audio‑visual proposal for commission and conference rooms, total $20,529.97 (all voted aye)
- Waived purchase policy for the REDI Systems audio‑visual proposal (all voted aye)
- Adopted resolution lowering chicken acreage to 2 acres and granting conditional use permit for chickens (all voted aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda May 4", 2026
10:00-10:15
Commission Review and Update
10:15-10:30
Crystal Matchose, Human Resources Director, Weekly Report
10:30-10:45
Offer on unsold County Owned Property
10:45-11:00
Garry Berges, Emergency Management Director, Rural Fire Chief-Monthly Report
10:55
Break
11:00-11:30
Jeremie Myers, Public Works Administrator, Bi-Weekly Report
11:30-11:45
Executive Session-Non-Elected Personnel
11:45-12:00
Troy Livingston, GlS/Zoning Director-Conditional Use Permit
12:00-12:15
Public Comment (5 minutes per person)
12:15-12:30
Approval of Cereal Malt Beverage License-Consumption on Premises-Milford State Park Marina
12:30
Adjourn
GEARY COUNTY
PLANNING COMMISSION/
BOARD OF ZONING APPEALS
STAFF REPORT
April 14, 2026
TO: Geary County Planning Commission / Board of Zoning Appeals
FM: Troy Livingston, Director of Planning and Zoning/GIS
SUBJECT: GCCU-04-01-26 — Request for a Conditional Use Permit to allow farm animals/chickens
on property less than 3 acres.
This is the request of Steven Rickers et al., owners, requesting a Conditional Use Permit to allow chickens
on property less than 3 acres. The properties are located from 807 N Milford Lake Rd. to 1109 N Milford Lake
Rd., Junction City, Kansas.
BACKGROUND
My office received a complaint from a Geary County Sheriff's deputy on behalf of a resident in the general vicinity
of KS Hwy 18 and N Milford Lake Road. The substance of the complaint was that a neighbor had chi
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
May 4", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Ascher-No meetings this week.
Gave a shout out to the Immanuel Lutheran Church who celebrated their 100-year anniversary,
Congratulations to them.
Tremont-Pawnee Mental Health did not have their regular meeting; it was a celebration event.
Giordano-Stated that Michele Rone received the Order of the Sunflower Award.
Stated there will be a Primary Tabletop exercise for the OLDCC Grant.
Reported there will be a RERC (Recreation Economy for Rural Communities) meeting on May 27&28,
will be having a workshop, and she encourages commissioners to attend.
Attended the Stormont Vail Derby fundraiser for the cardiac unit-it was a very good event and well
attended.
Commissioner Ascher gave a shout out to Public Works for all the work they did after all the flooding.
Henry Petty arrived at the meeting.
Commissioner Giordano said there was a discussion and vote last week about the new hours when
Commissioner Ascher wasn’t here, but he said it was ok, he just wants to see what the public thinks about
it and it is just a trial run.
Maria Berkowitz, citizen arrived at the meeting.
Chairman Tremont asked Ms. Berkowitz
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026
Commissioners
Geary County considers 4.5-day work week trial and capital project funding
The Commission will discuss a proposed 6-month trial of a 4.5-day work week to improve employee recruitment and retention. The body will also hold a work session on the Capital Improvement Program (CIP) to review project funding and cash positions.
- Proposed 4.5-day work week trial starting in June
- Request for $25,000 for GIS Office Concrete Steps & Landing Replacement
- Review of $775,000 in non-funded 2026 CIP projects
- Joint meeting with the Public Building Commission
- Proclamation for National Treatment Court Month
employee-benefitsbudgetcapital-improvementspublic-worksgovernment-operations
✓ Decided: Commission approved purchase of 301 East 8 St property and related payment
The commission voted to sign closing documents for the property at 301 East 8 Street and to issue a check for $14,628.86 to cover title fees and the purchase balance. Commissioners also approved a $25,000 GIS concrete landing and step replacement, adopted a temporary 4.5‑day work‑week trial for six months, and approved tax‑roll correction change orders. No other actions were taken.
- Approved signing closing documents for 301 East 8 St property (aye)
- Approved issuing check for $14,628.86 for title fees and purchase balance (aye)
- Approved GIS concrete landing & step replacement $25,000 from CIP fund (aye)
- Approved temporary 4.5‑day work‑week schedule trial starting June 1 2026 (aye)
- Approved Tax Roll Correction Change Orders #2026000710‑2026000716 (aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 27", 2026
10:00-10:15 Commission review and update
10:15-10:30 Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 Tami Robison, Finance Director, Weekly Report
10:45-11:00 Tami Robison, Finance Director-2" Qtr. CIP work session
11:00-11:30 Joint Meeting with the Public Building Commission
11:30-11:45 Sheriff Nate Boeckman, Bi-Weekly Report
11:45-12:00 Jason Lankas, Junction City Fire Chief, 1** Quarter Report-EMS
12:00-12:15 Public Comment (5 minutes per person)
12:15-12:30 Proclamation for National Treatment Court Month
12:30-12-45 Executive Session-Non-Elected Personnel
12:45 Adjourn
COMMISSION AGENDA REPORT
FROM: Tami Robison, Finance Director
MEETING: April 27, 2026
SUBJECT: Capstone-Proposed Schedule Change
BACKGROUND AND DISCUSSION
Competitive pay and benefits are no longer enough to attract and keep quality employees. Because
flexibility and work-life balance may be an alternative solution to this, which may also assist in
recruiting and retaining quality employees, Geary County has been exploring an adjusted work
schedule. However, it is imperative we maintain our current level of service to the citizens.
Even after implementing a wage study, enhancing the county’s benefit package, and holding
supervisory training multiple times a year, the county is stil] encountering high turnover and difficulty
in filling positions.
After reaching out for input from other governmental entities concerning this i
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
April 27", 2026
Commissioners Present: Trish Giordano, and Kathy Tremont, Ascher (absent)
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Giordano- Stated Mayor Butler and she attended as members of the Stan Tech team for the
comprehensive plan. They met and talked about preliminary things, get acquainted with the community.
This is part of the OLDCC grant, information should be going out on public outreach.
Report the MAC breakfast was canceled.
Attended the grand opening for the Stephen A Cohen veterans’ facility in Manhattan.
Tremont: Met with the Sheriff and Pawnee Mental Health-discussed issues, look for better ways to serve
the inmates, there needs to be more help from the state, once an individual is incarcerated, Pawnee Mental
Health services cease, and it is the county’s responsibility to take care of them.
Attended the KCCA conference in Hutchinson and it was very beneficial-they talked about data centers
and property tax issues, most counties have the same issues. Chairman Tremont has asked the Finance
Director and the Appraiser to put together information about where the taxes are spent and how the
Appraiser sets values on property to get out to the public.
Jeremie Myers, Public Works Administrator and Kalyn Ross, Administ
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 20, 2026
Commissioners
Health coalition contract terminated; commission hears updates
The commission will hear a health department report that the state terminated the Healthcare Coalition contract, removing a core emergency response component. They will also discuss a CVB marketing grant request from the Junction City Brigade, a potential policy discussion on data centers/solar/wind energy, and consider a $128,000 OPEIS contract for at-risk families. Public works items include access petitions for Kansas Falls Rd and Cutoff Rd, and a recommendation on a mowing contract with Cloud Community College.
- Termination of Healthcare Coalition contract by KDHE without prior notice, impacting emergency response coordination
- Request from Junction City Brigade for a CVB marketing grant (sponsorship levels from $700 to $5,500)
- Consideration of OPEIS contract for $128,000 (county match $64,000) for outreach and prevention services
- Discussion of data centers, solar, and wind energy policy
- Federal funds exchange of $176,247.88 available from KDOT for transportation projects
public-healthemergency-managementgrantsenergypublic-worksroadscommission
✓ Decided: Commission approved 2026 Federal Funds Exchange and multiple infrastructure contracts
The Geary County Commission approved the 2026 Federal Funds Exchange, allowing the exchange of $176,247.88 in federal funds for $158,623.09 in state transportation dollars. It also approved a new driveway at 6212 Kansas Falls Road, a culvert on Cut‑Off Road, a mowing contract for Cloud County Community College, and an HVAC replacement for the Sheriff’s Office kitchen. All motions were passed unanimously.
