The Boring PartsFederalLocal · USLocal · Canada
Nashville, TN

Nashville public meetings in 2024

1240 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Thu Dec 19, 2024

Continuum of Care Homelessness Planning Council

Housing Opportunities Committee reviews HMIS data and housing models

The Housing Opportunities Committee of the Continuum of Care Homelessness Planning Council is meeting to review HMIS data and discuss a needs assessment focused on housing opportunities for people experiencing homelessness. The agenda includes research questions and a housing models and types spreadsheet, along with other business and next steps. This is a working meeting with no formal votes or public hearings scheduled.

homelessnesshousingdata-reviewneeds-assessmentcontinuum-of-care
Thu Dec 19, 2024

Continuum of Care Homelessness Planning Council

Council to discuss lived experience programming for homelessness

The Continuum of Care Homelessness Planning Council will meet to discuss lived experience programming, with a focus on incorporating perspectives of those who have experienced homelessness. The agenda includes welcome, introductions, and new business, but no specific votes or dollar amounts are listed.

homelessnesscontinuum-of-carelived-experiencenashville
Thu Dec 19, 2024

Metropolitan Council

Budget & Finance Committee HR Working Group meets to discuss department responses

The Human Resources Working Group of the Budget & Finance Committee is meeting to discuss responses from departments to committee questions and determine next steps. The agenda is largely procedural, with no specific votes, ordinances, or financial actions listed.

budgetfinancehuman-resourcesworking-groupprocedural
Thu Dec 19, 2024

Audit Committee

Audit Committee to review Nashville's annual financial report

The Metropolitan Nashville Audit Committee will meet to receive the city's Comprehensive Annual Financial Report for the fiscal year ending June 30, 2024, and consider an amendment to the 2024 Annual Audit Workplan. The agenda also includes approval of prior meeting minutes and discussion of the 2025 meeting schedule. The committee may enter a closed executive session to discuss pending audits or investigations.

auditfinancial-reportbudgetgovernment-oversightnashville
Thu Dec 19, 2024

Wastewater Hearing Authority

FOG enforcement policy up for adoption; board elects chair

The Wastewater Hearing Authority will vote on a new FOG (fats, oils, grease) Management Policy Enforcement Response Guide, hear a semi-annual report, and elect a chairperson and vice chairperson. The meeting also includes approval of prior minutes and annual ethics training.

wastewaterfog-managementpolicyboard-electionethics-training
✓ Decided: Wastewater board approves new FOG enforcement guide

The Wastewater Hearing Authority unanimously approved the new FOG (fats, oils, and grease) Enforcement Response Guide, which updates enforcement for food service establishments and includes a penalty schedule. The board also elected Mr. Tant as Chair and Dr. Wingfield as Vice Chair, and approved the September 19, 2024 meeting minutes. The semi-annual report was presented, noting 52 Significant Industrial Users monitored and 8 in Significant Noncompliance.

Thu Dec 19, 2024

Procurement Standards Board

Procurement board to vote on new small business definition

The Procurement Standards Board is deciding whether to adopt a revised definition of a small business, raising the gross receipts threshold to $10 million and adding a majority-owner control requirement. The board will also consider a reciprocity rule allowing acceptance of certifications from other agencies with substantially matching qualifications.

procurementsmall-businesscertificationregulationsnashville
Thu Dec 19, 2024

Zoning Appeals Board

Board to hear variance for daycare, digital billboard, and other zoning cases

The Metropolitan Board of Zoning Appeals will hear several variance and special exception requests, including a daycare at 200 Brevard Ct, a digital billboard conversion at 2436 Gallatin Pike, and a pole barn at 1633 B Pawnee Trl. Two cases are deferred to future meetings, and one is withdrawn.

zoningvariancesspecial-exceptionsdaycarebillboardspublic-hearing
Wed Dec 18, 2024

Historic Zoning Commission

Historic Zoning Commission to review 10 construction projects in conservation overlays

The Metro Historic Zoning Commission will hold a public hearing on December 18, 2024, to review applications for new construction, additions, and partial demolitions in several neighborhood conservation zoning overlays. Items include a design guideline revision for Inglewood Place and a violation case at 1208 Shelton Ave. Two applications have been withdrawn and two deferred to January 2025.

historic-zoningconstruction-permitsneighborhood-conservationpublic-hearingdesign-guidelines
✓ Decided: Commission approves amended SP for 930 McFerrin Ave, adds 905 W Eastland

The Metro Historic Zoning Commission approved an amended specific plan (SP) for 930 McFerrin Ave to include 905 West Eastland Ave, with conditions on setbacks and future material reviews. The commission also approved several new construction and addition projects in historic overlays, each with conditions. A proposed revision to the Inglewood Place design guidelines was deferred to the January 15, 2025 public hearing.

Wed Dec 18, 2024

Short Term Rental Appeals Board

Appeal to re-establish short-term rental at 2688 Miami Ave denied

The board denied Craig O'Shoney's appeal to re-establish a short-term rental at 2688 Miami Ave, finding the Zoning Administrator did not err in denying the permit based on residency. The appellant may reapply for a short-term rental permit after June 18, 2025.

short-term-rentalappeals-boardzoningpermit-denialnashville
Wed Dec 18, 2024

Beer Permit Board

Beer Permit Board to vote on 11 new permits and 4 deferrals

The Beer Permit Board will consider 11 applications for new or transferred beer permits, including off-sale locations, on-sale establishments, a caterer, and a special event for New Year's Eve. Four additional applications are proposed for indefinite deferral due to missing documents. The meeting also includes approval of prior minutes and public comment.

beer-permitsalcohol-licensingpublic-hearingnashvillespecial-events
✓ Decided: Beer board approves 11 permits, defers 4 for missing documents

The Metro Beer Permit Board approved all 11 applications on the agenda, covering new locations, ownership changes, and special events, with no opposition. Four applications were deferred indefinitely due to missing documents. No public comments were made, and the meeting adjourned after about four minutes.

Tue Dec 17, 2024 · 6:30 PM

Metropolitan Council

Council considers issuing up to $527.17 million in general obligation bonds

The Metropolitan Council will vote on several board appointments and proposed amendments to its rules of procedure. The body is also reviewing beer permit exemptions for five businesses and various government contracts and agreements.

bondsalcohol-permitshousingappointmentsgovernment-operations
✓ Decided: Council approves $527M bond issuance and 35-item consent agenda

The Metropolitan Council approved a resolution to issue up to $527,170,000 in general obligation bonds (35-0-2). It also adopted a 35-item consent agenda covering contracts, grants, zoning changes, and property matters. Several beer permit exemptions were approved, and one was deferred. Two rule amendments were deferred to February 2025.

Metropolitan Courthouse
Tue Dec 17, 2024

Metropolitan Council

Committee to vote on beer permits for 5 businesses and police hate-group policy

The Government Operations and Regulations Committee will vote on resolutions to exempt five businesses from minimum distance requirements for beer permits. The committee will also discuss a resolution requesting review of police and fire personnel policies on hate groups and misuse of water cannons.

beer-permitspolicepublic-safetyalcohol-regulationhate-groupsfire-departmentcommittee-meeting
Tue Dec 17, 2024

Metropolitan Council

Council committee to consider rule changes and board appointments

The Rules, Confirmations, and Public Elections Committee is meeting to consider several board and commission appointments, including reappointments to the Mechanical, Plumbing, and Electrical Examiners and Appeals Board and the Transportation and Licensing Commission. The committee will also discuss proposed amendments to Council Rules 12 and 53.2, which would limit honorary resolutions and presentations and require a 30-day delay for rule changes. Additionally, the agenda includes several honorary resolutions recognizing individuals and organizations.

rules-committeeboard-appointmentsrule-changeshonorary-resolutionstransportationpublic-health
Tue Dec 17, 2024

Nashville Health and Well-being Leadership Council

Council to adopt 2025 health assessment strategic issues

The Nashville Health & Well-being Leadership Council will vote on adopting strategic issues for the 2025 Community Health Assessment and on updates to the 2023-2025 Community Health Improvement Plan (CHIP). The meeting also includes workgroup reports on economic opportunity and job skill development.

healthcommunity-assessmentstrategic-planningworkgroupsnashville
✓ Decided: Council adopts strategic issues for 2026-2028 community health plan

The Nashville Health & Well-being Leadership Council approved the slate of strategic issues for the 2026-2028 Community Health Improvement Plan (CHIP), including Housing, Economic Opportunity & Job Skill Development, Food Access/Food Insecurity, Awareness & Navigation of Community Resources, and Equity as an overarching issue. The council also approved the 2025 CHIP workgroup report calendar and the use of the 2023-2025 CHIP Monitoring and Evaluation Guide for updates. Revisions to the Awareness & Navigation and Equity objectives were approved, with equity strategy realignment to be reviewed by the Health Equity Coalition and presented by March 18. The council discussed developing a communication plan to engage Metro Council and the Mayor's office, with an outline expected in January.

