The Boring PartsFederalLocal · USLocal · Canada
Roswell, Georgia

Roswell public meetings in 2024

75 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Wed Dec 18, 2024

Design Review Board - Special Called Meeting

DRB to hold initial public hearing on 89‑unit Riverwalk II townhome project

The Design Review Board will hear an initial application for an 89‑unit townhome development at 1200 Old Alabama Road, known as Riverwalk II. Staff recommends the board consider a variance to reduce ground‑floor transparency to 15% and require mayor‑council approval for any retaining wall over 6 feet. The board will also consider a playground addition and repaving at 9212 Nesbit Ferry Road and approve the October 1, 2024 DRB minutes.

zoninghousingdevelopmentdesign-reviewpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Dec 18, 2024

Mayor and Council - Special Called Meeting

City Attorney recommends closing agenda to discuss real estate

The Roswell Mayor and Council will hold a special called meeting on Dec. 18, 2024. The agenda consists of a City Attorney’s Report that includes a recommendation to close the meeting in order to discuss real estate matters. No other items are listed for decision or discussion.

real-estatecity-attorneycouncilspecial-meeting
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Dec 17, 2024

Planning Commission - Regular Meeting

Riverwalk II townhome development of 89 units at 1200 Old Alabama Road heard as initial

The Roswell Design Review Board will hold a public hearing on the Riverwalk II project, an 89‑unit townhome development at 1200 Old Alabama Road. Staff recommends hearing the item as an initial review and notes conditions such as a 5% transparency variance and mayor‑council approval for retaining walls over 6 feet. The board will also consider a playground addition and parking‑lot repaving at 9212 Nesbit Ferry Road.

zoninghousingdevelopmentdesign-reviewpublic-hearingroads
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Dec 10, 2024

Committees of Council - Regular Meeting

Council sets fees for 2025 municipal election and approves Big Creek Parkway contract

The Roswell Committees of Council will vote on setting qualifying fees for the November 4, 2025 municipal election and approve a construction contract for the Big Creek Parkway Phase 1 TSPLOST project.

electionstransportationroadsbudgettsplostcontract
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Dec 9, 2024

Mayor and Council - Work Session

Council discusses proposed fee changes for multiple city departments

The Roswell Mayor and Council will review a fire response analysis presentation and discuss proposed fee structures for the Fire, Community Development, and Environmental/Public Works departments. They will also hold a discussion on the Parking Plan Analysis. No formal decisions are indicated in the agenda.

firefinancefeesparkingplanningpublic-workscommunity-development
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Dec 9, 2024

Mayor and Council - Regular Meeting

City Council approves FY 2025 budget of $197,025,114

The Roswell City Council will adopt the FY 2025 budget of $197,025,114 and adjust fees for the fiscal year. A $1,014,741.66 Local Maintenance & Improvement Grant will be accepted and funded. The council will also approve a contract with Temple, Inc. for traffic preemption up to $733,535.20 and a task order to Hussey Gay Bell for Fire Station #27 design up to $540,198. Additional items include a conditional use for a massage establishment at 875 Mansell Road and a road resurfacing agreement for Ebenezer Road.

budgetfinancetransportationpublic-safetydevelopmenthousing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Dec 5, 2024

Alcoholic Beverage License Board - Public Hearing

Board will decide on new and renewed alcoholic beverage licenses for multiple venues

The Alcoholic Beverage License Board will hold a public hearing to review applications for new and existing liquor, beer, and wine licenses, including full pouring, limited pouring, and package permits, some with Sunday sales. The board will also approve the minutes from the previous meeting and consider renewals for 2025. Several establishments such as I Taquero Mucho, Eggs Up Grill, Chicken Bee, and others are listed for new or transferred licenses.

alcoholic-beveragelicensingrestaurantssunday-salespublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Dec 5, 2024

Roswell Recreation Commission - Regular Meeting

City proposes new fees for Fire, Community Development, and Environmental/Public Works departments

The Roswell Recreation Commission work session will include a Fire Response Analysis presentation and discussion of proposed fee structures for the Fire Department, Community Development Department, and Environmental/Public Works Department. The meeting will also review a Parking Plan Analysis presented by Seer World LLC, outlining a comprehensive parking business model and financing strategy. The commission will consider these proposals but no final fee decisions are indicated.

fire-departmentcommunity-developmentpublic-worksparkingfinancefees
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Nov 26, 2024

Committees of Council - Regular Meeting

Roswell considers adding Johns Creek Police to North Fulton SWAT Team

The Committees of Council will discuss expanding the North Fulton SWAT Team MOU to include the Johns Creek Police Department. Other agenda items include transportation grants and a legal brief regarding the City of Milton.

policetransportationbudgetintergovernmental-agreementlegal
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Nov 26, 2024

Mayor and Council - Special Called Meeting

Alcoholic Beverage Board to hear 13 license applications for Sunday sales

The Alcoholic Beverage License Board will hold a public hearing to consider 13 applications for Sunday sales permits, including renewals for 2025. The items range from new liquor licenses for restaurants and grocery stores to transfers of ownership for existing establishments.

alcohollicensingpublic-hearingroswellbusinesssunday-sales
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Nov 25, 2024

Mayor and Council - Regular Meeting

Council approves $805,059 contract for radio tower and 911 center equipment relocation.