- Approved 2026 Federal Funds Exchange ($176,247.88 federal for $158,623.09 state) (unanimous)
- Approved driveway construction at 6212 Kansas Falls Road (unanimous)
- Approved culvert installation on Cut‑Off Road (unanimous)
- Approved Avila Lawn Maintenance mowing contract for Cloud County Community College ($85) (unanimous)
- Approved Sheriff's Office kitchen HVAC replacement ($39,437) (unanimous)
- Approved purchase of precast reinforced concrete box culvert for Thomas Creek Road ($20,742.33) (unanimous)
- Approved OPEI health services agreement ($128,000 total, $64,000 federal) (unanimous)
- Opened meeting as County Board of Health (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 20°, 2026
Night Meeting
6:00-6:15 | Public Comment
6:15-6:45 | Jeremie Myers, Public Works Superintendent, Bi-Weekly Report
6:45-7:00 | Charles Martinez, Health Department Director, Monthly Board of Health Meeting
7:00-7:15 | Commission Review & Update-Request from Junction City Brigade for a CVB Marketing Grant
7:15-7:45 | Discussion-Data Centers, Solar & Wind Energy
7:45-8:15 | Executive Session-Legal Matters pertaining to contracts
8:15 Adjourn
GEARY COUNTY PUBLIC WORKS DEPARTMENT
Jeremie Myers, Public Works Administrator
310 East 8" Street, Junction City, KS 66441
(785) 238-3612
ll
Public Works Board of County Commissioners Meeting Agenda
Date of Meeting: April 20", 2026
1. Request and Petition Kansas Falls Rd
2. Request & Petition Cutoff Rd
3.Cloud Community College Mowing Contract Recommendation
4. SO Kitchen HVAC Replacement
5.Teap Study Munson/Ritter
6.Thomas Creek Drainage Structure Replacement
7.City/County Joint Clean Up Update
8.2026 Federal Funds Exchange
ll
Geary County Public Works
Jeremie Myers: Public Works Administrator
310 East 8" Street, Junction city, KS 66441
(785) 238-3612
REQUEST AND PETITION PROJECT ACCESS
Name of Requestor Joson /lartLey
PropertyLocation 6212 KAVSAS Falcs RD Jwerton Gry 6 6644/
Date Requested CIA 13/2026
Proposed Project_ MEU DRIVEWAY
COMES now before the Board of County Commissioners of Geary County, Kansas with plans to construct above mentioned
project within Geary County
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED NIGHT MEETING OF THE GEARY COUNTY COMMISSION
MINUTES
April 20%, 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 6:00 p.m.
Arriving at the meeting: Gary Olds, Anthony Berkowitz, Mark Powers, Desree and Randy Pettera, Gerald
Gerloff, Dewey Terrill, Dave Schneider
The pledge of allegiance was recited.
Public Comment (5 minutes per person):
Gary Olds:
Asked about opening the burn pile at the landfill for more than one Saturday a month, Commissioner
Giordano said they are working on it.
Discussed the upcoming county budget for 2027-asked about the raise for employees 2% COLA, 3% Step
increase (based on performance evaluations), last year it was 1% COLA and 3% Step.
Mr. Olds encouraged the commission to think about: talked about revenue coming into the county, wants
to keep the expenditures below the revenue for personnel, he said the county is in a better financial
position than other cities and counties, also encourage the commission to think about non-profit
organizations, they should be raising their own monies. It is not the role of government to fund them.
Commissioner Ascher said they ask the other agencies to look for funding other than the county. Mr. Olds
said the commission is doing a good job, and the Finance Director is doing a good job.
Desree Pettera-On EDC agenda last week,
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 13, 2026
Commissioners
Geary County Commissioners to review budget schedule and department reports
The County Commission will meet to receive weekly and quarterly reports from the Human Resources Director, Finance Director, Register of Deeds, and Sheriff. The Finance Director will present the budget presentation schedule. The meeting also includes an annual meeting with Fair Board representatives.
- Budget presentation schedule discussion with Finance Director Tami Robison
- Annual meeting with Fair Board Representatives
- Quarterly report from Register of Deeds Jacqie Reisinger
- Bi-weekly report from Sheriff Nate Boeckman
- Weekly report from Human Resources Director Crystal Malchose
budgetadministrationpublic-safetyreports
✓ Decided: Commission approved agenda amendment, executive session, and tax‑roll changes
The commission voted to amend the agenda to add a 15‑minute executive session for non‑elected personnel, with all three commissioners voting aye. They then approved entering that executive session, again with unanimous approval. The board also approved Change Orders #20260000694‑2026000708 to correct clerical errors in the real estate and personal property tax rolls. Finally, the commissioners approved the minutes from the April 6, 2026 meeting.
- Amended agenda to add 15‑minute executive session (all aye)
- Entered executive session for non‑elected personnel (all aye)
- Approved Change Orders #20260000694‑2026000708 correcting tax‑roll errors (all aye)
- Approved April 6, 2026 commission minutes (all aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 13", 2026
10:00-10:15 | Commission review and update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45_| Tami Robison, Finance Director, Financial Reports, Budget presentation schedule
10:45-11:00 | Jacqie Reisinger, Register of Deeds, Quarterly Report
11:00-11:05 | Break
11:05-11:20 | Sheriff Nate Boeckman-Bi-Weekly Report
11:30-11:45 | Fair Board Representatives, Annual Meeting
11:45-12:00
12:00-12:15 | Public Comment {5 minutes per person)
12:15 Adjourn
TREASURER'S DUPLICATE STMT AND VOUCHERS SHEET
AND VOUCHERS DAILY STATEMENT
DAILY COLLECTIONS
HEALTH DEPARTMENT
TRANSFER STATION ACH
MISCELLANEOUS DEPOSITS
MORNING BALANCE
TOTAL
DAY'S PAYMENTS
MISCELLANEOUS DEBITS
EVENING BALANCE
Sports C omplex-CD
WASTE DISPOSAL CNB CD '
CNB-New CD'S
OMIP
CENTRAL NATIONAL BANK
CASH IN DRAWER & PETTY CASH
TOTAL
MARCH 31 2026
GEARY COUNTY TREASURER
SHERRI CHILDS
74,481.56
799.68
79,380.09
37,093,803.66
37,248,464.99
10,681.17
901,880.09
36,335,903.73
CASH AND CASH ITEMS
$600,000.00
200,000.00
5,200,000.00
1,882,481.56
28,442,872.17
10,550.00
36,335,903.73
Fund Status Report Geary County
Selected Fund Type: ALL
Report Selection Criteria: Include Encumbrances? NO Fiscal Year: 2026 From Date: 1/1/2026
Include Pri Yr Ltablilities? NO From Period: 1 Thru Date: 3/31/2026
Printed In Alpha by Fund Name? NO . .
Exclude Additional Cash? NO To Period: 3 Option: Date Range
Include Pending Cash? ~NO Exclud
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
April 13", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Ascher: Did not have any meetings
Attended the Little Theatre- Rock of Ages-said it was very good, lots of talent in the area.
Tremont: Attended the EDC Advisory Board Meeting-Vet Epic program will be coming up in the future,
Destination Bootcamp, Energy issues, ongoing challenges. |
Chairman Tremont attended the Employee Task Force meeting-talked about looking for lunch and learn
topics, HR director brought up the benefits-any concerns, asked their co-workers if they want anything
changed, no complaints or concerns.
Data center conversation-seems to be a lot of information going on now, lots of counties are fighting them
coming in to their communities, Saline County placed a moratorium of construction of data centers and’
nuclear centers in the unincorporated areas of the county, where there is no power and water, would cost a
lot to bring it in.
Legislation-property tax bill was passed late, she talked to Representative Butler and Representative
Chauncey and they both voted no, it would make additional work on the clerk and treasurers, people want
their taxes to be lowered, but the legislature didn’t g
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 6, 2026
Commissioners
Commissioners to set 2027 budget baseline and personnel cost estimates
The Geary County Commission will review the 2027 budget baseline, including a proposed 2% cost-of-living adjustment and a $25 employer match for employee retirement contributions. The meeting also includes a proclamation for the Purple Heart Trail and an executive session regarding non-elected personnel.
- 2027 Budget Baseline discussion
- Proposed 2% COLA increase for employees
- $25 employer match for 457 deferred compensation plan
- Purple Heart Trail Proclamation
- Executive Session for non-elected personnel
budgetpersonnelcolaretirementproclamationexecutive-session
✓ Decided: Commission approved King Construction’s revised flyover project plan
The commission approved King Construction’s revised proposal for the I‑70 flyover (K‑18/170) project. They also approved a $10,500 change order for new siding on Fire Station #4, a $2,000 grant to Run for the Wall, and acceptance of a $40,409 bid for 2026 Noxious Weed supplies. Additionally, the commission authorized the application for a state grant to build a new communications tower and approved APAC’s $2.95‑per‑gallon MC‑800 chip‑seal oil quote. All motions were moved by Commissioner Ascher, seconded by Chairman Tremont, and passed unanimously.
- Approved King Construction’s revised flyover (K‑18/170) proposal (aye)
- Approved $10,500 change order for new skin on Fire Station #4 (aye)
- Approved $2,000 Run for the Wall grant from CVB funds (aye)
- Accepted Van Diest $40,409 bid for 2026 Noxious Weed supplies (aye)
- Approved application for state grant to build new communications tower (aye)
- Approved APAC $2.95 per gallon MC‑800 chip‑seal oil quote (aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda April 6", 2026
Commissioner Giordano will not be in attendance
10:00-10:15 | Commission review and update
10:15-10:30 | Crystal Malchose, Human Resource Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly report-Budget Baseline Discussion, Financial reports,
Run for the Wall funding request on behalf of the CVB
10:45-11:00 | Garry Berges, Emergency Management Director/ Rural Fire Chief-Monthly Report
11:00-11:30 | Jeremie Myers, Public Works Superintendent-Bi-Weekly Report-Open quotes for Cloud County
Community College Mowing at 11:00 a.m.
11:30-11:35 | Break
11:35-11:45 | Purple Heart Trail Proclamation
11:45-12:00 | Executive Session-Non-Elected Personnel
12:00-12:15 | Public Comment (5 minutes per person)
12:15 Adjourn
MEETING: April 6, 2026
SUBJECT: 2027 Budget Baseline
PRESENTER: Tami Robison, Finance Director
BACKGROUND
I am requesting your assistance in setting the 2027 Budget Baseline. The following are examples
for consideration and discussion:
--Present budgets reflecting departmental needs being aware of the current economic conditions and
tax sentiment of the public.