Tue Dec 17, 2024

Metropolitan Council

Committee to vote on Parthenon grant and USBR 80 bike route

The Arts, Parks, Libraries & Entertainment Committee will consider two resolutions: accepting an in-kind grant from the Centennial Park Conservancy for Parthenon improvements, and designating United States Bicycle Route 80 through Nashville. A presentation on the Greater Nashville Music Census is also scheduled.

parksbicyclingtransportationmusicgrantspublic-hearing
Tue Dec 17, 2024

Metropolitan Council

Council committee to vote on 20 health, safety, and police items

The Public Health and Safety Committee will consider 20 resolutions, including contracts and grants for health programs, a fire department software contract, a school resource officer grant, and a request for police and fire department policy reviews on hate groups and water cannons. The meeting includes public comment and updates from the PAL program and departments.

public-healthpolicefire-departmentgrantscontractsschool-safetypolicy-review
Mon Dec 16, 2024

Metropolitan Council

Solid Waste Subcommittee to discuss new waste services division

The Solid Waste Subcommittee of the Transportation & Infrastructure Committee will meet to discuss committee goals, determine the meeting schedule, and receive an update from Director Tracey Thurman on the new Waste Services Division. No votes or binding decisions are scheduled.

transportationinfrastructuresolid-wastewaste-servicescommittee-meeting
Mon Dec 16, 2024

Bicycle and Pedestrian Advisory Commission

BPAC submits first annual report with 2025 infrastructure recommendations

The Nashville Bicycle and Pedestrian Advisory Commission (BPAC) is presenting its first annual report, summarizing its 2024 activities and outlining recommendations for 2025. The report highlights completed infrastructure projects, goals for the coming year, and specific requests to Metro Council and NDOT, including increased funding for sidewalks and bikeways and the use of hardened protection for bike lanes.

bicyclingpedestrianinfrastructuresafetytransportationannual-reportnashville
✓ Decided: BPAC approves annual report letter to Mayor's Office

The Bicycle and Pedestrian Advisory Commission approved a letter for its Annual Report to the Mayor's Office, with discussion on Spanish translation and public posting. The commission also reviewed updates on the East Bank Boulevard project, Connect Downtown plan, and the NDOT Tactical Urbanism program, but took no other formal votes. The next meeting was rescheduled from January 20 due to the MLK Day holiday.

Mon Dec 16, 2024

Historical Commission

Historical Commission to vote on marker for First Masonic Hall

The Metropolitan Historical Commission will vote on approving a historical marker for the First Masonic Hall, a privately funded project. The meeting also includes a guest speaker from Historic Nashville, Inc., a report on an Indigenous Archaeology Tour, and updates on historic zoning.

historical-commissionhistorical-markershistoric-preservationpublic-hearingnashville
✓ Decided: Historical Commission approves First Masonic Hall marker

The Metropolitan Historical Commission unanimously approved the placement of a historical marker for the First Masonic Hall along the 400-block of Church Street. The commission also heard presentations on Historic Nashville, Inc.'s preservation work and the archaeology of Indigenous Nashville, and discussed marker funding and zoning updates. No public comments were made.

Mon Dec 16, 2024

Investment Committee

Investment Committee to review pension performance and 2025 private markets plan

The Investment Committee of the Metropolitan Employee Benefit System will meet to consider several items, including an operational update, the 2025 Private Markets Investment Plan, third-quarter 2024 pension performance, investment recommendations, and a 457b performance report with annual fee review. The meeting includes a public comment period and approval of prior minutes.

pensioninvestmentperformancefeesprivate-markets
✓ Decided: Investment Committee approves terminating Oaktree Emerging Markets Fund

The committee unanimously approved Meketa's recommendation to terminate the Oaktree Emerging Markets Fund and reallocate its funding equally to RBC Emerging Markets and an EAFE index fund. The committee also noted that the previously approved $30 million commitment to Sound Mark's closed-end fund is no longer valid because Sound Mark liquidated its open-end fund and failed to raise the required additional commitments. The 2025 Private Markets Investment Plan was reviewed, and the 457b fee and performance reports were presented with no recommended changes.

Mon Dec 16, 2024

Metropolitan Council

Transportation committee to vote on Granny White Pike repaving, Nolensville Pike signals, and bike route

The Transportation and Infrastructure Committee will consider eight resolutions and two bills on second reading. Key items include approving a TDOT agreement for repaving 5.26 miles of Granny White Pike, maintaining traffic control devices on Nolensville Pike, designating US Bicycle Route 80 through Nashville, and accepting a $25,000 donation for the Pie Town Mobility Study. The committee will also vote on a sidewalk construction agreement at 1401 Gallatin Pike North and a lead service line inventory grant.

transportationinfrastructureroadsbicycle-routessidewalksgrantspublic-works
Mon Dec 16, 2024

Metropolitan Council

Committee to consider $527M bond issuance and dozens of grants

The Budget and Finance Committee will consider a resolution to issue up to $527,170,000 in general obligation bonds, along with a consent agenda of over 30 items including contracts, grants, and agreements. Most items are routine approvals for funding, services, and property matters.

budgetbondsgrantshousingtransportationpublic-healthsettlement
Mon Dec 16, 2024

Community Review Board

Community Review Board to discuss sexual misconduct policy, 2025 goals, and officer-involved shooting resolution

The Nashville Community Review Board is holding its December monthly meeting. The board will discuss several items, including an update on the sexual misconduct policy, 2025 initiatives and goals, a resolution regarding officer-involved shootings, and the FY 25 budget. Public comment is also scheduled.

community-review-boardpolice-oversightsexual-misconduct-policybudgetofficer-involved-shootings
✓ Decided: CRB elects Walter Holloway as new Chair for 2025

The Community Review Board held its final 2024 meeting, approving minutes and the Executive Director's report unanimously. The board elected new officers for 2025: Walter Holloway as Chair, Joe Brown as 1st Vice-Chair, Walter Searcy as 2nd Vice-Chair, and Heather Meshell as Secretary. The board also unanimously approved a bylaw amendment to move officer elections to December 31, with officers taking seats in January. Chair Alisha Haddock announced she would not seek reappointment.

Mon Dec 16, 2024

Metropolitan Council

Joint committee to discuss Resolution RS2024-922

The joint Budget and Finance and Public Health and Safety committees are meeting to discuss Resolution No. RS2024-922, as referenced in Resolution No. RS2024-799. The agenda contains only this single discussion item, with no other business listed.

budgetpublic-safetyresolutioncommittee-meeting
Mon Dec 16, 2024

Metropolitan Council

Planning & Zoning Committee to vote on 22 items including rezonings, road repairs, and housing

The Planning and Zoning Committee will consider 22 items, including resolutions for a lease agreement with Liberty Collegiate Academy, a PILOT agreement for the Whispering Oaks multi-family housing project, and intergovernmental agreements for road repairs on Granny White Pike and traffic signal improvements on Nolensville Pike. The committee will also vote on several zoning changes, including a mixed-use development at 12th Avenue South and a 254-unit multi-family project at 858 West Trinity Lane.

zoninghousingroadspublic-transitpedestrian-safetydevelopmentplanning
Thu Dec 12, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission to vote on code amendments, production directory

The Nashville Music, Film and Entertainment Commission will meet Dec. 12 to discuss and potentially vote on recommended code amendments, a production directory, and AFCI membership, along with updates on the executive director hiring process and downtown parking for musicians. The agenda is largely procedural with several action items.

entertainmentmusicfilmcommissioncode-amendmentsparkinghiring
✓ Decided: Commission approves code change adding intimacy coordinators to entertainment occupations

The Nashville Music, Film, and Entertainment Commission unanimously approved a motion to recommend a code amendment to Metro Council that would add 'intimacy coordinators' to the list of entertainment industry occupations. The commission also moved its regular meetings to the third Wednesday of each month at 9:00 AM. No other substantive decisions were made; several items were deferred to future meetings.

Thu Dec 12, 2024

Nashville Entertainment Commission

Budget Committee to review prior fiscal year budget and process

The Nashville Music, Film, and Entertainment Commission Budget Committee is meeting to review the prior fiscal year's budget and process. The agenda includes a public comment period and scheduling of the next meeting. No new business items are listed.

budgetentertainmentcommissionnashville
✓ Decided: Budget committee begins FY2026 planning, sets data-gathering tasks

The Nashville Entertainment Commission's Budget Committee met to begin work on the FY2026 budget proposal. Members were assigned initial tasks, including reviewing the code, determining how to spend the current budget, and reading the Reel Scout. Max Butler will meet with Councilmembers Porterfield and Gadd as part of the planning process. No formal decisions were made; the meeting was procedural.

Thu Dec 12, 2024

Transportation Licensing Commission

Commission to vote on new wrecker, towing, and passenger vehicle licenses

The Transportation Licensing Commission will consider consent items including new company applications for wrecker/towing services and other passenger vehicles for hire, as well as ownership modifications for existing companies. A deferred application for Breedlove Transportation will also be reviewed. The meeting includes public comment and approval of previous minutes.

transportationlicensingtowingpassenger-vehiclespublic-hearing
✓ Decided: Breedlove Transportation OPVH application approved after hearing

The Commission approved Breedlove Transportation's new OPVH company application after a hearing, despite a failed motion to defer. Several towing and passenger vehicle applications were also approved. The meeting was otherwise routine.