The Roswell Mayor and Council will vote on several major contracts, including a $805,059 agreement to build a radio tower and move equipment to the new 911 center. They will also consider stormwater construction funding, upgrades to the 911 phone and digital delivery systems, and a redevelopment plan establishing a Tax Allocation District. Additional items include a small‑tract variance request and a memorandum of understanding with the Georgia Department of Labor.

public-worksemergency-servicesfinancedevelopmentzoninglabor
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Nov 19, 2024

Planning Commission - Regular Meeting

Planning Commission to review Chaffin Road subdivision plat

The Roswell Planning Commission will consider a preliminary plat for a six-lot subdivision at 155 Chaffin Road. The body will also discuss a text amendment for the Hill Street Overlay and review meeting minutes from August and January.

planningzoningsubdivisionchaffin-roadhill-streettext-amendmentminutes
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Nov 18, 2024

Planning Commission - Work Session

Planning Commission to consider Hill Street Overlay code amendment

The Roswell Planning Commission will discuss two preliminary plats for Chaffin Road and Scott Road, a withdrawn text amendment to the Unified Development Code, and a text and map amendment for the Hill Street Overlay. The commission will also adopt the 2025 meeting calendar. All items are for discussion in the work session.

planningzoningdevelopment-codeplatsmeetings
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Nov 18, 2024

Committees of Council - Special Called Meeting

Roswell City Council to vote on 90‑day moratorium on all murals

The Roswell City Council will vote on a resolution that imposes a temporary 90‑day moratorium on all murals in the city. The moratorium is intended to maintain the status quo until the Unified Development Code is amended to provide appropriate mural regulations. Council members cited concerns that murals may affect aesthetic beauty, economic development, and public safety. No financial impact is associated with the resolution.

zoningpublic-safetyartscity-councildevelopment-code
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Nov 18, 2024

Mayor and Council - Special Called Meeting

City of Roswell council to approve FY 2025 budget of $197 million

The Mayor and City Council will consider the first reading of the City of Roswell’s Fiscal Year 2025 budget. The ordinance proposes a total budget of $197,025,114, allocating funds across general, capital, and enterprise accounts. Council members will vote on the motion to approve the first reading of the budget.

budgetfinancetaxescapital-projectscity-government
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Nov 14, 2024

Board of Zoning Appeals - Regular Meeting

BZA to consider setback variance for garage addition at 170 Derby Forest Ct.

The Board of Zoning Appeals will review a request to reduce rear and side setbacks for a residential addition. The board will also determine the 2025 meeting calendar and review previous minutes.

zoningvariancesresidentialsetbacks
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Thu Nov 14, 2024

Mayor and Council - Special Called Meeting

Roswell presents FY 2025 proposed budget of $197 million

The Mayor and City Council will present the City of Roswell's FY 2025 proposed budget, totalling $197,025,114. The budget is reported as balanced with no increase to the property tax millage rate. Highlights include road resurfacing, new equipment purchases, and additional staffing for fire and concrete crews. The first budget reading is scheduled for November 18.

budgetfinanceinfrastructurepublic-safetystaffing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Nov 13, 2024

Historic Preservation Commission - Regular Meeting

Commission will consider a Certificate of Appropriateness for 120 Bulloch Ave renovations

The Roswell Historic Preservation Commission will hold a public hearing on a Certificate of Appropriateness for exterior renovations at 120 Bulloch Avenue. It will also discuss an appeal of an HPC minor for 77 Vickery Street, a withdrawn text amendment to the Unified Development Code, a text and map amendment for the Hill Street Overlay, and provide design guidance for the Taqueria Tsunami project at 982 Canton Street.

historic-preservationzoningdevelopment-codedesign-guidelinespermits
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Nov 12, 2024

Committees of Council - Regular Meeting

City to approve $805,059.72 radio tower contract for new 911 center

The Roswell Committees of Council will vote on several agenda items, including awarding a $244,748 stormwater construction task order to Chatfield Contracting for the Ramsdale Drive project. They will also consider a $805,059.72 contract to build a 150‑foot radio tower and relocate equipment to the new 911 Center. Additional items include funding the Carbyne APEX 911 phone system ($247,687.20), an ESInet digital IP delivery upgrade ($21,336.48), and a redevelopment plan for Tax Allocation District #1 (Roswell East‑West Connection TAD).