--Present budgets reflecting statutory requirements and business needs.
--All budgets are requested to be flat.
--All budgets are requested to be reduced.
--Non-essential purchases are not to be included.
--Only critical, essential, and emergency purchases should be part of the budget.
--Do not include requests for new
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
April 6", 2026
Commissioner’s Present: Keith Ascher, Kathy Tremont, Trish Giordano (on vacation)
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Arriving at the meeting: Representative Shaun Chauncey,
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Ascher: Attended the PBC meeting on March-26-Ken Mortenson oversees the PBC financials-the
company that assists with the collection of bad debt, Haase & Long is just going to take it all over, they
get a percentage of collections, which they are still collecting.
Attended the Chamber Board of Directors meeting on March 26-received the audit-it was recommended a
secondary person review and do the reconciliation of the numbers.
Chamber Golf Tournament will be May 1, 2026.
MAC-Armed Forces Day is May 16, 2026.
First ID reunion will be June 24 through June 28, 2026.
Stated there will be lots of Change of Commands between May and July.
Attended Steve Meyer’s retirement party and he thanked Mr. Meyer for his years of service.
Tami Robison, Finance Director and Crystal Malchose, HR Director arrived at the meeting.
Tremont: Attended Steve Meyer’s retirement party.
Stated the Pawnee Mental Health board members will be having a retreat on May 7.
Stated she was invited by the Geary County Extension Agent to attend a meeting with the Extension,
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 30, 2026
Commissioners
Mon Mar 23, 2026
Commissioners
Commission approves eRecording system contract and Fire Station #4 bid
The Geary County Commission will review a $18,105 contract for an eRecording system, approve a bid for Fire Station #4, and discuss the 2027 budget timeline. The meeting includes department head updates and a public comment session.
- Approval of eRecording system contract with Harris Recording Solutions for $18,105
- Approval of bid for Fire Station #4
- Discussion of 2027 budget timeline and department head purchase needs
- Review of finance and travel policy
- Public comment session
budgetfire-stationhiringpublic-hearingrecordingtechnologytransportation
✓ Decided: Commission approved $18,105 eRecording system purchase
Commissioners Giordano and Ascher moved to approve the purchase of an eRecording product from Harris Recording Solutions at a cost of $18,105 with a $2,500 maintenance fee; the motion was seconded and all three commissioners voted aye. They also moved to open an executive session for legal matters concerning contract services, which was seconded and approved unanimously. No other substantive actions were taken during the meeting.
- Approved eRecording product purchase for $18,105 plus $2,500 maintenance (unanimous aye)
- Approved executive session for legal matters‑contract services (unanimous aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 23", 2026
10:00-10:15 | Commission review and update
10:15-10:30_| Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Weekly Report
10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Report
11:00-11:15
11:15-11:30 | Jacqie Reisinger, Register of Deeds, eRecording Discussion & Approval
11:30-12:00 | Jordan McCann-Junction City Mainstreet-2025 Impact and 1* Quarter Update
12:00-12:15 | Public Comment (5 minutes per person)
12:15-12:45_ | Department Head Meeting-Discussion of: finance&travel policy, non-county employees in county
vehicles, tax statements/deeds issue, department heads purchase-needs commission approval,
budget timeline
12:45-1:00 | Garry Berges, Emergency Management Director, Rural Fire Chief, Approval of bid for Fire Station #4
1:00-1:15 | Executive session-non-elected personnel
1:15 Adjourn
2
ESTO Sree 1655
pecan
GEARY COUNTY
KANSAS
Geary County
2027 Internal Budget Calendar
Date Activity
March 23, 2026 [Distribute 2027 budget calendar to department heads and Commission for review
@
Apr 6 Finalize 2027 budget baseline estimates with BOCC
Apr 7-10 Finance Director to formulate 2027 budget baseline estimates as applicable
Apr 17 Finance to forward preliminary personnel reports to departments for review/verification
CPI-U for December annual from Bureau of Labor Statistics included in reports as guideline based on BOCC decision
On or before Apr 21 |Finance
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
March 23", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Chairman Tremont Congratulated Commissioner Giordano on her marriage.
Commissioner Giordano moved to add an executive session for legal matters to discuss contract
services, to include the County Counselor and the Finance Director; Commissioner Ascher
seconded and all voted aye.
Commission review and update:
Chairman Tremont Congratulated Commissioner Giordano on her marriage.
Tremont: Attended a juvenile detention board meeting.
Discussed the upcoming KCCA conference on April 22-24 in Hutchinson, are any commissioners going?
She is going to try to attend, she reviewed the agenda and thought there were going to be good topics at it.
Commissioner Ascher can’t go.
Giordano: Did not have any report since she was on vacation.
Ascher: Congratulations to Commissioner Giordano.
The PBC meeting will be this week.
The next MPO meeting will be in April.
Commissioner Ascher asked about the legislature-anything going on? Chairman Tremont said $B284-bill
that proponents for rural hospitals under duress, reducing prescription drugs, the property tax bill didn’t
pass, there are lots of amendments to the property tax bills, SB 404-Treasurer’s b
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 16, 2026
Commissioners
Geary County Commissioners to review health updates and public works bids
The Board of Commissioners will receive a monthly update from the Health Department and a radio update from the Sheriff and Fire Chief. The Public Works Director will present a bi-weekly report and open bids for chemicals.
- Health Department report on $10,000 Building Bridges Learning Community grant
- Review of open bids for chemicals by Public Works Director
- 800 radio update from Sheriff Nate Boeckman and Fire Chief Jason Lankas
- Health Department evaluation of new Electronic Medical Record (EMR) systems
- KDOT report on local bridge load ratings
public-healthpublic-worksemergency-servicesgrantsinfrastructure
✓ Decided: Commission approved $1.69 M 800‑radio system grant application
The Geary County Commission voted to approve the fire department’s application for a $1.69 million 800‑radio system upgrade grant. They also approved a speed‑limit reduction on Rucker and Munson Roads, a culvert placement on Mockingbird Road, a letter of support for Stormont Vail, a firewall service agreement for the Transfer Station, a new hot‑water heater for the Health Department, and a revised crack‑seal material purchase. All votes were unanimous.
- Approved $1.69 M 800‑radio system grant application (unanimous)
- Approved speed‑limit reduction on Rucker Road and Munson Road (unanimous)
- Approved placement of a culvert on Don Sheffiele’s property on Mockingbird Road (unanimous)
- Approved Letter of Support for Stormont Vail Regional Partnership Grant (unanimous)
- Approved Nex‑Tech firewall service agreement for Transfer Station at $197.93/month for 36 months (unanimous)
- Approved purchase of new hot‑water heater for Health Department at $3,146.00 (unanimous)
- Rescinded prior crack‑seal material purchase and approved new purchase through McConnell & Associates at $16,146.00 (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 16", 2026
NIGHT MEETING
6:00-6:15 | Public Comment (5 minutes per person)
6:15-6:30 | Charles Martinez, Health Department Director, Monthly meeting
6:30-6:45 | Nate Boeckman, Sheriff and Jason Lankas, Junction City Fire Chief-800 radio update
6:45-7:00 | Commission review and update
7:00-7:30 | Jeremie Myers, Public Works Director-Bi-Weekly Report, Open bids for chemicals
7:45 Adjourn
Geary County
Health Department
1212 West Ash Street
P. O. Box 282
Public Health Junction City, Kansas 66441
16 March 2026
Geary County Board of Health
GCPHD Monthly Update
1. Program Updates
Public Health Infrastructure Grant Update
The issue in KGMS has been resolved, and we are now able to submit the Budget Modification Request
(BMR). Once KDHE approves the BMR in KGMS, we will be able to complete the Financial Status Report
(FSR) and proceed with reimbursement.
Annual Grants Applications Submission
The department has successfully submitted all required annual grant applications, including PHEP, State
Formula, IAP, and OPEIS funding. These applications ensure continued support for core public health
services, preparedness activities, and community health programs for the upcoming funding cycle.
Building Bridges Learning Community Grant
GCPHD was selected as one of 10 health departments nationwide to participate in the Building Bridges
Learning Community. This six-month, $10,000 grant focuses on strengthening relationships with
community pa
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
March 16", 2026
NIGHT MEETING
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk
Chairman Tremont called the County Commission meeting to order at 6:00 p.m.
The pledge of allegiance was recited.
Public Comment (5 minutes per person): No one was in attendance for public comment.
Charles Martinez arrived at the meeting.
Commissioner Ascher moved to open the meeting as the County Board of Health; Commissioner
Giordano seconded and all voted aye.
Charles Martinez, Health Department Director, gave the monthly report:
Public Health Infrastructure Grant Update-The issue in KGMS has been resolved, and the Health
Department is now able to submit the Budget Modification Request. Once KDHE approved the
BMR in KGMS, the Financial Status Report can be completed, and they will proceed with
reimbursement.
Annual Grants Applications Submission- The department has successfully submitted all required
annual grant applications, including PHEP, State Formula, IAP, and OPEIS funding. These
applications ensure continued support for core public health services preparedness activities, and
community health programs for the upcoming funding cycle.
Building Bridges Learning Community Grant-the Health Department was selected as one of 10
health departments nationwide to participate in the Building Bridges Learning Community. This
six-month, $10,000.00 grant focuses o
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026
Commissioners
County opens RFP for new Fire Station #4
The Geary County Commissioners will consider several operational items, including approving a memorandum of understanding for a regional tabletop exercise and reviewing weekly reports from HR, finance, the sheriff and other departments. They will discuss the open request for proposals to build Fire Station #4, review FY27 adult and juvenile budget and compensation plans for Community Corrections, and consider a marketing campaign for the county. The meeting also includes a signature on a health department grant paperwork request.