Thu Dec 12, 2024

Planning Commission

Planning Commission to vote on 4 consent items, defer 20 others

The Planning Commission will consider a revised agenda with 44 items, including a housing and infrastructure study briefing. Most substantive items are recommended for deferral to future meetings. Four items are on the consent agenda for a single vote, and several others are tentative consent items that may be heard individually if opposed.

zoninghousingcommunity-planrezoningmulti-familyplanning-commissionpublic-hearing
✓ Decided: Planning Commission approves 350-unit apartment complex on Herron Drive

The Metro Planning Commission approved several rezoning and development requests, including a 350-unit multi-family development at 361 Herron Drive and a 170-unit development at 3848/3854 Abernathy Road. The commission also approved the Madison Community Plan amendment to allow residential development on Atlantic Avenue and Plum Street, and approved a two-story overlay for parts of Bordeaux with a substitute ordinance. Many other items were deferred to future meetings.

🏢 Building at this address: Christie Cookie Co
Thu Dec 12, 2024

Community Corrections Advisory Board

Community Corrections Board to review 1st quarter stats and grant proposal

The Davidson County Community Corrections Advisory Board will adopt minutes from July, review first-quarter statistics, hear a grant proposal update, and discuss personnel changes including two new hires. The board will also address new business and public comments.

community-correctionsadvisory-boardpersonnelgrantstatisticsdrug-court
Thu Dec 12, 2024

Health Board

Board approves new Director of Health contract, contingent on Metro Council

The Board approved a Director of Health contract with compensation set in Section 3, contingent on Metro Council approval. The proposed start date is February 3, 2025. The Board also approved several grants and contracts, including a $843,396 CDC grant and a $250,000 family planning grant. An update on the electronic health record system indicated a February 25, 2025 go-live date.

health-boarddirector-contractgrantselectronic-health-recordpublic-health
✓ Decided: Board approves Director of Health contract, contingent on Metro Council

The Board unanimously approved the Director of Health contract, fixing compensation as set out in Section 3, with approval contingent on Metro Council's approval. The Board also unanimously approved a $20,000 Tennessee Child Safety Fund grant application and five grants/contracts, including a CDC infrastructure grant of $843,396. No other substantive decisions were made; the meeting included routine approvals and reports.

Thu Dec 12, 2024

Auditorium Commission

Auditorium Commission holds specially called meeting

The Metropolitan Auditorium Commission is holding a specially called meeting on December 12, 2024. The agenda includes only procedural items such as public comment and standard opening statements. No substantive decisions or discussions are listed.

auditoriumcommissionmeetingprocedural
Thu Dec 12, 2024

Continuum of Care Homelessness Planning Council

Youth Action Board discusses Point-in-Time Count and youth data

The Youth Action Board is meeting to discuss the Youth Point-in-Time Count and youth data and research. The agenda includes updates, new business, and other business items.

homelessnessyouthpoint-in-time-countdatameeting
Thu Dec 12, 2024

Metropolitan Council

Immigrant Caucus discusses emerging needs in immigration services

The Nashville Metropolitan Council's Immigrant Caucus is meeting to discuss emerging needs in immigration services and hold an open discussion. The agenda includes welcome, minutes, and adjournment.

immigrationcommunity-servicescouncil-meeting
Thu Dec 12, 2024

Metropolitan Council

HR working group discusses department responses, next steps

The Human Resources Working Group of the Budget & Finance Committee is meeting to discuss department responses to committee questions and determine next steps. The agenda is procedural with no specific decisions or proposals listed.

budgetfinancehuman-resourcesmetropolitan-councilnashville
Thu Dec 12, 2024

Nashville Entertainment Commission

Commission to discuss potential bylaw changes

The Nashville Music, Film, and Entertainment Commission's Bylaws Committee will meet to discuss potential changes to its bylaws as recommended by the commission. This is listed as an action item, meaning the committee may vote on proposed changes. The meeting also includes a public comment period and scheduling of the next committee meeting.

bylawsentertainmentcommissionnashville
Thu Dec 12, 2024

Continuum of Care Homelessness Planning Council

Homelessness council reviews goals; affordable housing and outreach off track

The SWOP Committee of the Continuum of Care Homelessness Planning Council is reviewing current goals and metrics. Several goals are off track, including increasing affordable housing capacity, establishing efficient communication with HPC/Comms/CoC, and identifying outreach capacity. The committee will also discuss winter preparations and the landscape of street outreach.

homelessnessaffordable-housingoutreachwinter-preparationsgoals-reviewnashville
Wed Dec 11, 2024

Greenways and Open Space Commission

Greenways commission to review capital budget, new officers, and 2025 goals

The Greenways and Open Space Commission will consider October meeting minutes, hear public comments, and receive updates on the transit referendum, new greenway police officers, and the capital budget. They will also review the Plan to Play initiative, annual recap of greenway projects, open space easements, and inter-agency partnerships, and discuss goals for 2025.

greenwaysopen-spaceparkscapital-budgetpoliceplan-to-playtransit
Wed Dec 11, 2024

Industrial Development Board

Board to consider revenue bonds for two affordable housing projects

The Industrial Development Board will consider inducement of revenue bonds for two affordable housing projects: Nashville Leased Housing V at 865 W Trinity Lane and Nashville Leased Housing VI on Buena Vista Pike. The board will also discuss a joinder for RHP Hotels regarding stormwater control measures and review old business on the TSU student housing project.

industrial-development-boardaffordable-housingrevenue-bondsstormwaterstudent-housing
✓ Decided: Board approves $48M bond inducements for two affordable housing projects

The Industrial Development Board approved inducement resolutions for revenue bonds up to $48 million each for two affordable housing projects by Dominium: one at 865 W Trinity Lane (227 units, all affordable) and one on Buena Vista Pike (all affordable). The board also approved a joinder for Ryman Hospitality stormwater control measures and deferred approval of the October 9th minutes. The TSU student housing bond application was withdrawn.

Wed Dec 11, 2024

Industrial Development Board

Industrial Development Board Ad Hoc Committee meets to discuss affordable housing research

The Industrial Development Board Ad Hoc Committee will meet on December 11, 2024. The agenda includes a discussion regarding affordable housing research.

housingaffordable-housingresearch
Wed Dec 11, 2024

Sustainability Advisory Committee

Sustainability Committee reviews Nissan Stadium green design and East Bank resilience plans

The committee is discussing sustainability and resilience strategies for the new Nissan Stadium and the East Bank development, including flood mitigation, stormwater management, and brownfield cleanup. They also received updates on Metro's proposed capital spending plan for solar, safety, and parks investments, and a school food scraps pilot program.

sustainabilitystadiumeast-bankflood-mitigationstormwaterbrownfieldcapital-spendingschool-pilot
Wed Dec 11, 2024

Continuum of Care Homelessness Planning Council

HPC discusses HMIS policy changes and outdoor homelessness strategy revisions

The Homelessness Planning Council reviewed proposed revisions to the HMIS Policies and Procedures Manual, including removing background check requirements for end users, and discussed updates to the Outdoor Homelessness Strategy focused on implementation and coordination. The council also received updates on cold weather shelter preparations, ARPA fund spending, and October homelessness data showing 3,290 people experiencing homelessness and 184 housed.

homelessnesshmiscold-weather-shelterarpa-fundshousingoutdoor-homelessness-strategydata
Wed Dec 11, 2024

Community Review Board

CRB executive committee to discuss sexual misconduct policy and 2025 goals

The Community Review Board's executive committee is meeting to discuss several policy and planning items, including a sexual misconduct policy, Department of Justice training, budget specifications, 2025 initiatives, and a resolution on officer-involved shootings. These are discussion items only; no votes are listed on the agenda. The meeting includes a public comment period.

community-review-boardpolice-oversightpolicytrainingbudgetpublic-safety
Wed Dec 11, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board to elect 2025 officers and consider canceling Christmas meeting

The board will meet to approve minutes, review entertainer permits and business licenses from August through December 2024, hear the inspector's report, elect officers for 2025, and discuss canceling the December 25, 2024 meeting due to the Christmas holiday.

sexually-oriented-business-licensingpermitslicenseselectionsholiday-schedule
Tue Dec 10, 2024

Public Library Board

Library board to discuss anti-bullying policy and retreat priorities

The Nashville Public Library Board of Trustees will meet to discuss an anti-bullying policy, a resolution (2024-05), and follow-up priorities from a recent retreat. The meeting includes public comment on actionable items, approval of minutes, and reports from the interim director and foundation.

librarypolicyanti-bullyingboard-meetingnashville
✓ Decided: Library Board approves anti-bullying policy, hears funding updates

The Nashville Public Library Board unanimously approved a new Anti-Bullying Policy (Resolution 2024-05) defining harassment and bullying for patrons, volunteers, and staff. The board also approved minutes from October and November meetings. The interim director reported on NECAT hour changes, a $2 million collection fund allocation, and parking plans for Main Library staff. No other formal votes were taken.