public-safetyinfrastructurebudgettelecommunicationsstormwatereconomic-development
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Nov 12, 2024

Mayor and Council - Regular Meeting

Council approves veterans proclamations and DDA appointments

The Mayor and Council will read proclamations honoring a local Marine veteran and Veterans Day. The body also plans to appoint members to the Downtown and Roswell Development Authorities and approve several administrative and construction contracts.

veteransappointmentsproclamationsconstructiondevelopmentcontractsbudget
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Nov 8, 2024

Mayor and Council - Workshop

Roswell considers $805,059 contract for new 911 center radio tower

The Mayor and Council will discuss several infrastructure and public safety upgrades, including equipment for a new 911 center and stormwater construction. The body will also consider a redevelopment plan for a new Tax Allocation District.

public-safety911stormwatereconomic-developmentinfrastructure
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Thu Nov 7, 2024

Alcoholic Beverage License Board - Public Hearing

Board will consider a new limited‑pour beer and wine license for Sushi Hut.

The Roswell Alcoholic Beverage License Board will hold a public hearing to review several new alcohol license applications. The agenda includes six applicants seeking limited pour, full pour, brewpub, and package licenses, all with Sunday sales. The board will also approve minutes from the previous meeting.

alcohol-licensingbusinesspublic-hearingroswellrestaurants
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Nov 7, 2024

Design Review Board - Regular Meeting

Meeting will cover routine procedural matters only

The Roswell Recreation Commission work session on November 7, 2024 will address standard procedural items such as call to order, agenda items, information items, and adjournment. No specific projects, contracts, or policy decisions are listed on the agenda.

recreationgovernanceprocedural
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Nov 7, 2024

Roswell Recreation Commission - Work Session

Work session with no specific agenda items listed

The Roswell Recreation Commission held a work session on November 7, 2024. The agenda did not list any specific items for decision or discussion, indicating a routine meeting. The commission members and a possible quorum of the mayor and city council were noted. The meeting concluded with standard procedural items.

recreationwork-sessioncity-government
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Nov 7, 2024

Roswell Recreation Commission - Regular Meeting

Commission will approve October minutes and review the November capital project list

The Roswell Recreation Commission will vote to approve the 10.03.24 meeting minutes. It will share information about upcoming work session and regular meeting dates in December. The commission will also review the Capital Project List that outlines the status of numerous park and recreation projects.

minutescapital-projectsparksrecreationmeeting-schedule
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Oct 29, 2024

Committees of Council - Regular Meeting

Roswell committees to discuss $2 million loan collateral and infrastructure projects

City committees are meeting to consider a modification to a $2,039,000 Section 108 loan application and various public works contracts. The body will also review agreements for the Hardscrabble Rd Multi-Use Trail and the Hill Street Redevelopment.

financetransportationpublic-workseconomic-developmenthousing
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Oct 28, 2024

Mayor and Council - Regular Meeting

Roswell Mayor and Council to consider $1.15 million property purchase

The Mayor and Council will discuss the purchase of property at 1028 Green Street and the functional use of Church Circle. The meeting also includes the swearing-in of Roswell Fire Department staff and a veteran's award proclamation.

real-estatetransportationfire-departmentpublic-safety
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Oct 17, 2024

Planning Commission - Regular Meeting

City approves $1.15 million purchase of 1028 Green Street

The Roswell Planning Commission will consider several agenda items, including approving the functional use of Church Circle and authorizing a $1,150,000 purchase of property at 1028 Green Street. The meeting also includes a proclamation honoring First Lieutenant Craig Smith and the swearing‑in of new Roswell Fire Department staff. Routine approval of the October 15, 2024 Mayor and Council meeting minutes is also on the agenda.

property-purchasefinancetransportationveteransfire-departmentcouncil-minutes
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Oct 15, 2024

Committees of Council - Regular Meeting

Council will vote on a Unified Development Code amendment affecting sign permits

The Roswell City Council will approve the September 10 minutes, consider a text amendment to the Unified Development Code that updates sign‑permit tables and crowns sign limits, and vote on changing the functional use of Church Circle to a two‑way segment and a multi‑use trail. No financial impact is noted for the transportation proposal.

zoningsignagedevelopmenttransportationcity-council
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Oct 15, 2024