- Approve MOU for participation in a regional Tabletop Exercise (OLDCC IR Grant)
- Open RFP for Fire Station #4
- FY27 Adult and Juvenile budgets and compensation plans (Community Corrections)
- Marketing Campaign Discussion for Geary County
- Signature on health department grant paperwork request
public-safetybudgetgrantsemergency-servicescommunity-correctionsmarketing
✓ Decided: Commission approved FY27 adult and juvenile budgets and comprehensive plans
The commission unanimously approved the FY27 adult budget and the FY27 juvenile budget. They also approved the FY27 adult comprehensive plan and the FY27 juvenile comprehensive plan. Additional approvals included a memorandum of agreement for a regional tabletop exercise, attendance at a CPM leadership course for the county appraiser and register of deeds, and tax‑roll correction change orders. All motions were passed with all commissioners voting aye.
- Approved Memorandum of Agreement for tabletop exercise (up to $833) – unanimous aye
- Approved County Appraiser and Register of Deeds attendance at CPM leadership course ($3,900) – unanimous aye
- Approved tax‑roll correction change orders #2026000095‑2026000156 – unanimous aye
- Approved FY27 Adult budget – unanimous aye
- Approved FY27 Juvenile budget – unanimous aye
- Approved FY27 Adult comprehensive plan – unanimous aye
- Approved FY27 Juvenile comprehensive plan – unanimous aye
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 9", 2026
10:00-10:15 | Commission review and update-Approve MOU for participation in a regional Tabletop Exercise,
OLDCC IR Grant
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Weekly Report
10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Report
11:00-11:15 | Bukaty representatives, Benefits update
11:15-11:30 | Jacqie Reisinger, Register of Deeds-CPM Course
11:30-11:45 | Garry Berges, Emergency Management/Rural Fire Chief-Open RFP’s for Fire Station #4
11:45-12:00 | Representative of 4H/Senior Citizens Building Committee, Annual Report
12:00-12:15 | Public Comment (5 minutes per person)
12:15-12:30 | Chrysann Phipps, Community Corrections Director-FY27 Adult and Juvenile budgets and comp
plans
12:30-1:00 | Marketing Campaign Discussion for Geary County
1:00-1:15 Charles Martinez, Health Department Director-Signature on grant paperwork request
1:15 Adjourn
Geary County
Composition of Cash Balances and Investments
As Of: 2/27/2026
Cash on Hand/
Net Bank Balance Inyestments In Transit Total
Cash and Cash Items
Cash on Hand Bank $10,550.00 $0.00 $0.00 $10,550.00
Certificate of Deposit
CENTRAL NATIONAL BANK $0.00 $6,425,000.00 $0.00 $6,425,000.00
Demand and Time Deposits
CENTRAL NATIONAL BANK $29,754,803.41 $0.00 $0.00 $29,754,803.41
State Investment Pool
OMIP $0.00 $1,871,200.99 $0.00 $1,871,200,99
$29.765,353.41 $8.296,200,99 $0.00 1,554.4
Operat
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
March 9", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Tremont-attended County Day at the Capitol last week, was able to talk to the legislators.
EDC board meeting-the second Epic Challenge event will be on June 23 from 5:30 p.m. to 8:00 p.m.
They talked about coordinating more efforts with the Chamber, getting new members and working with
businesses. , :
Ascher: Did not have any meetings. Received complaints from citizens about Boller Road because of the
construction.
Giordano: She was invited to an open house for the new military family clinic in Manhattan, which is a
grant funded program for veterans and their families and much needed in the community.
Attended County Day at the Capitol, Geary County was very well represented.
Attended the CVB board meeting-marketing campaign was discussed, something we need to move
forward with, wants the whole community involved.
Attended the Mo Town show at the Opera House-very good show, Stated there were lots of good events
going on in the community including the Murder Mystery and the Comedy Show.
Discussed the regional tabletop exercise funded through the OLDCC installation resilience grant. Flint
Hills Regional Counci
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 2, 2026
Commissioners
County Commission to consider funding intent for Sewer No. 4
The Geary County Commissioners will review routine reports and consider several public‑works actions. Items include petitions for Budden Road and Cedar Road and for Thomas Creek Road, a noxious‑weed management plan and chemical bid, a funding intent letter for Sewer No. 4, and a recommendation for a crack‑seal quote. The board will also confirm the hiring of a Facilities Manager/Assistant Public Works Administrator.
- Sewer No. 4 Funding Intent Letter
- Crack Seal Quote Recommendation
- Noxious Weed Chemical Bid Open
- Request & Petition – Budden Rd & Cedar Rd
- Request & Petition – Thomas Creek Rd
public-worksinfrastructurewaterroadsenvironmenthiring
✓ Decided: Commission approved Feld Fire $696,189.73 air pack contract
The Geary County Commission approved the low bid from Feld Fire for air packs at $696,189.73. It also approved the Cox Communications fiber request, a waterline request from Morris County Rural Water District, the 2026 Noxious Weed Management Plan, a $15,876 crack‑sealing material quote, and a $930,963 sewer‑funding notice. All motions passed unanimously.
- Approved Feld Fire air pack bid $696,189.73 (unanimous)
- Approved Cox Communications fiber request (unanimous)
- Approved Morris County Rural Water District waterline request (unanimous)
- Approved 2026 Noxious Weed Management Plan (unanimous)
- Approved Crafco crack‑sealing material quote $15,876.00 (unanimous)
- Approved Letter for Public Notice – Sewer funding $930,963.00 (unanimous)
- Approved tax roll correction change order #20026000077-2026000079 (unanimous)
- Approved February 23, 2026 meeting minutes (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda March 2", 2026
10:00-10:15 | Commission review and update
10:15-10:30_| Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45
10:45-11:00 | Garry Berges, Emergency Management Director/ Rural Fire Chief-Monthly Report, Opening of Air
Pack bids
11:00-11:30 | Jeremie Myers, Public Works Administrator, Bi-Weekly Report
11:30-11:45 | Executive Session-Non-Elected Personnel
11:45-12:00
12:00-12:15 | Public Comment (5 minutes per person)
12:15-12:30 Adjourn
GEARY COUNTY PUBLIC WORKS DEPARTMENT
Jeremie Myers, Public Works Administrator
310 East 8" Street, Junction City, KS 66441
(785) 238-3612
ll
=
wo
a
o>)
N
Public Works Board of County Commissioners Meeting Agenda
Date of Meeting: March 2, 2026
. Action Item: Request & Petition; Budden Rd & Cedar Rd
. Action Item: Request & Petition; Thomas Creek Rd
. Action Item: Noxious Weed Annual Report & Management Plan
. Noxious Weed Chemical Bid Open
. Sewer No. 4 Funding Intent Letter
. Crack Seal Quote Recommendation
. Facilities Manager / Assistant Public Works Administrator Position Filled
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
March 2", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Tremont-Attended Pawnee Mental Health board meeting-discussed evaluation of the CEO.
Ascher-Stated the joint meeting with the city/school/county last week went well, lots of information.
Attended High Five Fridays at Westwood School.
Tremont-Had a meeting to encourage feedback, and prompt conversations for growth in the community
with economic development.
Stated the joint meeting went well and the Public Works Director gave a good report and will continue to
attend the joint meetings.
Giordano-Attended the joint city/county/school district meeting. She thinks it is important to get together
to discuss things and throw out ideas.
Attended the Kansas Automobile Dealers Association Legislative Conference-a chance to meet with
legislators-talked about the 3% cap on appraisals-if it goes over 3%, it will need to go to a vote.
Attended marketing campaign meeting with Terry Butler involved.
Regional economic rural recreation meeting-talked about outdoor recreation assets, what is in the
community, what we would like to see in the community-need to work on it.
Chairman Tremont and Commissioner Giordano are a
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 23, 2026
Commissioners
County approves $175,584 for three new sheriff patrol vehicles
The Geary County Commissioners will review routine reports from Human Resources, Finance and the Sheriff, and discuss the 2025 year‑to‑date budget expenditures and revenues. They will consider a Capital Improvement Program request to purchase three outfitted patrol vehicles for the Sheriff’s Office at a total cost of $175,584. The meeting also includes a special CIP work session, an executive session on non‑elected personnel, and a public comment period.
- CIP request (Fund #44) for three sheriff patrol vehicles, total cost $175,584
- Weekly report from Human Resources Director and bi‑weekly reports from Finance Director and Sheriff
- Presentation of 2025 YTD expenditure and revenue tables for the General Fund
- Special Capital Improvement Program work session
- Executive session on non‑elected personnel
capital-improvementlaw-enforcementbudgetfinancepublic-commentexecutive-session
✓ Decided: Commission approved $175,584 purchase of three sheriff patrol vehicles
The commission approved several items, including adding agenda items, sponsoring a Crimestoppers banquet table, purchasing a commercial property, and buying three new patrol vehicles for $175,584.06. They also approved tax‑roll correction change orders, the minutes from the February 17 meeting, and authorized two executive sessions. All motions passed unanimously.