Tue Dec 10, 2024

Metro Development and Housing Agency Board

Board to vote on PILOT deal for Autumn Lake and redevelopment plan amendment

The Metro Development and Housing Agency Board will consider a PILOT (payment in lieu of taxes) agreement for Autumn Lake and an amendment to the Phillips Jackson Redevelopment Plan. The meeting also includes approval of prior minutes, public comments, and committee reports.

housingdevelopmentpilotsredevelopmentnashville
Tue Dec 10, 2024

Metro Development and Housing Agency Board

MDHA Housing Committee to hear grants and partnerships presentation

The Housing and Community Committee of the Metropolitan Development and Housing Agency will meet to hear a presentation titled 'Creating Opportunities Through Grants and Partnerships.' The meeting also includes approval of prior minutes and public comments.

housinggrantspartnershipsmdhanashville
Tue Dec 10, 2024

Metro Development and Housing Agency Board

MDHA board to vote on Autumn Lake PILOT agreement

The Metro Development and Housing Agency Finance and Development Committee will consider a PILOT agreement for Autumn Lake, a design contract for Park Point East, and a 2024 HOPWA award. A presentation on the Property Disposition Policy is also scheduled.

housingpilotsdevelopmentcontractspublic-health
Tue Dec 10, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup to review federal benchmarks for ending veteran homelessness

The Continuum of Care Veterans Workgroup will meet to review minutes, data from OHS and MDHA, and continue work on USICH Federal Criteria and Benchmarks for Ending Veteran Homelessness. The meeting also includes Built for Zero updates, agency updates, and a chair transition. No votes or decisions are scheduled.

homelessnessveteranscontinuum-of-caredata-reviewbenchmarkschair-transition
Tue Dec 10, 2024

Fair Commissioners Board

Fair Commissioners Board reviews $89.5M in capital projects at fairgrounds

The board is reviewing the status of multiple capital improvement projects at the fairgrounds, including the new Exposition Center, Fair Park Phase 2, and infrastructure work. The agenda consists entirely of project budget updates with no new decisions or public hearings scheduled.

capital-improvementsfairgroundsbudgetconstructionparks
✓ Decided: Board approves November minutes, discusses strategic plan updates

The Board of Fair Commissioners approved the November meeting minutes unanimously. Members discussed updating the mission statement and making the strategic plan more specific with measurable benchmarks, but no formal action was taken on these items. The meeting was otherwise procedural, with no new business.

Tue Dec 10, 2024

Farmers Market Board

Nashville Farmers' Market Board meeting scheduled for December 10, 2024

The Board will review the November 2024 meeting minutes and consider a lease amendment for A & M Marketplace. The agenda also includes a business presentation from Roll Academy and reports on finances and executive operations.

farmers-marketleasesfinancegovernment-business
Tue Dec 10, 2024

Audit Committee

Audit committee to review Fire Dept fleet maintenance and Agricultural Extension audits

The Metropolitan Nashville Audit Committee will discuss two completed audits: the Davidson County Agricultural Extension Office (Oct 17, 2024) and the Nashville Fire Department Fleet Maintenance and Operations (Nov 14, 2024). They will also tentatively discuss the Justice Integration Services 2024 IT audit, consider amending the 2024 Annual Audit Workplan, and conduct the annual review of committee and internal audit bylaws. The meeting includes public comment, approval of prior minutes, and an executive session on the FY2024 financial statement audit.

auditfire-departmentagricultural-extensioninformation-technologybudgetstaffingbylaws
Tue Dec 10, 2024

Civil Service Commission

Civil Service Commission to consider extending injury leave for DCSO employee

The commission will discuss and possibly vote on a request from DCSO employee James LeMaster to extend his Injury On Duty (IOD) time under Civil Service Rule 4.8 D. This is the only substantive item on the late-item agenda.

civil-serviceinjury-on-dutypersonneldcso
Tue Dec 10, 2024

Fire and Building Code Appeals Board

Board hears six appeals on building code variances

The Fire and Building Code Appeals Board will hear six appeals from property owners seeking variances from the 2018 International Building Code. Cases involve parking garage clearance, church ramp dimensions, office ceiling height, stair construction materials, sprinkler system deactivation, and fire safety alternatives. The board will also take public comment and approve previous meeting minutes.

building-codesfire-safetyvariancespublic-hearingnashville
✓ Decided: Board approves 6 of 6 building code appeals, including parking garage variance

The Nashville Fire and Building Code Appeals Board approved all six appeal cases on the agenda, with one approval conditioned on stipulations and one member recusing from two cases. The board granted variances for a parking garage ceiling height, a church ramp, an office ceiling height, wood stairs in a podium building, sprinkler deactivation, and an alternative to a sprinkler system. All votes were 8-0 or 7-1, with one recusal.

Mon Dec 9, 2024

Metropolitan Council

Non-profit funding process working group meets to set guidelines

The Budget & Finance Committee's Non-Profit Funding Process Working Group is discussing how to create an open and transparent process for funding non-profits that provide services Metro needs. They are considering a central information hub, a website, and clear accountability measures. The group aims to align with Metro's budget timeline and provide guidance to the Council.

budgetfinancenon-profitfundingtransparencyaccountabilitygrants
Mon Dec 9, 2024

Traffic and Parking Commission

Commission to vote on new traffic signal, all-way stops, and speed limit reduction

The Traffic and Parking Commission will consider several traffic safety measures, including new all-way stops at two intersections with high crash rates, a new traffic signal at White Bridge Road and Lions Head Village, and a reduction of the speed limit on Lebanon Pike to 35 mph. The commission will also hear an appeal of a denied driveway connection for a proposed 16-unit development at 2311 Whites Creek Pike.

traffic-safetytraffic-signalsspeed-limitsdevelopmentpublic-hearing
✓ Decided: Commission approves Lebanon Pike speed reduction to 40 mph

The Traffic and Parking Commission approved a revised speed limit reduction on Lebanon Pike from 40/45 mph to 40 mph between Donelson Pike and the Wilson County line, with a report due in 4 months. They also approved several traffic control changes, deferred a driveway appeal for two months, and set the January meeting at 2:30 PM.

Mon Dec 9, 2024

Health and Educational Facilities Board

Board to consider $65M bond amendment for Madison Station housing project

The Health and Educational Facilities Board will vote on amendments to bond approvals for two housing projects and grant preliminary approval for a third, including a public hearing. The board will also elect a secretary and receive reports on existing debt obligations.

housingbondspublic-hearingfinancehealth-facilitieseducation-facilities
Mon Dec 9, 2024

Hospital Authority Board

Hospital board to evaluate CEO performance and contract

The Metropolitan Hospital Authority Board of Trustees will meet to discuss and approve CEO performance goals for FY24 and FY25, and review the CEO contract expiring June 30, 2025. The meeting includes public comment and approval of prior meeting minutes.

hospital-authorityceo-evaluationcontract-reviewpublic-comment
Mon Dec 9, 2024

Metropolitan Council

Minority Caucus discusses traffic enforcement and resolution RS2024-905

The Metropolitan Council Minority Caucus is meeting to discuss old and new business, including an annual reception update, boards and commissions, and a legislative update. A key item is a discussion of traffic enforcement and resolution RS2024-905.

minority-caucustraffic-enforcementlegislationboards-and-commissionsannual-reception
Fri Dec 6, 2024

Continuum of Care Homelessness Planning Council

Subcommittee plans annual homeless count methodology and logistics

The Point-in-Time Count Subcommittee of the Continuum of Care Homelessness Planning Council is meeting to plan the annual homeless count. The agenda includes reviewing HUD methodology, volunteer recruitment, team assignments, zones, data collection, and youth count strategies. No decisions are recorded; the meeting is a planning discussion.

homelessnesspoint-in-time-countplanningvolunteersdata-collectionnashville
Fri Dec 6, 2024

Continuum of Care Homelessness Planning Council

Committee to map council membership and plan 2025 meetings

The Nominating & Membership Committee will discuss mapping Homelessness Planning Council membership, member orientation and training, recruitment, and scheduling 2025 general membership meetings. The agenda is largely procedural with no specific votes or funding decisions listed.

homelessnesscontinuum-of-carecommittee-meetingmembershipplanning
Fri Dec 6, 2024

Continuum of Care Homelessness Planning Council

Council discusses Consumer Advisory Board and member orientation

The Continuum of Care Homelessness Planning Council's Lived Experience Programming Committee will meet to discuss the Consumer Advisory Board cohort and orientation of members. The agenda includes welcome, introductions, new business, and other business. No votes or decisions are listed.

homelessnessadvisory-boardcommunity-meetingnashville
Thu Dec 5, 2024

Metro Action

Metro Action Commission to vote on $5.9M LIHEAP grant and other contracts

The board will consider approving a $5.9 million LIHEAP grant for energy assistance, a contract amendment, and an SEIU MOU extension. They will also vote on job description changes and organizational restructuring. The meeting includes reports on programs like early education and workforce development.

grantscontractsenergy-assistanceliheapcsbgseiuorganizational-restructure
✓ Decided: Board approves $5.9M LIHEAP grant and other funding items

The Metropolitan Action Commission Board approved the September 2024 finance reports, a $5.9 million LIHEAP grant and amendments, a CSBG amendment, an SEIU MOU extension, and a revised Finance Officer I job description. The board also appointed Justin Singleton as Treasurer and welcomed new member Parv Santhosh-Kumar. No other substantive decisions were made.