Mayor and Council - Regular Meeting

Council to approve $6 million Pine Grove Road budget increase

The Roswell Mayor and Council will consider several approvals, including a $6 million budget amendment for the Pine Grove Road project, raising its total budget to $20.8 million. They will also vote on a contract to replace artificial turf at Roswell Area Park Multisport Field 1 for $720,340 and a Liberty Square Park contract for $238,790.50. Additional items include a second‑reading ordinance to adopt a 4.949 millage rate for Tax Year 2024 and a text amendment to the Unified Development Code for the Hill Street Overlay.

parksroadsbudgetzoningcontracts
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Oct 9, 2024

Historic Preservation Commission - Regular Meeting

HPC reviews fence request for 1096 Alpharetta Street

The Historic Preservation Commission will hold public hearings regarding certificates of appropriateness for two properties. The body will also discuss park improvements at 127 Bulloch Avenue and the 2025 meeting calendar.

historic-preservationzoningpublic-hearingsfencing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Oct 8, 2024

Mayor and Council - Possible Quorum of Mayor & Council

Historic Gateway Project update presented to Roswell Mayor and Council

The Roswell Mayor and Council will hear a presentation on the Historic Gateway Project from the City and GDOT. An open house for the project will be held at St. Andrew Catholic Church, 675 Riverside Road. No formal decisions are indicated on the agenda.

developmenttransportationcommunityhistoric-preservation
St. Andrew Catholic Church, 675 Riverside Road, Family Center, Roswell, GA 30075
Tue Oct 8, 2024

Board of Zoning Appeals - Regular Meeting

Historic Preservation Commission to review requests for 1096 Alpharetta St and 120 Bulloch Ave

The Historic Preservation Commission will hold public hearings to determine if proposed exterior changes at two properties meet historic guidelines. The commission will also discuss park improvements at 127 Bulloch Avenue and the 2025 meeting calendar.

historic-preservationzoningpublic-hearingsfencingrenovations
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Oct 7, 2024

Mayor and Council - Special Called Meeting

Roswell holds public hearing on 2024 millage rate

The Mayor and Council are holding a public hearing to discuss the millage rate for tax year 2024. The proposed rate of 4.949 represents no change in the current rate.

taxesmillage-ratebudget
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Oct 3, 2024

Alcoholic Beverage License Board - Public Hearing

New alcohol licenses for Corella Spirits, Roswell Liquor Store, Sprouts Market, RaceTrac

The Alcoholic Beverage License Board will hold a public hearing to consider applications for new alcoholic beverage licenses. The agenda includes a new license for Corella Spirits (wholesale liquor, beer, wine, Sunday sales), a change of ownership for Roswell Liquor Store, and new licenses for Sprouts Farmer’s Market and RaceTrac, each for beer and wine with Sunday sales. The board will also review minutes from prior meetings and address any new business.

alcoholic-beveragelicensingbusinesssunday-salesroswell-ga
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Oct 3, 2024

Roswell Recreation Commission - Work Session

Roswell Recreation Commission to discuss Friends of Roswell leadership and bylaws

The commission will hold a work session to discuss the appointment of a Vice Chair for Friends of Roswell. Members will also receive updates on Booster Club bylaw changes and a presentation regarding Founders Park.

recreationparksbylawscommunity-events
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Oct 3, 2024

Roswell Recreation Commission - Regular Meeting

Commission will vote to approve September 5, 2024 meeting minutes

The Roswell Recreation Commission will consider and vote on the approval of the September 5, 2024 meeting minutes. The agenda also includes a Director’s Report and an informational update on the October 3, 2024 capital project list. Notices of upcoming work sessions and commission meetings in November are also provided.

recreationminutescapital-projectsmeetingsparks
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Tue Oct 1, 2024

Design Review Board - Regular Meeting

Board to consider 102-unit multi-family building at 199 Grove Way

The Design Review Board will hold a public hearing for a final decision on a new 4-story multi-family building proposed by the Roswell Housing Authority. The project would replace a condemned building with 102 residences and associated amenities.

housingzoningmulti-familydesign-reviewpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Sep 30, 2024

Mayor and Council - Open Forum

Mayor reads proclamation honoring Sergeant Kevin Green as Esteemed Veteran

The Roswell Mayor and Council open forum will include Mayor Kurt Wilson reading a proclamation that names Sergeant First Class Kevin Green an Esteemed Veteran of Roswell. The City Attorney will present a recommendation to close the meeting to discuss personnel, litigation, and real estate matters. The agenda also contains a welcome, invocation, pledge of allegiance, and an open‑mic public comment period. No policy decisions are listed on the agenda.

mayor-reportcity-attorneyveteranspublic-commentmeeting
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Sep 27, 2024