- Amended agenda to add executive session for legal contracts (approved)
- Amended agenda to add Crimestoppers banquet sponsorship discussion (approved)
- Approved sponsoring a table at the Crimestoppers Banquet for $350 (approved)
- Approved purchase of 301 E. 8" Street property for $15,000 and $500 earnest money (approved)
- Approved purchase of three sheriff patrol vehicles for $175,584.06 (approved)
- Approved tax roll correction change orders #2026000064‑2026000070 (approved)
- Approved minutes from February 17, 2026 (approved)
- Approved executive session for non‑elected personnel (approved)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 23", 2026
10:00-10:15
Commission Review and Update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report
10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Report
11:00-11:30 | Travis Lilly, County Appraiser, mailing of value notices update
11:30-11:45 | Special CIP Work Session
11:45-12:00 | Executive session-Non-Elected Personnel
12:00-12:15 | Public Comment
12:15-12:30 | ADJOURN
2025 YTD EXPENDITURE BUDGET ACTIVITY
% of Year: 100%
FUND EXPEND Jan-Feb AVAILABLE
# FUND BUDGET Jan Feb Mar Apr May Jun Jul Aug Sept Ost Nov Dee 25 Total BUDGET __% USED
001 __ GEARY COUNTY GENERAL FUND (anended) 36015262 5,463,619 2,688,441 1,683,652 1,842,949 1,781,942 1,551,508 3,827,372 1,970,516 2,072,946 1,607,072 1,613,709 1,959,804 635,174 28,655,832 7356430 79.57%
002 APPRAISERS FUND - - - - - - - - - - - - - - - -
003 © ROAD & BRIDGE - - - : - - - - - - - - - - - -
004 SPECIAL BRIDGE 732,879 - - 18,560 - 1,260 - 5,150 - - - - - 1160 26,130 106,749 3.57%
005 NOXIOUS WEED - - : - - - - - - - - - - - - -
006 = HEALTH DEPARTMENT 1,084,138 90,538-=57,634 60,269 71,386 «69,170 58,868 © 61,086 8.8 51,465 51,685 41,961 «41,290 3,530 757,693 326,445 69.89%
007 EXTENSION OFFICE . : : - : - - - - - - - - - - -
008 = LIBRARY 120,000 62,446 . 8,481 1,559 - 27,330 - - 16541 3,127 - 315 - 120,000 - 10.00%
010 PAWNEE MENTAL. HEALTH - - . - - - - - - - - - - - . -
Otl ELECTION - -
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
February 23, 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards, County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commissioner Ascher moved to amend the agenda to add an executive session for legal contracts
after public comment; Commissioner Giordano seconded-and all voted aye.
Chairman Tremont moved to amend the agenda to add Crimestoppers banquet sponsorship
discussion; Commissioner Giordano seconded and all voted aye.
Commission review and update:
Ascher: Attended the Risk Management meeting last week. Mr. Berges pointed out that the last time the
Everbridge test was done, there was only about 50% participation. He is going to try again and hopefully
will get more. .
Stated the Severe Weather training will be Monday, March 16, 2026, at 7:00 p.m. at the 4H-Senior
Center.
Stated fire alarm testing will be done. It will not be done when the public is in the building.
Stated Public Works has a new Facebook page.
Attended the MPO organizational meeting. There are quite a few new participants on the board. They had
election of officers-Commissioner Ford from Riley County will be the chairman again, Commissioner
Ascher is vice chair. They received an update on the I70-K.18 interchange-amount now is $35.2 million
dollars.
Giordano: Attended a
[Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026
Commissioners
Commissioners to consider tourism travel and solid waste plan
The Board of County Commissioners will review reports from human resources, health, and public works. Key decisions include a request for the CVB Director to attend a trade show and the adoption of the 2025 Solid Waste Management Plan annual review.
- Request for CVB Director to attend Travel & Adventure Show in Denver, CO, with a registration fee of $3,695
- Approval of the 2025 Geary County Solid Waste Management Plan Annual Review
- Discussion on funding allocation for Mud Bogg and Blues & BBQ
- Public Works updates on Dundon Road Culvert Replacement and Kansas Falls Road engineering
- Health Department update on a pending $43,294.29 payment request from the Public Health Infrastructure Grant
tourismwaste-managementpublic-healthroadsbudget
✓ Decided: Commission approved off‑system bridge project, land purchase, and multiple contracts
The Geary County Commission approved a bridge agreement worth up to $800,000, a land purchase at 301 E 8th St., and several service contracts including a lock service, generator maintenance, and a culvert replacement. It also approved a $3,695 trade‑show booth for the CVB, a $17,980 engineering report for the Kansas Falls Road project, and adopted the 2025 Solid Waste Management Annual Review Plan.
- Approved Off‑System Bridge Agreement Project No. 31 C‑5401‑01 (≤$800,000) (unanimous)
- Approved purchase of land at 301 E 8th St. for equipment shed (unanimous)
- Accepted two‑year lock service agreement with INA Alert Inc. (unanimous)
- Approved two‑year preventative maintenance contract with Foley’s for sheriff generators (unanimous)
- Approved purchase of reinforced concrete pipe for Dundon Road culvert through Old Castle (unanimous)
- Approved CVB attendance at Colorado trade show (booth $3,695, hotel $600, fuel $100, food $186) (unanimous)
- Approved Kaw Valley Engineering preliminary engineer report proposal ($17,980) (unanimous)
- Adopted and approved the 2025 Solid Waste Management Annual Review Plan (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 17°, 2026
Night Meeting
6:00-6:15 Commission Review and Update
6:15-6:30 Crystal Malchose, Human Resources Director, Weekly Report
6:30-6:45 Raquel Cinco, CVB Director, request approval to attend a trade show
6:45-7:00 Charles Martinez, Health Department Director, Monthly Report
7:00-7:30 Jeremie Myers, Public Works Administrator, Bi-Weekly Report
7:30-7:45 Discussion on allocation funding for Mud Bogg and Blues & BBQ
7:45-8:00 Public Comment
8:00-8:15 Adjourn
+
ESTD Samm 61855
Reese
Sed
GEARY COUNTY KANSAS
CONVENTION & VISITORS BUREAU
February 9, 2026
Board of County Commissioners,
T respectfully request approval to attend the Travel & Adventure Show on April 11-12 at the
Colorado Convention Center in Denver, CO. This event will provide valuable opportunities
to promote Geary County as a visitor destination, gain insight into current travel trends and
consumer interests.
The registration fee has been discounted from $4,495 to $3,695 as an incentive to have the
Geary County CVB return to the show.
The advisory board made a motion to approve this travel at its meeting on February 4+h,
Attendance will support ongoing tourism promotion efforts to enhance outreach for the
county.
Thanks for your consideration.
222 W 6" St, Junction City, KS 66441 | 785-238-2885 | visitgearycounty.com
Geary County
Health Department
1212 West Ash Street
s P. O. Box 282
Public Health Junction City, Kansas 66441
17 February 2026
Geary County
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
February 17", 2026
Commissioners Present: Keith Ascher (arrived at 6:40pm), Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor
Gerald Gerloff
Chairman Tremont called the County Commission meeting to order at 6:00 p.m.
The pledge of allegiance was recited.
Commission review and update:
Giordano:
e Lunch meeting with Jeremie Myers, Ray Ibarra and Kim Zimmerman to touch base on the Joint
City/County clean up and East St. East St. belongs to the county, and the county will address that.
e Attended the Childcare Coalition meeting, Geary County’s Childcare Coalition became a
“childcare champion”, first county in the state to receive that title based on meeting the
requirements for training, resources and support.
e Attended the MAC meeting, they talked about the parades and thought that two parades in a short
time is very taxing, however, they would like to potentially have a Veteran’s Summit to recognize
the Veteran’s. Commissioner Giordano brought up issues about MAC finances and how they
ended 2025 -$18,000. They have now received their appropriation from the City and the County
so they are now positive, however, they need to find out where the deficiencies are and how they
can be corrected going forward.
e Alan Bontrager would like to have a marketing campaign to promote Geary County. The CVB
should be leading this project. Commissioner Giordano would l
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026
Commissioners
County Commissioners consider vacation of Walker Road
The Geary County Commission will review a road viewing and consider a vacation of Walker Road, followed by a public hearing on the same matter. Updates from the Human Resources and Finance directors, as well as a bi‑weekly report from Sheriff Nate Boeckman, will be presented. The board will discuss issues related to the county jail and Pawnee Mental Health services, and consider a travel request from the Convention & Visitors Bureau director.
- Road viewing and vacation on Walker Road
- Public hearing on Walker Road vacation
- Sheriff’s bi‑weekly update and end‑of‑year accomplishments
- Discussion on the jail and Pawnee Mental Health
- CVB Director request for approval of travel to a trade show
roadhearingjailmental-healthtravelfinance
✓ Decided: Commission approved Walker Road vacation and key financial actions
The commission accepted the road viewers' recommendation and approved the certificate of viewing for Walker Road. The board agreed to pay $145,000 to the City of Junction City for EMS services. Change Orders 2026000039‑2026000062 were approved, and the minutes from 02/02/2026 were adopted.