Thu Dec 5, 2024

Arts Commission

Arts Commission to decide on Thrive Awards grant implementation and funding amounts

The Arts Commission Grants + Funding Committee will discuss and take action on the implementation of Metro Arts Thrive Awards, including staff recommendations and grant funding amounts. They will also consider fiscal agents and additional grant cycle items for FY25. The meeting includes a public comment period for Davidson County residents.

artsgrantsfundingpublic-commentnashville
Thu Dec 5, 2024

Arts Commission

Arts Commission sets eligibility rules for 2024-25 Operating Support Grants

The Arts Commission is presenting the eligibility criteria for its Operating Support Grants, which fund general operations of arts-focused nonprofits in Nashville. The agenda outlines requirements such as 501(c)(3) status, a Nashville address, and an IRS exemption date of January 15, 2024 or earlier, plus a list of ineligible organization types. This is a criteria document, not a decision item, so the commission is likely reviewing or discussing these rules at the meeting.

artsgrantsnonprofitsfundingeligibility
Thu Dec 5, 2024

Beer Permit Board

Beer board to vote on 8 new permits, 6 deferrals, and 7 fines for underage sales

The Metro Beer Permit Board will consider eight applications for new or transferred beer permits, including new locations and ownership changes. Six applications are proposed for indefinite deferral due to missing documents. The board will also hear seven complaints alleging underage beer sales, with staff recommending civil penalties ranging from $1,500 to $3,000.

beer-permitsalcohol-regulationpublic-hearingfinesnashville
✓ Decided: Beer board grants 8 permits, defers 6, issues 7 citations

The Metro Beer Permit Board approved all eight on-sale and off-sale beer permit applications on the agenda, including new locations, changes of ownership, and a special event. Six applications were deferred indefinitely due to missing documents. The board also issued civil penalties for seven alleged violations, ranging from $1,500 to $3,000, as recommended by staff.

Thu Dec 5, 2024

Zoning Appeals Board

Board to hear 11 zoning appeals including digital billboard and residential projects

The Metropolitan Board of Zoning Appeals will hear 11 cases at its December 5, 2024 meeting. Items include requests for variances, special exceptions, and an appeal of a permit denial. Two cases have been deferred to a later meeting and one has been withdrawn.

zoningvariancesspecial-exceptionsbillboardsresidentialfencesappeals
Thu Dec 5, 2024

Behavioral Health and Wellness Advisory Council

Behavioral Health Council to review bylaws and hear juvenile justice update

The Behavioral Health and Wellness Advisory Council will meet to approve November minutes, hear a presentation on juvenile justice and the Nashville Youth Campus for Empowerment, receive a wrap-up of the council's history, and review its bylaws. The meeting is largely procedural with informational presentations.

behavioral-healthjuvenile-justicebylawsyouthnashville
Thu Dec 5, 2024

Stormwater Management Commission

Stormwater Commission to hear floodway buffer variance for Estes Road home

The Stormwater Management Commission will hear a case for floodway buffer disturbances at 3702 B Estes Road to build a home and pool. The board will also discuss proposed regulations and compensatory mitigation with Metro Water Services and Legal.

stormwaterfloodway bufferzoningwater-servicesnashville
Thu Dec 5, 2024

Sports Authority Board

Sports Authority to vote on bond amendment for MLS stadium project

The Sports Authority Board will consider approving a resolution to amend the trust indenture and lease agreement related to the 2021 bonds for the MLS stadium project. The board will also receive updates on stadium construction, Titans DBE participation, and First Horizon Ballpark operations.

sports-authoritystadiumbondsmls-projectaudittitansfirst-horizon-ballpark
Thu Dec 5, 2024

Sports Authority Board

Finance committee to vote on bond amendment for MLS stadium project

The Sports Authority Finance Committee will consider approving amendments to the trust indenture and lease agreement related to the 2021 bonds for the MLS stadium project. The committee will also receive a Metro Internal Audit on stadium construction and vote on the September 12 meeting minutes.

sports-authorityfinance-committeemls-stadiumbondsauditnashville
Wed Dec 4, 2024

Continuum of Care Homelessness Planning Council

Coordinated Entry Oversight Committee to review policies and procedures manual

The Coordinated Entry Oversight Committee of the Nashville/Davidson County Continuum of Care will meet to review the Coordinated Entry Policies & Procedures Manual. The meeting includes a values and equity statement, introductions, and discussion of other business and next steps.

homelessnesscoordinated-entrypoliciesoversightnashville
Tue Dec 3, 2024 · 6:30 PM

Metropolitan Council

Council to vote on new definitions for bar/nightclub, beer market

The Metropolitan Council will hold public hearings and vote on several zoning changes, including a new definition for 'bar or nightclub' and amendments to 'beer and cigarette market' definitions. They will also consider a beer permit exemption for Little Hats Italian Market and multiple rezoning and development plan amendments. Additionally, the Council will elect board members and confirm appointments to various boards and commissions.

zoningbeerappointmentsplanningredevelopmenthousingpublic-hearing
Metropolitan Courthouse
Tue Dec 3, 2024

Continuum of Care Homelessness Planning Council

CE Oversight Committee meets to discuss governance and trainings

This is a procedural meeting of the CE Oversight Committee, with agenda items including a welcome, roll call, a values statement, review of committee description, standardized trainings, and new/other business. No specific decisions or proposals are listed.

homelessnessoversightgovernancetrainings
Tue Dec 3, 2024

Metropolitan Council

Public Health and Safety Committee to vote on grants for juvenile mental health, police software, and a resolution urging more traffic enforcement

The committee will consider five resolutions, including a state grant for juvenile court mental health and gang intervention, a Kresge Foundation grant for the Metro Action Commission, a contract with Versaterm for public safety software, a sole-source contract with Intergraph for police records management, and a resolution urging increased traffic enforcement. The agenda also includes an update from Partners in Care and a chair report.

public-safetygrantsjuvenile-justicepolicesoftware-contractstraffic-enforcement
Tue Dec 3, 2024

Employee Benefit Board

Employee Benefit Board to elect 2025 chair and vice chair

The Metropolitan Employee Benefit Board will elect a new chair and vice chair for 2025, consider virtual care cost changes for PPO and HRA plans, and discuss Secure 2.0 super catch-up provisions. The board will also review disability pensions, service pensions, and reports from CIGNA and Davies.

employee-benefitspensionshealth-insuranceboard-electionvirtual-caresecure-2.0
✓ Decided: Board approves 5 new disability pensions, 9 reexaminations, and 3 deferrals

The Metropolitan Employee Benefit Board approved five new disability pension requests, continued nine reexaminations, deferred three reexaminations, and removed one from the list due to Social Security approval. The board also approved service pensions, disability-to-service conversions, survivor benefits, and a QDRO. Additionally, the board elected officers for 2025, approved a telehealth coverage change to comply with state regulations, and implemented the SECURE 2.0 super catch-up provision.

Tue Dec 3, 2024

Metro Action

Committee discusses executive director search and interim priorities

The Ad Hoc Committee for Executive Director Evaluation & Search is meeting to receive an update on the interim executive director's 30-60-90 day priorities and to discuss the timeline for the executive director search 2.0. The meeting also includes setting the meeting schedule. No votes or decisions are noted in the agenda.

executive-director-searchinterim-directorcommittee-meeting
✓ Decided: Committee reviews interim director's 30-day update, keeps search timeline

The ad hoc committee heard an update from Interim Executive Director Dairo on his first 30 days and confirmed no changes to the Executive Director Search 2.0 Timeline. A check-in with Metro HR is set for January 15, 2025. The committee scheduled its next meeting and adjourned.

Tue Dec 3, 2024

Metropolitan Council

Beer permit distance exemption for Little Hats Italian Market

The Government Operations and Regulations Committee will consider a resolution to exempt Little Hats Italian Market at 1120 4th Avenue N, #101 from minimum distance requirements for a beer permit. Public comment is allowed on this item. The meeting is scheduled for 5:45 p.m. on December 3, 2024.

alcoholbeer-permitcommitteegovernment-operationspublic-hearingzoning-exemption
Tue Dec 3, 2024

Metropolitan Council

Committee to vote on $250K library grant for youth college access

The Arts, Parks, Libraries & Entertainment Committee will consider three resolutions: approving criteria for a community arts internship program, and two grant contracts with Oasis Center, Inc. totaling $280,000 for youth services through the Nashville Public Library. The committee also has a chair report/updates item.

artslibrariesgrantsyouthpublic-librarycommunity-programs
Tue Dec 3, 2024

Parks and Recreation Board

Board to consider renaming Cumberland Park to Wasioto Park

The Nashville Parks and Recreation Board will consider an appeal to rename Cumberland Park to Wasioto Park, the original Shawnee name of the Cumberland River. The board will also vote on a large consent agenda of facility use permits and event approvals, and consider several new items including grants, fee changes, and event requests.

parksrenamingpermitsgrantsfeesevents
Tue Dec 3, 2024

Parks and Recreation Board

Board to vote on renaming Cumberland Park to Wasioto Park

The Parks and Recreation Board's Naming Committee will consider a request from the Indigenous Peoples Coalition to rename Cumberland Park to Wasioto Park, the original Shawnee name of the Cumberland River. The meeting includes a call to order, public comment period, and adjournment.

parksnamingindigenouspublic-hearing
Tue Dec 3, 2024

Housing Trust Fund Commission

Housing Trust Fund Commission discusses audit rules and training

The Metropolitan Housing Trust Fund Commission will discuss nonprofit audit requirements and commissioner training and policy. No items are scheduled for a vote. The commission also receives a financial update and a Unified Housing Strategy update.