Mayor and Council - Workshop

City Attorney recommends closing to discuss personnel, litigation, real estate

The council will hear a proclamation honoring United States Army Sergeant First Class Kevin Green as an Esteemed Veteran of Roswell. They will also consider the City Attorney’s recommendation to close the meeting to discuss personnel matters, ongoing litigation, and real‑estate issues. No decisions are recorded; the items are presented for discussion.

proclamationveteranscity-attorneypersonnellitigationreal-estate
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Tue Sep 24, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Committee to consider $20.8M Pine Grove Road improvement concept

The committee will approve the minutes from the August 27 meeting. It will vote on the Pine Grove Road improvement concept, which seeks to raise the project budget to $20.8 million. The body will also consider contracts to replace artificial turf at Roswell Area Park Multisport Field 1 for $720,340 (total budget $828,391) and to award Liberty Square Park work to Columbia Engineering for $238,790.50 (total budget $262,669.50). A resolution to apply for the FY 2024 Justice Assistance Grant from the U.S. Department of Justice will be considered.

transportationroadsinfrastructureparkscontractsbudgetgrants
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Sep 23, 2024

Mayor and Council - Regular Meeting

Roswell considers 2024 millage rate and historic parks improvements

The Mayor and Council will discuss a 2024 millage rate and a contract for historic parks improvements. The body is also considering several amendments to the City Code regarding animal control and park activities.

taxesparksanimal-controlbudgetordinances
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Sep 17, 2024

Planning Commission - Regular Meeting

City recommends $460k CMAR contract and up to $3M ARPA funding for historic parks plan

The Roswell Planning Commission will consider several ordinance text amendments, including changes to animal control tethering rules, a prohibition on transient sales of dogs, cats and domestic rabbits, and activity restrictions in Old Mill Park. It will also adopt a millage rate of 4.949 for tax year 2024. A recommendation will be made to award CMAR services to Reeves Young, Inc. for up to $460,420 plus 4.5% of construction costs and up to $3.0 million in ARPA‑funded construction costs. Additional items include a resolution for the North Fulton Community Improvement District expansion and a discussion on personnel, litigation, and real estate matters.

animal-controlparksfinancemillagecontractspublic-safety
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Fri Sep 13, 2024

Mayor and Council - Possible Quorum of Mayor & Council

Mayor meets Roswell neighborhoods and HOAs at Roswell River Landing

The Mayor and Council members will hold a meet‑up with Roswell neighborhoods and homeowners associations. The gathering is scheduled for Friday, September 13, 2024, from 8:30 AM to 10:00 AM at Roswell River Landing, 245 Azalea Drive. No formal decisions are indicated; the session appears to be for discussion and community outreach.

community-engagementneighborhoodshomeowners-associationspublic-meeting
Roswell River Landing, 245 Azalea Drive, Roswell, GA 30075
Fri Sep 13, 2024

Alcoholic Beverage License Board - Special Called Public Hearing

Board reviews full pouring and Sunday sales request for Rodgers Catering

The Roswell Alcoholic Beverage License Board will hold a public hearing on a request for a full pouring license, including liquor, beer, wine, and Sunday sales, for Rodgers Catering & Events LLC. The request had been deferred at the September 5, 2024 hearing. The board will decide whether to grant the license at this meeting.

alcoholic-beveragelicensingbusinessroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Sep 11, 2024

Historic Preservation Commission - Regular Meeting

Guidance on HPC design guidelines for the 982 Canton Street project

The Historic Preservation Commission will discuss direction and guidance on adhering to the HPC design guidelines for the upcoming project at 982 Canton Street. The commission will also consider and approve the minutes from the August 14, 2024 HPC meeting. No other decisions are listed on the agenda.

historic-preservationdesign-guidelinesminutesroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Sep 10, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Committee will vote on awarding the Liberty Square Park design contract for $238,790.50

The Administration, Finance, Recreation and Parks Committee will consider awarding the design contract for Liberty Square Park to Columbia Engineering. The contract amount is $238,790.50 with a total budget authorization of up to $262,669.50, funded by a grant. The committee will also approve the minutes from the August 13, 2024 meeting.

parkscontractsfinancecity-councilgrantsdesign
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Sep 10, 2024

Roswell Public Facilities Authority (PFA) - Regular

Roswell Public Facilities Authority to elect Chairman

The Roswell Public Facilities Authority is meeting to conduct a single piece of business. The body will vote to elect a Chairman for the Authority.

governanceelectionpublic-facilities
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Sep 10, 2024

Board of Zoning Appeals - Regular Meeting

HPC to discuss design‑guideline guidance for 982 Canton Street project

The Roswell Historic Preservation Commission will review direction and guidance on adherence to the HPC design guidelines for the upcoming project at 982 Canton Street. The commission will also consider and approve the minutes from its August 14, 2024 meeting.