- Approved Walker Road vacation certificate (unanimous)
- Authorized $145,000 EMS payment to City of Junction City (unanimous)
- Approved Change Orders 2026000039‑2026000062 (unanimous)
- Adopted minutes from 02/02/2026 (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 9", 2026
9:00-10:00 | Road Viewing-Walker Road Vacation
10:00-10:15 | Public Hearing-Road Viewing and vacation on Walker Road
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Update
10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Update
10:45-11:00 | Sheriff Nate Boeckman, Bi-Weekly Update, and Sheriff’s Dept. end of year accomplishments
11:00-11:15 | Discussion on the Jail and Pawnee Mental Health
11:15-11:30 | Raquel Cinco, CVB Director, Request approval for travel to a trade show
11:30-11:45
11:45-12:00 | Commission review and update
12:00-12:15 | Public Comment
12:15-12:30
Adjourn
é GEARY COUNTY, KANSAS
SHERIFF NATE BOECKMAN
2025 Accomplishments
Geary County Sheriff’s Office
CALEA Accreditation
In 2025, the Geary County Sheriff's Office achieved National CALEA Accreditation,
becoming the only active Sheriff’s Office in Kansas to earn this prestigious distinction.
CALEA accreditation is the result of a comprehensive and rigorous evaluation process that
measures an agency’s performance against internationally recognized standards for
professionalism, accountability, and service delivery.
With this achievement, the Sheriff's Office is now the first and only Sheriff’s Office in Kansas
to hold dual accreditation from both CALEA and KLEAP. This milestone represents a
significant accomplishment in law enforcement and underscores the agency’s continued
commitment to transparency, ethical policing, and orga
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
February 9", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
The road viewing for the Walker Road vacation was held at 9:00 a.m.
Arriving at the public hearing for vacation of Walker Road:
Jeremie Myers, Public Works Administrator
Bobby Miller, road viewer
Chairman Tremont opened the Public Hearing for a vacation on Walker Road:
Bobby Miller, Alan Hildebrand and Terry Heldstab were appointed as road viewers.
The road viewers agreed that the road vacation would have no adverse effect on any landowners.
Certificate of viewing was presented by Mr. Miller.
Commissioner Ascher moved to accept the road viewers recommendation and approve the
certificate of viewing for Walker Road, Commissioner Giordano seconded, all voted in favor aye
Crystal Malchose, Human Resources Director, gave the weekly report:
e Employee task force meeting is this week, commissioner Ascher will be attending
¢ Lunch and learn, presented by Commerce Bank will be held on February 12" 2026, in the
conference room.
e Congratulated employees, Jayme Coffey and Raquel Cinco on graduating from the Flint Hills
Regional Leadership program.
Tami Robison, Finance Director, gave the bi-weekly report:
e Presented CIP project funding docum
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 2, 2026
Commissioners
Commissioners consider OPEI grant and public works projects
The Board of County Commissioners will review a letter of intent for the Healthy Families OPEI Program grant. The meeting includes reports from county directors and discussions on public works infrastructure and speed limits.
- Authorization for Chair to sign OPEI Program letter of intent with a local match up to $64,000
- Discussion of Lower Budden Road Entrance and RWD #1 Humboldt requests
- KLBIP Application for Lower McDowell Creek Bridge
- Review of Munson / Rucker Road speed limits
- Transient Guest Tax Charter Resolution
public-healthroadsgrantsinfrastructuretaxes
✓ Decided: Commission approved $696,189 Feld Fire air pack purchase
The commission approved several contracts and plans, including a $696,189.73 air‑pack purchase from Feld Fire, a Cox Communications fiber‑optic bore request, and a waterline project for Morris County Rural Water District #1. They also adopted the 2026 Noxious Weed Management Plan, approved a $15,876 crack‑sealing material quote from Crafco, and authorized a $930,963 sewer‑funding notice. Additional actions included approving a tax‑roll correction change order and adopting the February 23 meeting minutes.
- Approved $696,189.73 Feld Fire air‑pack contract (all aye)
- Approved Cox Communications 2,925‑ft fiber bore request (all aye)
- Approved Morris County Rural Water District #1 waterline project (all aye)
- Approved 2026 Noxious Weed Management Plan (all aye)
- Approved $15,876 Crafco crack‑sealing material quote (all aye)
- Approved $930,963 Letter of Intent for Sewer Funding #4 (all aye)
- Approved tax‑roll correction change order #20026000077-2026000079 (all aye)
- Approved minutes from February 23, 2026 (all aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda February 2", 2026
10:00-10:15 | Commission review and update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Update
10:30-10:45 | Garry Berges, Emergency Management Director/Rural Fire Chief, Monthly Report
10:45-11:15 | Jeremie Myers, Public Works Administrator, Bi-weekly report
11:15-11:30 | Executive Session with Public Works, KOMA 79-4319(b) (6)
11:30-11:45 | Mike Rezkalla, CEO Pawnee Mental Health Services, update
11:45-12:00 | Betsy Edwards, County Counselor, Transient Guest Tax Charter Resolution
12:00-12:10 | Public Comment
12:10-12:25 | Raquel Cinco, CVB Director, Monthly Update
12:25-12:35 | Charles Martinez, Health Department Director, GCPHD Letter of Intent
12:35-12:50 | Executive Session, Contract Services
Adjourn
GEARY COUNTY PUBLIC WORKS DEPARTMENT
Jeremie Myers, Public Works Administrator
310 East 8" Street, Junction City, KS 66441
(785) 238-3612
ll
Public Works Board of County Commissioners Meeting Agenda
Date of Meeting: Feb 2, 2026
1. Request & Petitions - Lower Budden Road Entrance & RWD #1 Humboldt
2. USDA Acceptance of Environmental Assessment & Notice of Availability
3. KLBIP Application - Lower McDowell Creek Bridge
4. City/County Joint Clean Up Week
5. Munson / Rucker Road Speed Limits
6. SNICE Update
7. Executive Session Request KOMA 79-4319(b) (6) Preliminary Discussion of
Acquisition of Real Property; 10 minutes
Geary County
Health Department
1212 West Ash Street
P. O. Box 282
P
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
March 2", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Therese Hoff, Deputy County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update:
Tremont-Attended Pawnee Mental Health board meeting-discussed evaluation of the CEO.
Ascher-Stated the joint meeting with the city/school/county last week went well, lots of information.
Attended High Five Fridays at Westwood School.
Tremont-Had a meeting to encourage feedback, and prompt conversations for growth in the community
with economic development.
Stated the joint meeting went well and the Public Works Director gave a good report and will continue to
attend the joint meetings.
Giordano-Attended the joint city/county/school district meeting. She thinks it is important to get together
to discuss things and throw out ideas.
Attended the Kansas Automobile Dealers Association Legislative Conference-a chance to meet with
legislators-talked about the 3% cap on appraisals-if it goes over 3%, it will need to go to a vote.
Attended marketing campaign meeting with Terry Butler involved.
Regional economic rural recreation meeting-talked about outdoor recreation assets, what is in the
community, what we would like to see in the community-need to work on it.
Chairman Tremont and Commissioner Giordano are a
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026
Commissioners
Commission will consider funding for sheriff’s patrol vehicles and computers
The commissioners will hold a Capital Improvement Program (CIP) work session to review the county's cash position and a $970,584 list of non‑funded projects, including the sheriff’s request for three patrol vehicles and ten computers. They will also discuss a possible 3% cap on property valuations proposed by state legislators and consider a City/County Jail and Dispatch Agreement. Additional items include routine reports from department heads and public comment.
- Sheriff’s Office request for three patrol vehicles, total cost $175,584
- Sheriff’s Office request for ten computers, total cost $20,000
- Discussion of a potential 3% cap on property valuations with County Appraiser Travis Lilly
- City/County Jail and Dispatch Agreement
- CIP cash position shows $5,604,056 resources available and $2,586,196 uncommitted cash for projects
capital-improvementpolicebudgetvaluation-capjail-agreement
✓ Decided: Commission approved jail‑dispatch service‑exchange agreement with Junction City
The commission approved an agreement to exchange jail and dispatch services with the City of Junction City, with all three commissioners voting aye. They also approved change orders 2026000032‑2026000033, the prior meeting minutes, and Cereal Malt Beverage licenses for two RV parks. A $20,000 CIP request for ten new sheriff's office computers was approved unanimously, while the request for three new patrol cars was tabled. The board voted no on paying retired directors insurance.
- Approved jail‑dispatch service‑exchange agreement (all aye)
- Approved change orders 2026000032‑2026000033 (two aye)
- Approved minutes from 01/20/2026 (two aye)
- Approved Cereal Malt Beverage licenses for Thunderbird RV Park & Resort and Flagstop Resort & RV Park (two aye)
- Approved Sheriff’s Office CIP request $20,000 for 10 computers (all aye)
- Board voted no to pay retired directors insurance
- Tabled Sheriff’s Office CIP request for 3 new patrol cars
- Appointed Jayme Coffey to 3‑year term on Flint Hills Regional Leadership Board (two aye)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 26", 2026
10:00-10:15 | Commission review & update
10:15-10:30 | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Tami Robison, Finance Director, Bi-Weekly Report
10:45-11:00 | CIP work session with Tami Robison, Finance Director
11:00-11:30 | Joint Meeting with the Public Building Commission
11:30-11:45 | Chief Lankas, Junction City Fire Chief, 1° Quarter Update
12:00-12:15 | Public Comment (5 minutes per person)
12:15-12:30 | Discussion of potential 3% cap on valuations (state legislators) with County Appraiser, Travis Lilly
12:30-12:45 | Sheriff Nate Boeckman, Bi-Weekly Report
12:45-1:00 | City/County Jail and Dispatch Agreement
1:15-1:30 Department Head Meeting
Adjourn
COMMISSION AGENDA REPORT
FROM: Tami Robison, Finance
MEETING: Director January 26, 2026
SUBJECT: CIP Work Session
BACKGROUND
This is the first CIP work session for 2026 which will include the CIP cash position updated with
estimated project costs as of January 6, the updated 2026 Non-Funded CIP Project List (attached)
and Funding Authorization Forms (attached) for consideration in activating CIP projects.