housingaffordable-housinggrantsaudittraining
Tue Dec 3, 2024

Metropolitan Council

Council committee to vote on board appointments and resolutions

The Rules, Confirmations, and Public Elections Committee will consider several resolutions honoring individuals and organizations, and will vote on numerous board and commission appointments, reappointments, and confirmations. The agenda is largely procedural, focusing on personnel decisions and honorary recognitions.

appointmentsresolutionshonoraryboardscommissionsencroachment
Mon Dec 2, 2024

Human Relations Commission

Human Relations Commission to discuss No Hate campaign, conciliation agreement, and committee updates

This is a regular meeting of the Metro Human Relations Commission. The commission will review and approve minutes, receive a financial update, and discuss old business including a conciliation agreement update and the Friendsgiving event. New business includes the No Hate campaign and updates from the Executive, Bylaws, and Community Engagement committees.

human-relationsconciliationcommunity-engagementhate-campaigncommittee-updates
Mon Dec 2, 2024

Historical Commission

Marker Committee to review three proposed historical markers

The Metro Historical Commission's Marker Committee will meet on December 2, 2024, to review and select language for three proposed historical markers: Tennessee Tribune, Cumberland Heights, and First Masonic Hall. No public comment will be taken at this committee meeting; public comment will be available at the full Commission meeting on December 16, 2024.

historical-markershistorical-commissionpublic-hearing
Mon Dec 2, 2024

Metropolitan Council

Committee to vote on EPA grant for North Nashville/Bordeaux hubs project

The Transportation and Infrastructure Committee will consider 26 items, including a resolution to apply for an EPA Environmental and Climate Justice grant for the North Nashville and Bordeaux Hubs and Spokes Project. Other items include accepting private donations for infrastructure improvements, approving contracts for water services, and authorizing various sewer and water main projects. The committee will also discuss a resolution urging increased traffic enforcement and road safety improvements.

transportationinfrastructuregrantsdonationstraffic-safetywater-sewerpublic-works
Mon Dec 2, 2024

Auditorium Commission

Auditorium Commission meets Dec. 2, 2024, with public comment period

The Metropolitan Auditorium Commission is holding a regular meeting on December 2, 2024. The agenda includes only procedural items: a public comment period and standard non-discrimination and ADA accommodation statements. No specific decisions or proposals are listed.

auditoriumpublic-meetingpublic-commentnashville
Mon Dec 2, 2024

Metropolitan Council

Planning committee to vote on 395-unit development near 1st Ave N

The Planning & Zoning Committee will consider 23 items, including a major rezoning for a 395-unit apartment complex near 1st Avenue North and Van Buren Street, and several infrastructure easements and sewer projects. The committee also will discuss a transportation advisory committee and accept grants for brownfield investigation and historic preservation.

zoninghousingtransportationbrownfieldspublic-workssewerdevelopment
Mon Dec 2, 2024

Continuum of Care Homelessness Planning Council

Equity committee to revise anti-discrimination policy and plan 2025 training

The Equity & Diversity Committee of Nashville's Continuum of Care will discuss updates, a racial equity training survey, planning for 2025 training, hiring a racial equity consultant, and revising the anti-discrimination policy. The meeting includes reading the CoC's Anti-Racism Pledge and setting the next agenda.

homelessnessequityanti-racismtrainingpolicy
Mon Dec 2, 2024

Metropolitan Council

Committee to consider $527M bond issuance and $18.6M fund appropriation

The Budget and Finance Committee will discuss a resolution to issue up to $527,170,000 in general obligation bonds and another to appropriate $18,573,000 from the General Fund Reserve for equipment and building repairs. Other items include grants for environmental justice, juvenile court mental health services, workforce development, and various infrastructure donations and settlements.

budgetbondsgrantspublic-safetyworkforce-development
Tue Nov 26, 2024

Audit Committee

Audit Committee to discuss follow-up on Agricultural Extension Office audit

The committee will review follow-up on an audit of the Davidson County Agricultural Extension Office, consider amending the 2024 Annual Audit Workplan, and receive updates on internal audit projects and the FY2025 budget. A closed executive session is planned to discuss the FY2024 financial audit and other confidential matters.

auditbudgetfinancegovernment-oversightstaffing
Mon Nov 25, 2024

Metropolitan Council

Minority Caucus meets for routine business and legislation update

The Metropolitan Council Minority Caucus is holding a regular meeting to approve minutes, hear a treasurer's report, discuss old business (annual reception and boards/commissions), and receive a legislation update. No specific votes or decisions are listed on the agenda.

minority-caucusmetropolitan-councilnashvillemeetinglegislation
Mon Nov 25, 2024

Metropolitan Council

Executive Committee discusses public comment rules and state legislative update

The Metro Council Executive Committee is meeting to receive updates on public comment rules changes, a proclamation project, and a state legislative update from Morrison Capitol Strategies. No votes or binding decisions are scheduled; the agenda is primarily informational and procedural.

councilpublic-commentstate-legislatureproclamationsprocedural
Mon Nov 25, 2024

Civil Service Commission

Civil Service Commission to approve dozens of hires, terminations, and pensions

The Civil Service Commission will vote on a large slate of appointments, terminations/pensions, and eligibility register reports across multiple Metro departments. The agenda also includes several human resource items, such as a review of a dismissal, salary increase requests, and job description revisions.

civil-serviceappointmentsterminationspensionshuman-resources
Mon Nov 25, 2024

Continuum of Care Homelessness Planning Council

HMIS policies, evaluation, and 2025 homeless count discussed

The Data & HMIS Oversight Committee will discuss updates to the HMIS Policies & Procedures Manual, follow up on the HMIS Lead evaluation, and consider new business including a descriptive report of HMIS participating agencies, equity and diversity disparities research, encampment research, and the 2025 Point-in-Time Count methodology. No final decisions are noted on the tentative agenda.

homelessnesshmisdatapoint-in-time-countequityencampments
Mon Nov 25, 2024

Arts Commission

Arts Commission committee to allocate grant funds between Organization Grants and Thrive Awards

The Arts Commission Grants + Funding Committee will meet to discuss and take action on allocating funds between Organization Grants and Thrive Awards, as well as implementing new operating grant options and Thrive Awards. The meeting includes public comment and approval of previous minutes.

arts-commissiongrantsfundingpublic-commentnashville
Fri Nov 22, 2024

Election Commission

Election board to certify Nov. 5 general and municipal election results

The Davidson County Election Commission will certify the results of the November 5, 2024 State & Federal General Election and municipal elections in Belle Meade, Forest Hills, and Goodlettsville. The board will also approve minutes from previous meetings and hear an AOE report.

election-commissionelection-certificationmunicipal-electionsauditdavidson-county
✓ Decided: Election Commission certifies Nov. 5, 2024 election results

The Davidson County Election Commission certified the results of the November 5, 2024 State and Federal General Election, along with municipal elections in Belle Meade, Forest Hills, and Goodlettsville, and the Transit Improvement Program Referendum. The certification followed a mandatory audit and review of provisional ballots. The commission also approved minutes from September 3 and November 5, 2024, and reviewed voter registration applications.

Fri Nov 22, 2024

Continuum of Care Homelessness Planning Council

Council discusses lived experience programming for homelessness

The Continuum of Care Homelessness Planning Council is meeting to discuss lived experience programming, new business, and other business. The agenda includes a values and equity statement focused on antiracism. No specific decisions or proposals are listed.

homelessnesshousingequityplanningnashville
Fri Nov 22, 2024

Continuum of Care Homelessness Planning Council

Homelessness council plans annual Point-in-Time Count

The Continuum of Care Homelessness Planning Council's Point-in-Time Count Subcommittee is meeting to plan the annual count of people experiencing homelessness. The agenda includes reviewing HUD methodology, volunteer recruitment, team assignments, zones, data collection methods, and targeted strategies like the youth count. This is a planning session, not a decision-making meeting.

homelessnesspoint-in-time-countplanningvolunteersdata-collection
Thu Nov 21, 2024

Metropolitan Council

Procurement Working Group interviews four Metro departments

The Budget & Finance Committee's Procurement Process Working Group is meeting to interview representatives from four Metro departments about their procurement processes. The departments scheduled are General Services, Parks and Recreation, Nashville Public Library, and Health (Metro Animal Care and Control). No decisions are being made; this is a discussion and information-gathering session.

procurementbudgetfinancegeneral-servicesparkslibraryanimal-care
Thu Nov 21, 2024

District Energy System Advisory Board

District Energy Board to review FY25 budget, contractor performance, and capital projects

The Metro Nashville District Energy System Advisory Board will meet to discuss routine operational items including customer sales, marketing, contractor performance, natural gas purchasing, and the FY25 budget. The agenda also includes reviews of capital projects, system operator updates, and special topics. No votes on specific policies or expenditures are listed.

district-energybudgetcapital-projectscontractor-performancenatural-gasoperations
Thu Nov 21, 2024

Transportation Licensing Commission

TLC proposes e-bike minimums and pedal-vehicle rush-hour restrictions

The Transportation Licensing Commission is considering two rule amendments: one requiring operators to deploy at least one e-bike for every four electric scooters, and another restricting pedal vehicles from operating on streets during morning rush hours (7-9 a.m. weekdays) and requiring approved routes during afternoon rush hours (4-6 p.m. weekdays).

transportationscooterse-bikespedal-vehicleslicensingnashville
✓ Decided: TLC approves rule allowing class 2 e-bikes in Nashville fleets

The Transportation Licensing Commission approved a rule change permitting operators to add class 2 e-bikes to shared urban mobility device fleets, subject to a minimum ratio of one e-bike per four scooters. The commission also approved numerous towing, passenger vehicle, and taxicab licenses, and set the 2025 meeting calendar.