historic-preservationdesign-guidelinesminutesroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Sep 9, 2024

Mayor and Council - Regular Meeting

City approves up to $25,000 for Woodstock Road Multi-use Trail right‑of‑way

The Roswell Mayor and Council will consider several ordinance amendments, including changes to animal control and park use. They will review multiple conditional use applications for properties on Woodstock Road. The council will also vote on a contract to spend up to $25,000 for right‑of‑way acquisition for Phase 1 of the Woodstock Road Multi‑use Trail TSPLOST project. Finally, the August 26 meeting minutes will be approved.

zoningtransportationanimal-controldevelopmenttrails
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Sep 5, 2024

Alcoholic Beverage License Board - Public Hearing

Board will consider two new full‑pour liquor licenses with Sunday sales

The Alcoholic Beverage License Board will hold a public hearing to review applications for full‑pour liquor, beer and wine licenses that include Sunday sales. The applications are from Rodgers Catering & Events LLC ("Recess in Roswell") at 11510 Woodstock Road and from NFHS Roswell LLC ("Roswell Junction") at 340 Atlanta Street. The board will discuss and may approve these new licenses.

alcoholic-beveragelicensingsunday-salesbusinessroswell
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Sep 5, 2024

Roswell Recreation Commission - Work Session

Commission considers policy for dual roles with Friends of Roswell Parks

The Roswell Recreation Commission is meeting to consider a policy allowing members to simultaneously serve as officers for the 501(c)(3) Friends of Roswell Parks. The body will also discuss the 2024 Youth Day Parade Grand Marshal and booster club bylaws.

parksrecreationpolicybudgetnon-profit
Hembree Park Community Room, 850 Hembree Road, Roswell, GA 30075
Thu Sep 5, 2024

Roswell Recreation Commission - Regular Meeting

Commission will vote on adding a dual‑role policy for Friends of the Roswell Parks.

The Roswell Recreation Commission will first approve the minutes from the August 1 meeting. It will then consider two approvals: a policy that allows commission members to serve in dual roles with Friends of the Roswell Parks, and the selection of the 2024 Youth Day Parade Grand Marshal. An informational capital project list will be presented, and upcoming meeting dates will be announced.

recreationparkspolicyyouth-paradecapital-projectsmeetings
Hembree Park Community Room, 850 Hembree Road, Roswell, GA 30075
Tue Sep 3, 2024

Design Review Board - Regular Meeting

Design Review Board to consider new 102-unit building at 199 Grove Way

The Design Review Board is reviewing an initial application from the Roswell Housing Authority to build a 4-story multi-family building. The project would replace a condemned 40-unit building on a 2.97-acre site. The proposal includes 102 residences, a rooftop deck, and a new 8.5-foot sidewalk along Grove Way.

housingzoningmulti-familylandscapingpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 27, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

Roswell committee to consider Woodstock Road trail funding and animal ordinances

The Community Development and Transportation Committee will discuss right-of-way acquisitions for a multi-use trail and proposed changes to city ordinances regarding the tethering and sale of animals. The body will also hold discussions on millage rates and Old Mill Park.

transportationanimal-controlordinancesbudgettrails
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Aug 26, 2024

Mayor and Council - Regular Meeting

City Council to approve purchase of two new police K‑9 dogs

The Roswell Mayor and Council will consider a proclamation for Lieutenant Commander Greg Roecker, approve the appointment and oath of Joseph Cusack to the Roswell Development Authority, and vote on the consent agenda. They will also approve the purchase of two new police K‑9 dogs using the Confiscated Assets Fund, accept a FY25 Cultural Facilities Grant from the Georgia Council for the Arts, and review a conditional use request for a massage establishment at 885 Woodstock Road, Suite 300. Two text amendments to the Unified Development Code will be considered: one to Article 13, Section 13.4.3 (Second Reading) and another to Article 5, Section 5.2.1 (First Reading).

policegrantzoningdevelopment-codemassagecultural-facilities
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Aug 26, 2024

Roswell Public Facilities Authority (PFA) - Regular

City seeks $25,000 blanket approval for Woodstock Road Trail right‑of‑way acquisition

The committee will vote on a blanket approval to perform right‑of‑way acquisition services for the Woodstock Road Multi‑use Trail Phase 1 TSPLOST project, limited to $25,000. It will also consider text amendments to the city code adding Section 8.1.10.1 on dog tethering and a new Section 8.1.25 prohibiting transient sales of dogs, cats, and domestic rabbits. Additional items include a modification to the draft Section 108 loan application, a discussion of the millage rate, and a discussion of Old Mill Park.

transportationright-of-waytrailsanimal-controlfinancetaxesparks
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 20, 2024