The 2025-year CIP cash position is as follows:
2025 Beginning Cash Balance $ 3,571,080
PLUS
Interest 121,283
Taxes ° 2,058
Purple Wave & Scrap Iron sales 27,340
Insurance & Other Reimbursements 204,142
State Historical Grant 77,616
Land Sale (K18/I70) 28,037
Transfer in from General Fund $ 1,572,500
Total Resources Available $
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
January 26", 2026
Commissioners Present: Keith Ascher (arrived at 11:00am), Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission review and update
Giordano:
Attended the MAC breakfast
Attended The Regional Growth Summit, comments that it was informative, believes that Geary County
should have been better represented and advertised.
Gave appreciation to Geary County and City of Junction City Public Works for working hard and long
hours to clear the roads.
Ascher:
Attended the MPO meeting last week, focus right now is on HWY 24 corridor in Pottawatomie County,
putting in a second bridge over the river.
Attended the Chamber of Commerce meeting, Ashley King is the chair for 2026.
Attended the annual soil conservation dinner.
Tremont: .
Attended the juvenile detention meeting and the board voted no to pay the retired directors insurance.
Attended the MAC breakfast.
Attended the soil conservation annual meeting and dinner, first time attending and it was informative.
Attended The Regional Growth Summit on Friday with Commissioner Giordano, Mrs. Robison, Ms.
Edwards. Commented that Geary County needs to do a better job at selling itself and promoting what is
happening in Geary County.
Crystal Malchose, Human Resources Director, ga
[Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026
Commissioners
Commission will approve Fireman Relief Association document
The Geary County Commissioners will review recent updates, approve the Fireman Relief Association document, and hear a weekly HR update. An executive session will evaluate non‑elected personnel. Reports from Public Works and the Health Department will be presented, including a $137,098.57 PHIG grant update and influenza surveillance data.
- Approve and sign Fireman Relief Association document
- Health Department monthly report noting $137,098.57 PHIG grant
- Public Works Administrator bi‑weekly report
- Executive session for non‑elected personnel evaluation
- Health Department report on influenza activity and disease surveillance
commissionbudgethealthpublic-workspersonnel
✓ Decided: County approved $28,720 elevator repairs for four county elevators
The commission unanimously approved using the Facility Fund to correct code compliance issues on four county‑owned elevators at a total cost of $28,720. It also approved Old Trooper membership dues of $450, a request and petition, tree‑removal quotes, and change orders. The board of public health was opened and later closed in the same meeting. Minutes from the January 12 meeting were approved.
- Approved $28,720 elevator correction contract (unanimous)
- Approved Old Trooper membership dues of $450 (unanimous)
- Approved request and petition presented (unanimous)
- Approved to obtain quotes for tree removal on Franklin St (unanimous)
- Approved change orders 20260000006‑20260000031 (unanimous)
- Approved minutes from 01/12/2026 (unanimous)
- Opened board of public health (unanimous)
- Closed board of public health (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 20", 2026
NIGHT MEETING
6:00-6:15 Commission review and update
6:15-6:20 Garry Berges, Emergency Management Director, Approve and signing of the Fireman Relief
Association document
6:20-6:30 Crystal Malchose, Human Resources Director, Weekly Update
6:30-7:00 Executive Session, Non-elected personnel / dept head evaluation
7:00-7:30 Jeremie Myers, Public Works Administrator, Bi-Weekly Report
7:30-8:00 Charles Martinez, Health Department Director, Monthly Report
Public Comment (5 minutes per person)
Adjourn
Geary County
Health Department
1212 West Ash Street
P. O. Box 282
Public Health Junction City, Kansas 66441
20 January 2026
Geary County Board of Health
GCPHD Monthly Update
1. Monthly Situation
PHIG
The PHIG grant was fully approved on December 31, confirming that Geary County will receive
the entire allocation of $137,098.57, with no loss of funding. A Budget Modification Request
(BMR) was submitted on January 12 to align the grant with updated guidance and reporting
requirements. We are currently awaiting KDHE’s release of the Financial Status Report (FSR)
so the remaining $43,294.29 for Quarter 4 of 2025 can be processed and reimbursed. At this
point, the grant is in good standing, and all required actions on our end have been completed.
Influenza Season
Since the end of December, Geary County has experienced a measurable increase in reported
influenza activity following relatively low levels earlier in the season, consi
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
January 20", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor
Chairman Tremont called the County Commission meeting to order at 6:00 p.m.
The pledge of allegiance was recited.
Commission review and update:
Giordano: Ms. Robison, Ms. Edwards and Commissioner Giordano spoke to Lead JC about County
Leadership.
Attended the employee task force meeting.
Attended the dinner for the Brigade Baseball team.
Attended the Flint Hills Regional Council Meeting, they hired two grant writers on a contract basis as
needed, mentioned EMS has received a $700,000 grant.
Attended the Martin Luther King JR celebration.
Attended Local Health Equity Action Team meeting, with some funding they provided some cold weather
gear, they are looking to get some additional funding to assist people with getting their GED.
Mentioned Old Troopers have asked the board to renew their membership.
Commission Ascher moved to approve the Old Trooper Dues for $450.00 for 2026, Commissioner
Giordano seconded, all voted in favor aye
Ascher: Attended the PBC meeting, Jeff Kline came to give an update about the Hospital, states $57,000
was received in accounts receivable last month.
Attended the Seals and Crofts show at the Opera House.
Tremont: Attended the Martin Luther King Jr celebration as well.
Mentioned January 28" is Local Government Day at
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026
Commissioners
Geary County Commissioners to consider GAAP financial reporting waiver
The Board of County Commissioners will discuss the reorganization of the commission and a resolution to exempt the county from certain generally accepted accounting principles (GAAP) for 2026 financial reports. The meeting includes reports from the Finance, Human Resources, and GIS directors, as well as the Sheriff and Register of Deeds.
- Resolution 01-12-2026 to exempt Geary County from K.S.A. 75-1120a(a) financial reporting requirements
- Reorganization of the County Commission
- Letter of support for Flint Hills Rural Electric Coop.
- Executive session for department head evaluations
- Review of cash balances totaling $55,891,329.34 as of 12/31/2025
financeaccountinggovernment-administrationbudget
✓ Decided: Commissioners approve GAAP waiver and 5% Cox franchise fee
The commission voted unanimously to approve a GAAP waiver for 2026 and a 5% franchise fee for Cox Communications' expansion. They also reappointed John Moyer to the Public Building Commission, approved the minutes from 01/05/2026, and confirmed all leadership nominations for 2026. The 911 Board was tabled pending a decision on its future.
- Nominated Commissioner Tremont as Chairman for 2026 – all in favor voted aye
- Nominated Commissioner Giordano as Vice‑Chairman for 2026 – all in favor voted aye
- Appointed Commissioner Ascher to the Public Building Commission – all in favor voted aye
- Appointed Chairman Tremont to the EDC Board – all in favor voted aye
- Reappointed John Moyer to the Public Building Commission for a three‑year term – all in favor voted aye
- Approved the GAAP waiver for 2026 (Resolution 01‑12‑2026) – all in favor voted aye
- Approved a 5% franchise fee with Cox Communications for their expansion – all in favor voted aye
- Approved the minutes from 01/05/2026 – all in favor voted aye
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 12", 2026
10:00-10:15_ | Commission review and update
10:15-10:30_| Reorganization of the County Commission
10:30-10:45 | Crystal Malchose, Human Resources Director, Weekly Report
10:45-11:15 | Tami Robison, Finance Director, Bi-Weekly Report - 2026 GAAP Waiver and PBC reappointments
11:15-11:30 | Troy Livingston, GIS Director, Letter of support for Flint Hills Rural Electric Coop.
11:30-11:45 | Sheriff Nate Boeckman, Bi-Weekly Report
11:45-12:00 | Jacqie Reisinger, Register of Deeds, Quarterly/Year End Report
12:00-12:15 | Public Comment (5 minutes per person)
12:30-1:30 | Executive Session, Non-Elected Personnel, Dept. Head Evaluations
Adjourn
RESOLUTION NO. 01-12-2026
A RESOLUTION EXEMPTING GEARY COUNTY, KANSAS, FROM THE PROVISIONS OF
K.S.A. 75-1120a (a).
WHEREAS, the County of Geary is now subject to the provisions of K.S.A. 75-1120a(a).
WHEREAS, the Board of County Commissioners of Geary County, Kansas, has determined that
the financial statements and financial reports prepared in conformity to generally accepted accounting
principles as promulgated by the National Committee on Govemmental Accounting and the American
Institute of Certified Public Accountants are not relevant to the requirements of the cash basis and budget
laws of this State and are of no significant value to the governing body or members of the general public of
Geary County, Kansas.
WHEREAS, there are no revenue bond resolutions or any other resolu
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
NS
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
Jemmary 12", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert, Cle, Betsy Edwards County Counselor ‘
Chairman Ascher called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission Review and Update:
Giordano: Attended the CVB Board meeting, they appreciated the financials being sent to them.
Attended the EDC Meeting, commented that-East St. is going to be completed.