Thu Nov 21, 2024

Hospital Authority Board

Hospital board to vote on contract and policy management rules

The Metropolitan Hospital Authority Board of Trustees will consider approving two policy documents: a Management of Contract Services Policy and a Policies: Development and Management Policy. The board will also vote on the September finance report, medical staff credentials, and minutes from the October meeting. Public comment is limited to agenda items and requires in-person sign-up.

hospital-authoritypolicy-approvalfinancecredentialspublic-commentclosed-session
Thu Nov 21, 2024

Emergency Communication District (E-911) Board

E-911 Board to review October financials and public awareness update

The Davidson County Emergency Communication District Board will meet to adopt minutes from October, review the October 2024 financial statement, and receive a public awareness update. No major decisions or public hearings are scheduled; the agenda is largely procedural.

e-911emergency-communicationfinancial-reportpublic-awarenessboard-meeting
Thu Nov 21, 2024

Hospital Authority Board

Finance Committee to review FY24 audit and approve September financials

The Metropolitan Hospital Authority Board Finance Committee will meet to receive an update on the FY24 audit and vote on approval of the September 2024 financial statements. The agenda also includes approval of prior meeting minutes and an opportunity for public comment on scheduled agenda items.

hospital-authorityfinanceauditfinancial-statementsnashville
Thu Nov 21, 2024

Health Board

Board interviews 4 finalists for Director of Health position

The Nashville Board of Health is holding a special called meeting to interview four finalists for the Director of Health position. Each candidate will give a presentation on prioritizing suicide, overdose, and community violence prevention. The board will then discuss and potentially negotiate a contract with a selected candidate.

healthpublic-healthhiringdirector-of-healthboard-of-health
✓ Decided: Board selects Sanmi Areola as preferred candidate for Health Director

The Board interviewed four candidates for Director of Health and selected Sanmi Areola as the preferred candidate. Amy Yeager was chosen as runner-up. The Board directed Metro Human Resources and the Chair to offer the position to Areola, and if he declines, to Yeager.

Thu Nov 21, 2024

Metro Development and Housing Agency Board

Employee appeal hearing for Robin Spicer

The Human Resources Committee of the Metro Development and Housing Agency is meeting to hear an employee appeal from Robin Spicer. The agenda also includes approval of minutes from April 2024 and public comments.

housinghuman-resourcesemployee-appeal
Thu Nov 21, 2024

Arts Commission

Arts Commission to review Arthur Avenue lighting project budgets

The Metro Arts Commission is meeting to discuss and potentially act on the Arthur Avenue Public Art Lighting Project's artist and site budgets, along with updates from several committees. The agenda includes reports on budget, equity, and grants, but no final votes are listed. Public comments are accepted in person or online before the meeting.

artspublic-artbudgetgrantsequity
Thu Nov 21, 2024

Continuum of Care Homelessness Planning Council

Housing Opportunities Committee to draft one-year plan

The Housing Opportunities Committee of the Continuum of Care Homelessness Planning Council is meeting to establish priorities and draft a one-year plan. The agenda includes routine items such as roll call, other business, and next steps, with no specific proposals or decisions listed.

homelessnesshousingplanningcommittee
Thu Nov 21, 2024

Continuum of Care Homelessness Planning Council

CoC general membership meeting with committee updates and new business

This is a general membership meeting of the Nashville-Davidson County Continuum of Care, featuring committee updates, a reading of the values and equity statement, and new business. No specific votes, funding decisions, or policy changes are listed on the agenda.

homelessnesscontinuum-of-carecommittee-updatesnashvillegeneral-membership-meeting
Wed Nov 20, 2024

Continuum of Care Homelessness Planning Council

CoC Performance Evaluation Committee meets to discuss grants and corrective action plan

The Performance Evaluation Committee of Nashville's Continuum of Care will meet to receive updates on the CoC Consolidated Application, CoCBuilds and Youth Homelessness Demonstration Program grants, and an Urban Housing Solutions Corrective Action Plan. The committee will also discuss a One Year Plan. No votes or decisions are listed on the tentative agenda.

homelessnessgrantscorrective-action-planhousingcontinuum-of-care
Wed Nov 20, 2024

Historic Zoning Commission

Historic Zoning Commission to review 30+ construction, demolition, and infill cases

The Metro Historic Zoning Commission will hold a public hearing on November 20, 2024, to review applications for new construction, additions, demolitions, and infill projects within Nashville's historic overlay districts. The agenda includes consent items, administrative permits, violation cases, and several demolition requests citing economic hardship. The commission will also adopt the previous meeting's minutes and consider deferring one item.

historic-zoningdemolitionnew-constructioninfillviolationspermitsnashville
✓ Decided: Commission approves multiple historic district projects with conditions

The Metro Historic Zoning Commission approved numerous new construction, addition, and infill projects across Nashville's historic overlays, each with specific conditions to ensure compliance with design guidelines. The commission also denied a demolition request for economic hardship at 1711 Boscobel St, approved a hardship demolition at 1807 Lakehurst Dr with reconstruction conditions, and ordered removal of an unpermitted rooftop covering at 300 Broadway. All votes were unanimous except for one project at 1207 Forest Ave, which passed with Commissioner Cotton in opposition.

Wed Nov 20, 2024

Beer Permit Board

Beer Board to hear 4 underage-sale cases, consider 16 new permits

The Metro Beer Permit Board will vote on 16 new or expanded beer permit applications, including for Gus's Fried Chicken, Sprouts Farmers Market, and Vanderbilt University events. The board will also hold hearings on four businesses accused of selling beer to minors, with staff recommending civil penalties or suspensions. Additionally, three complaints involving alleged criminal activity on premises are on the agenda, with staff recommending revocation for two of them.

beer-permitsalcohol-regulationpublic-safetyunderage-drinkingpermits-and-licensesnashville
✓ Decided: Beer board approves 16 permits, defers 13, fines violators

The Metro Beer Permit Board approved 16 beer permit applications, deferred 13 applications indefinitely due to missing documents, and issued citations for two complaints. The board also heard four violation cases, imposing civil penalties or suspensions, and deferred two other complaints pending further investigation.

Wed Nov 20, 2024

Short Term Rental Appeals Board

Nashville short-term rental appeals board cancels November meeting

The Metropolitan Short Term Rental Appeal Board has no meeting scheduled for November 2024. The agenda consists solely of procedural boilerplate regarding public comment rules and deadlines for submitting materials.

short-term-rentalsappeals-boardpublic-commentmeeting-cancellation
Wed Nov 20, 2024

Metropolitan Council

Procurement process interviews with three Metro departments

The Budget & Finance Committee's Procurement Process Working Group is meeting to interview representatives from three Metro departments about their procurement processes. The departments scheduled are NDOT, ITS, and the Metro Action Commission. No decisions are being made; this is a discussion and information-gathering session.

procurementbudgetfinancetransportationtechnologycommission
Tue Nov 19, 2024 · 6:30 PM

Metropolitan Council

Council to consider surveillance technology contract and board appointments

The Metropolitan Council will hold a public hearing on a contract amendment for surveillance technology and consider several board appointments. The body is also reviewing grant applications for homeless services and juvenile court programs.

surveillanceappointmentsgrantshomeless-servicespublic-safetyalcohol-permits
Metropolitan Courthouse
Tue Nov 19, 2024

Metropolitan Council

Rules Committee to consider board appointments and rule changes

The Rules, Confirmations, and Public Elections Committee will consider several board and commission appointments, including the Health and Educational Facilities Board, Metropolitan Action Commission, and others. The committee will also vote on proposed amendments to Council Rules 13.4 and 50.2 regarding late-filed legislation and nominee interview procedures. Additionally, resolutions honoring individuals and accepting a broadband grant are on the agenda.

appointmentsrulesbroadbandresolutionspublic-hearings
Tue Nov 19, 2024

Mechanical, Plumbing, and Electrical Examiners and Appeals Board

Board to hear appeal on restroom distance for food truck site

The Mechanical, Plumbing, and Electrical Examiners and Appeals Board will consider one appeal case (No. 20240098862) regarding a variance request for toilet facilities at 413 Rep John Lewis Way. The appellant seeks approval to use a restroom beyond the 500-foot code limit or provide a portable restroom with hand sink for food truck employees and customers. The meeting also includes public comment, approval of October minutes, and other business.

mechanical-plumbing-electrical-boardappealsplumbing-codevariancefood-trucksnashville
Tue Nov 19, 2024

Metropolitan Council

Committee to vote on expanding police surveillance tech contract

The Public Health and Safety Committee is deciding on 11 items, including a contract amendment for Fusus surveillance technology, several grant applications for homeless services and police programs, and a resolution urging increased traffic enforcement. Public comment is allowed on agenda items.

public-safetypolicesurveillancehomeless-servicesgrantsschool-resource-officerstraffic-enforcement
Tue Nov 19, 2024

Metropolitan Council

Committee to vote on beer permit exemption for Turkey Icehouse

The Government Operations and Regulations Committee will consider a resolution to exempt Turkey Icehouse, LLC from minimum distance requirements for a beer permit. A late-filed resolution accepting a grant for broadband services is also on the agenda.