Planning Commission - Regular Meeting

Planning Commission considers special events center permit

The Roswell Planning Commission will consider a conditional use permit for a special events facility at 11510 Woodstock Road. The applicant, Building Kidz School, proposes using the gym and playground for private events after daycare hours.

planningzoningspecial-eventsrecreationdowntowntext-amendment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Aug 14, 2024

Historic Preservation Commission - Regular Meeting

Commission reviews new home construction request for 69 Maple Street

The Historic Preservation Commission will consider a Certificate of Appropriateness for a new single-family home on a vacant lot. The body will also discuss a text amendment to the Unified Development Code regarding Downtown Historic Districts applicability.

zoninghistoric-preservationhousingunified-development-code
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 13, 2024

Committees of Council - Admin. and Fin. and Rec. and Parks Regular Meeting

Committee will vote on applying for a $25,000 cultural grant with city match

The Administration, Finance, Recreation and Parks Committee will first approve the minutes from its July 9, 2024 meeting. It will then consider applying for and accepting the FY25 Cultural Facilities Grant from the Georgia Council for the Arts, which seeks $25,000 in grant funds and a $25,000 city match to purchase a video projection system for the Roswell Cultural Arts Center Mainstage. The committee will vote on the grant application.

grantsartsculturefinancecity-council
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Aug 13, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Roswell committee to approve retiring police dog and buying two new K-9s

The Roswell Public Safety and Public Works Committee will consider a $1 sales agreement to retire police dog Ivar and a $48,000 contract to purchase two new K-9 dogs from Valhall K-9.

policek-9public-safetywaterlinebudgetcontractsroswell
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Tue Aug 13, 2024

Board of Zoning Appeals - Regular Meeting

Commission to review new home construction at 69 Maple Street

The Historic Preservation Commission will hold a public hearing regarding a request for a Certificate of Appropriateness to build a single-family home on a vacant lot. The body will also discuss a text amendment to the Unified Development Code concerning Downtown Historic Districts.

zoninghistoric-preservationhousingunified-development-code
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Aug 12, 2024

Mayor and Council - Regular Meeting

Council to approve $3.95 M settlement for Alpharetta St. property, preserve building

The Roswell City Council will vote on a resolution to settle litigation over 1054 and 1056 Alpharetta Street, authorizing up to $3,950,000 and preserving the historic structure on the site. Other agenda items include approving a $382,452 bridge repair contract, several right‑of‑way agreements for sidewalk improvements, and a $953,550 budget amendment for the Big Creek Parkway Phase 1 project. The meeting also covers grant applications for charging infrastructure and the 2024 Community Development Block Grant.

transportationfinancehistoric-preservationinfrastructuregrantsdevelopment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Aug 6, 2024

Design Review Board - Regular Meeting

Council to approve $3.95 M settlement of Alpharetta St. litigation

The Roswell City Council will vote on a resolution to settle eminent‑domain litigation involving 1054 and 1056 Alpharetta Street for up to $3,950,000 and to preserve the historic structure on the site as an open‑air pavilion. Other agenda items include a bridge‑repair contract for $382,452, an intergovernmental agreement for the Big Creek Parkway Phase 1 project with a $953,550 budget amendment, and right‑of‑way acquisition services for the Riverside Road TSPLOST project up to $350,000. The meeting also covers a conditional use request for a massage establishment at 45 West Crossville Road and a text amendment to the Unified Development Code.

litigationhistoric-preservationtransportationfinancedevelopment
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Aug 1, 2024

Alcoholic Beverage License Board - Public Hearing

Board will consider a new wholesale alcohol license for DVD Cocktails LLC

The Roswell Alcoholic Beverage License Board will hold a public hearing on a new wholesale license application from DVD Cocktails LLC. It will also review an existing business application for limited pouring, beer and wine, and Sunday sales at The Great Greek Mediterranean Grill, 2000 Holcomb Bridge Road, Suite 140. The meeting includes routine agenda items such as approval of minutes and adjournment.

alcoholic-beveragelicensingwholesalerestaurantsroswell-ga
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Aug 1, 2024

Roswell Recreation Commission - Work Session

Commission discusses dual roles for Friends of the Roswell Parks board

The Roswell Recreation Commission is discussing a policy update to allow commission members to concurrently serve as board members for the nonprofit Friends of the Roswell Parks. This arrangement would align officer roles between the two bodies and streamline the oversight of supplemental funding for parks and recreation programs.

parksrecreationnonprofitgovernancepolicy
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Thu Aug 1, 2024

Roswell Recreation Commission - Regular Meeting

Commission votes to approve dual‑role policy for Friends of Roswell Parks

The Roswell Recreation Commission will consider updating its policy to allow members to serve simultaneously on the Friends of the Roswell Parks board. The meeting also includes approval of the June 6 minutes, a review of the capital project list, and scheduling of future work sessions and commission meetings.