Tremont: Nothing to report
Ascher: Attended the victory with Honors at Ft Riley for the outgoing Chief of Staff and it was a very
nice ceremony. The incoming Chief of Staff was also there, and Commissioner Ascher met him.
The three road viewers have agreed to do it with no compensation.
Reorganization.of the Commission with County Clerk, Courtney Gilbert:
Commissioner Giordano moved to nominate Commissioner Tremont as Chairman for 2026,
Commissioner Ascher seconded, all in favor voted aye
Chairman Tremont moved to nominate Commissioner Giordano as Vice-Chairman for 2026,
Commissioner Ascher seconded, all in favor voted aye
|
|
|
Commissioner Giordano moved to nominate Commissioner Ascher to serve on the Public Building
Commission (PBC) for 2026, Chairman Tremont seconded, all in favor voted aye
Commissioner Ascher moved to nominate Chairman T; ‘remont to serve on the EDC Board for 2026,
Commissioner Giordano seconded, all in favor voted
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026
Commissioners
Commission adopts Kansas Hazard Mitigation Plan and reviews key infrastructure items
The Geary County Commission will officially adopt the Kansas Homeland Security Region I Hazard Mitigation Plan. The meeting also includes appointing road viewers for a vacation request of the right‑of‑way at Walker Road and Walker Access Road North, and updates on public works projects such as the Kaw Valley contract to replace the McNeal Bridge. Additional agenda items cover a household hazardous waste assessment, an Energy Efficiency & Conservation Block Grant program update, and a Kansas Local Bridge Rating Program update.
- Adopt Kansas Homeland Security Region I Hazard Mitigation Plan (Resolution)
- Schedule and appoint road viewers for vacation of right‑of‑way at Walker Road & Walker Access Road North
- Kaw Valley Contract for McNeal Bridge 19.6‑T.7 replacement
- Big Lakes Regional Household Hazardous Waste (HHW) 2026 Assessment
- Energy Efficiency & Conservation Block Grant Program (EECBG) update
hazard-mitigationroadsbridgeswaste-managementenergy-efficiencypublic-works
✓ Decided: Commission approved a $74,872 bridge replacement contract with Kaw Valley
The Geary County Commission unanimously approved several items, including a $74,872 contract with Kaw Valley for the McNeil Road bridge replacement and a $98,834 design cost. It also adopted the 2025 Kansas Region Hazard Mitigation Plan, approved a $20,067.50 assessment for the Big Lakes hazardous waste program, and authorized a sole‑source purchase of fire‑department air‑pac equipment. Additional approvals covered a transfer‑station fee increase, tax‑roll correction change orders, and the meeting minutes from December 22, 2025.
- Approved $74,872 bridge replacement contract with Kaw Valley (unanimous)
- Approved $98,834 non‑participating design costs for bridge project (unanimous)
- Adopted 2025 KS Region Hazard Mitigation Plan (unanimous)
- Approved $20,067.50 Big Lakes hazardous waste assessment (unanimous)
- Approved sole‑source purchase of Air Pacs for fire grant (unanimous)
- Approved increase to Geary County Transfer Station fee schedule (unanimous)
- Approved tax‑roll correction change orders 2025012138‑2025012159 (unanimous)
- Approved minutes from 12‑22‑2025 (unanimous)
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
County Commission Meeting Agenda January 5‘, 2026
10:00-10:15 | Commission review and update
10:15-10:30_ | Crystal Malchose, Human Resources Director, Weekly Report
10:30-10:45 | Schedule & appoint road viewers for the request of vacation of certain Geary County Right-of-Way-
located at intersection of Walker Road and /Walker Access Road North, Geary County Kansas,
Section 2 Township 11 South, Range 5 East
10:45-11:00 | Garry Berges, Emergency Management Director, Rural Fire Chief-Monthly Report
11:00-11:30 | Jeremie Myers, Public Works Administrator, Bi-Weekly Report
11:30-11:45 | Raquel Cinco, CVB Director, Monthly Update
11:45-12:00
12:00-12:15 | Public Comment (5 minutes per person)
12:15-12:30 Adjourn
Region | Resolution Officially Adopting the 2025 KS Region | Hazard Mitigation Plan
Resolution # : Adopting the Kansas Homeland Security Region I Hazard Mitigation Plan
Whereas, the (Name of Government/District/Organization) recognizes the threat that natural hazards pose to people
and property within our community; and
Whereas, undertaking hazard mitigation actions will reduce the potential for harm to people and property from
future hazard occurrences; and
' Whereas, the U.S. Congress passed the Disaster Mitigation Act of 2000 (“Disaster Mitigation Act”) emphasizing
the need for pre-disaster mitigation of potential hazards;
Whereas, the Disaster Mitigation Act made available hazard mitigation grants to state and local governments; and
‘Whereas, an adopte
[Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADJOURNED MEETING OF THE GEARY COUNTY COMMISSION MINUTES
January 5", 2026
Commissioners Present: Keith Ascher, Trish Giordano, and Kathy Tremont
Others present: Courtney Gilbert, County Clerk, Betsy Edwards County Counselor
Chairman Ascher called the County Commission meeting to order at 10:00 a.m.
The pledge of allegiance was recited.
Commission Review and Update:
Tremont:
Nothing to report
Ascher:
Nothing to report
Giordano:
Noted evaluations of department heads will begin soon, suggesting an executive session with fellow
commissioners to discuss prior to meeting with department heads.
ATA Bus and K18 connector between Junction City and Manhattan started January 1%, 2026.
Commissioner Tremont moved to amend the agenda today to do an executive session for 15 minutes
with HR director to discuss evaluations from 11:45am — Noon, Commissioner Giordano seconded,
all voted in favor aye
Crystal Malchose, Human Resources Director, gave the weekly report:
« Out of office notifications were presented and signed by commissioners.
® Nex-Tech is updating their domain name system.
e Atthe KAC annual conference meeting, a commissioner from Pottawatomie asked Mrs. Malchose
to share with the commissioners a framework for county property tax relief packet, Commissioner
Giordano recommended commissioners to send this to state representatives.
e Everbridge test wasn’t great, HR and Emergency Management are working to update contact
information, due to the Holiday participation may
[Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026
Commissioners
Geary County Emergency Services report $320,350 loss in 2025
The Commissioners will review the 2025 Geary County Emergency Services report. The report lists 126 total fire calls, details fire type counts, and records a total dollar loss of $320,350. It also shows 1,062.5 fire‑ground hours logged by command staff and volunteer firefighters.
- 126 total fire calls in 2025 (up from 106 in 2024)
- Fire type counts: 14 building fires, 20 vehicle fires, 32 vegetation fires, 2 crop fires, 2 other fires, 20 medical assists
- Total dollar loss for 2025: $320,350
- 1,062.5 fire‑ground hours logged (211.6 command staff, 850.9 volunteer)
- Volunteer and command staff response totals: 163 command staff, 591 volunteers
emergency-managementfirebudgetpublic-safetydata-report
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Emergency Management ¢ Rural Fire Department
EMERGENCY PLANNING & RESOURCES
&) GEARY COUNTY EMERGENCY SERVICES
Business Phone: (785) 238-1290 236 E. 8" Street, Junction City, KS 66441
___ Fax: (785) 238-1373 ; Websitewww.gearycounty.org
2025 FIRE RUNS
Total Calls 2025 — 126 106(2024)
Fire Types: 2025 2024
Building Fires: 14 8
Vehicle Fires: 20 19
Grass, Brush, Fires: 32 34
Cultivated grain or crop fire: 2 4
Other fires zZ 2
Medical Assist: 20 5
Fuel Spills/Vehicle Accident/
Down Power Line: 9 10
Service Calls 7 8
Good Intent:
(includes dispatched & cancelled
enroute and controlled burns) 23 16
Severe Weather 4 7
Dollar Loss:
Building Fires
Vehicle Fires
Vegetation Fires
Crop Fires
Other Fires
TOTAL LOSS
Responses:
Command Staff
Volunteer Firefighters
. Total
Hours on Fire Ground:
Command Staff
Volunteer Firefighters
Total
$ 173,000.00
$ 134,500.00
$ 2,500.00
$ 350.00
$ 1,000.00
$ 320,350.00
163
591
754
211.6 hrs
850.9 hrs
1,062.5 hrs
Unit Responses
100 Fast Attack 14
102 Heavy Brush 8
104 Pumper 0
106 Heavy Brush 12
108 Fast Attack 11
110 Heavy Brush 2
112 Fast Attack 41
114 Interface Unit 14
116 Pumper 14
101 Pumper 22
103 Pumper 2
105 Heavy Brush 8
107 Heavy Brush 10
109 Interface Unit 15
111 Fast Attack 15
113 Brush Unit 34
115 Tanker 41
117 Pumper 35
Meeting archives
🔗 Embed this city · use the data
Free to reuse under CC BY 4.0 — a link back is appreciated. Paste this into your site:
<iframe src="https://mytown.theboringparts.com/city/gearycounty.gov/embed/" width="100%" height="640" loading="lazy" style="border:1px solid #ddd;border-radius:8px" title="Geary County government meetings"></iframe>
<p>Local government meetings via <a href="https://mytown.theboringparts.com/city/gearycounty.gov/">MyTown</a></p>
The credit line under the iframe is a real link back — keep it and you help others find us (and it satisfies the CC BY attribution). Prefer JSON? meetings.json · full embed & API guide.