recreationparkspolicygovernancemeetingscapital-projects
Adult Recreation Center, 830 Grimes Bridge Road, Roswell, GA 30075
Mon Jul 29, 2024

Mayor and Council - Special Called Meeting

Roswell Mayor and Council hold special meeting on economic development

The Mayor and Council are reviewing an economic development update and discussing real estate acquisition. The meeting includes recognitions for a local veteran and a police detective.

economic-developmentreal-estatecontractspoliceawards
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Mon Jul 29, 2024

Mayor and Council - Open Forum

Council to consider closing discussion on personnel, litigation, and real estate

The Mayor and Council will hold an open forum for public comment. They will consider a City Attorney recommendation to close the agenda item that would discuss personnel matters, litigation issues, and real estate concerns. If adopted, the discussion on those topics would be postponed. The meeting will conclude with adjournment.

public-commentcity-attorneypersonnellitigationreal-estate
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jul 23, 2024

Committees of Council - Com. Dev. and Transportation Regular Meeting

City to approve $382,452 bridge repair contract

The Community Development and Transportation Committee will vote on several transportation items, including accepting right‑of‑way agreements for sidewalk improvements at 415 and 419 Westside Drive and 922 Myrtle Street, which have no financial impact on the city. It will also consider authorizing a $382,452 contract with ED Contracting for bridge repairs on Riverside Road, Oxbo Road, Roxburgh Road culvert and Grimes Bridge Road. Additional items include a blanket right‑of‑way acquisition approval up to $350,000 for the Riverside Road TSPLOST project, signing an intergovernmental agreement for the Big Creek Parkway Phase 1 project, and a resolution to apply for a DOT charging‑infrastructure discretionary grant.

transportationbridgesright-of-waycontractsgrantroads
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075
Mon Jul 22, 2024

Mayor and Council - Regular Meeting

City approves up to $614,565 waterline replacement contract on Maxwell Rd/Rocky Creek Ln

The Roswell Mayor and Council will vote on a contract with Wade Coots Company, Inc. for the Maxwell Road/Rocky Creek Lane waterline replacement project, limited to $614,565. They will also consider applications to accept $92,000 from the GEFA Lead and Service Line Loan Program and to receive the FY2025 National Endowment for the Arts grant for arts projects. Additional agenda items include conditional use requests for massage businesses, a resolution permitting scarecrows in the right‑of‑way, and several community‑development actions such as a small tract request, a site‑plan revision, and adoption of a capital improvement element.

waterline-replacementcontractgrantartszoningdevelopmentpublic-works
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jul 16, 2024

Planning Commission - Regular Meeting

Planning Commission to vote on UDC text amendment for parcels along GA 9/GA 140

The Roswell Planning Commission will consider a text amendment to the Unified Development Code, Article 13, Section 13.4.3, Letter E. The amendment would require any parcel bordering Georgia State Highway 9 or GA 140 east of GA 9 (or Highway 92) to have 51% of its square footage dedicated to non‑residential uses. The commission will also approve the minutes from the June 18, 2024 meeting.

zoningdevelopment-codeplanningland-usetransportation
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Thu Jul 11, 2024

Alcoholic Beverage License Board - Public Hearing

Roswell board to review multiple alcoholic beverage license applications

The Alcoholic Beverage License Board will hold a public hearing to consider several applications for liquor, beer, and wine licenses. These items include new business requests and changes in ownership or licensees for various Roswell establishments.

alcohollicensingbusinesspublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Wed Jul 10, 2024

Historic Preservation Commission - Regular Meeting

Proposed exterior changes and additions for 605 Atlanta Street

The Historic Preservation Commission will review several requests for building modifications. This includes a public hearing regarding a new deck, storefront entrance, and elevator tower at 605 Atlanta Street. The commission will also consider additions to 114 Bulloch Avenue and new construction at 77 Maple Street.

historic-preservationzoningconstructionroswellpublic-hearing
City Hall - Council Chambers, 38 Hill Street, Roswell, GA 30075
Tue Jul 9, 2024

Committees of Council - Public Safety and Public Works Regular Meeting

Roswell considers $614,565 contract for Maxwell Road waterline replacement

The Public Safety and Public Works Committee is reviewing a contract for the Maxwell Road/Rocky Creek Lane Waterline Replacement project. The committee is also considering accepting a $92,000 GEFA loan to reimburse expenses related to lead service line inventory.

waterinfrastructurepublic-worksbudgetutilities
City Hall - Room 220, 38 Hill Street, Roswell, GA 30075