alcohol-permitsbroadbandgrantspublic-hearing
Tue Nov 19, 2024

Nashville Health and Well-being Leadership Council

Council to discuss 2025 Community Health Assessment and CHIP workgroup structure

The Nashville Health & Well-being Leadership Council will discuss the 2025 Community Health Assessment strategic issues and the 2023-2025 CHIP workgroup report structure. They will also approve the October meeting minutes, set the 2025 meeting calendar, and consider potential member trainings. The meeting is largely procedural with strategic planning elements.

healthcommunity-assessmentstrategic-planningmeeting-minutescalendartraining
Tue Nov 19, 2024

Employee Benefit Board

Employee Benefit Board to discuss Secure 2.0 catch-up and virtual care costs

The Metropolitan Employee Benefit Board will hold a study session to discuss two items: Secure 2.0 Super Catch Up Considerations and PPO and HRA Plans Virtual Care Cost Consideration. No votes or decisions are scheduled; this is a discussion-only meeting.

employee-benefitsretirementhealthcarevirtual-carenashville
Tue Nov 19, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup continues federal benchmarks for ending homelessness

The Continuum of Care Veterans Workgroup will review data from the Metro Homelessness Impact Division and the Metropolitan Development and Housing Agency, continue work on USICH Federal Criteria and Benchmarks for Ending Veteran Homelessness, and receive Built for Zero updates. The meeting includes routine items such as introductions, minutes approval, and agency updates.

homelessnessveteransdata-reviewfederal-criteriabuilt-for-zeronashville
Tue Nov 19, 2024

Metropolitan Council

Committee to vote on 5 greenway easements and a gas utility easement

The Arts, Parks, Libraries, & Entertainment Committee will consider five bills on second reading approving greenway conservation easements at specific properties and one bill authorizing permanent and temporary construction easements to Piedmont Natural Gas Co. on Metro-owned land. Public comment is allowed on these items.

parksgreenwayeasementsutilitiespublic-comment
Mon Nov 18, 2024

Metropolitan Council

Committee to vote on greenway easements, gas easements, and stormwater project

The Transportation and Infrastructure Committee will consider multiple bills on second reading, including four greenway conservation easements, two natural gas easements, a stormwater improvement project, and sewer main modifications. The committee will also discuss a resolution urging increased traffic enforcement by police and transportation departments.

transportationinfrastructuregreenwayeasementsstormwatertraffic-enforcementsewer
Mon Nov 18, 2024

Historical Commission

Historical Commission to vote on marker for two historic downtown bookstores

The Metro Historical Commission will vote on a proposed historical marker for the Mills and Zibart bookstores, which operated on Church Street from the 1950s to 1970 and were known for supporting civil rights sit-ins and serving as cultural hubs. The meeting also includes public comment, ethics training, and director/historic zoning reports.

historical markerspublic commentethics traininghistoric zoningnashville
✓ Decided: Historical Commission approves R.M. Mills Bookstore/Zibart's marker

The Metropolitan Historical Commission unanimously approved the R.M. Mills Bookstore/Zibart's Books and Records historical marker, to be placed on Church Street. The commission also approved the October 2024 meeting minutes and received ethics training. No other substantive decisions were made.

Mon Nov 18, 2024

Metropolitan Council

Council considers 590-unit development on Clarksville Pike

The Planning and Zoning Committee will vote on 33 items, including several large rezoning proposals for multi-family housing. Key decisions include a 590-unit development on Clarksville Pike, a 288-unit complex on Burkitt Road, and a 250-unit project on West Trinity Lane. The committee also will consider multiple greenway easements and utility easements.

zoninghousingmulti-familygreenwayeasementsplanningdevelopment
Mon Nov 18, 2024

Metropolitan Council

Budget committee to vote on Fusus surveillance contract amendment

The Budget and Finance Committee will consider 19 items, including a resolution to amend a sole-source contract with Fusus LLC for surveillance technology. Several grant applications and contracts for police, homeless services, and juvenile court programs are also on the agenda. Most items are on the consent agenda for a single vote.

budgetfinancepolicesurveillancehomeless-servicesschool-safetygreenwaygrants
Mon Nov 18, 2024

Community Review Board

Community Review Board to discuss bylaws, MOU, and 61-page complaint

The Nashville Community Review Board is holding its monthly meeting to discuss and potentially approve bylaws, board member nominations, MOU negotiations, a sexual misconduct policy, and a 61-page complaint investigation. Public comment is available, and decisions may be appealed to Chancery Court.

community-review-boardbylawsmousexual-misconduct-policycomplaint-investigation
✓ Decided: CRB approves MOU with MNPD and updated bylaws unanimously

The Community Review Board unanimously approved the MOU negotiation agreement with Metro Nashville Police Department and the updated Bylaws and Rules. The board also approved two compliance review reports (CC2023-031 and CC2024-017) and the minutes from the October 28, 2024 meeting with amendments. No public comments were made, and no other substantive decisions were taken.

Mon Nov 18, 2024

Bicycle and Pedestrian Advisory Commission

East Bank project updates and docked bike share RFQ discussed

The Bicycle and Pedestrian Advisory Commission will hear a 30-minute update on East Bank projects from the Mayor's Office, receive general updates on the Shared Use Mobility Devices program, and discuss a docked bike share RFQ. The commission will also discuss subcommittees and the annual report to the Mayor's Office.

bicyclepedestriantransportationeast-bankshared-mobilitybike-sharepublic-comment
Fri Nov 15, 2024

Human Relations Commission

Human Relations Commission to review bylaws and rules

The Metro Human Relations Commission's Bylaws and Rules Ad hoc Committee is meeting to review its bylaws and rules. The agenda includes public comments and old business, but no specific proposals or decisions are listed.

human-relationsbylawsrulescommissionnashville
Fri Nov 15, 2024

Human Relations Commission

Human Relations Commission discusses Friendsgiving and Humans Over Hate

The Metro Human Relations Commission is holding an executive committee meeting to discuss old business (Friendsgiving) and new business (Humans Over Hate). The agenda includes call to order, quorum confirmation, and public comments. No decisions or detailed proposals are recorded in the agenda.

human-relationscommission-meetingpublic-comments
Thu Nov 14, 2024

Public Library Board

Library Board holds retreat with strategic planning and Freedom to Read talk

The Nashville Public Library Board is meeting for a full-day retreat at Beaman Park Nature Center. The agenda includes strategic exercises (SWOT, Case for Change), a presentation on Freedom to Read, and a working session with the Library Foundation. No binding votes or public hearings are scheduled.

librarystrategic-planningfreedom-to-readboard-retreatnashville
Thu Nov 14, 2024

Planning Commission

Planning Commission to consider 254-unit senior living rezoning at 858 West Trinity Lane

The Nashville Planning Commission is meeting to decide on several rezoning and subdivision requests, including a proposed 254-unit senior living development. Most items are recommended for deferral to future meetings, while a few are up for approval with conditions. The agenda includes public hearings on various residential and mixed-use projects across the city.

zoninghousingplanning-commissionrezoningsubdivisioncommunity-plan
✓ Decided: Planning Commission approves 254-unit senior living rezoning on West Trinity Lane

The Metropolitan Planning Commission approved a rezoning to permit a 254-unit multi-family senior living development at 858 West Trinity Lane, with conditions and a required $75,000 contribution for a future pedestrian crossing. The commission also approved several other development requests, including a 129-lot subdivision on Hamilton Church Road and a 90-unit multi-family development on Murfreesboro Pike. A large number of items were deferred to future meetings, and two text amendments related to zoning code housekeeping were approved.

🏢 Registered nonprofit at this address: Little Saints Comprehensive Learning Center Inc (Human services)
Thu Nov 14, 2024

Tourism and Convention Commission

Tourism commission meets; agenda is procedural only

The Metro Tourism and Convention Commission is meeting on May 11, 2023, at 8:30am. The agenda contains only logistical information about parking and building access, with no listed decisions, proposals, or public hearings.

tourismcommissionprocedural
✓ Decided: Commission approves September minutes, financial report, and 2025 meeting schedule

The Metro Tourism & Convention Commission unanimously approved the September 2024 meeting minutes with spelling corrections, the NCVC financial report, and the 2025 meeting schedule (third Thursday of each quarter at 8:30 a.m., pending room availability). No other substantive decisions were made; the meeting consisted primarily of reports from NCVC staff on tourism performance, marketing, and sales.

Thu Nov 14, 2024

Arts Commission

Arts Commission to vote on deaccessioning Helga and resiting Lotus

The Public Art Committee will consider deaccessioning the Helga (Lending Library) artwork and resiting the Lotus (Bike Rack) piece. They will also vote on the Arthur Avenue Public Art Lighting Artist and Sitework Budget. Updates will be given on the Arthur Avenue lighting testing, Lending Library launch at five branches, and Nolensville Pike transit shelter reinstallation.

public-artarts-commissiondeaccessionlightingtransit-shelterslending-librarynashville
✓ Decided: Arts Commission approves $500K artist budget, $400K site work for Arthur Ave project

The Public Art Committee unanimously approved increasing the artist budget to $500,000 and authorizing up to $400,000 for site work for the Arthur Avenue public art lighting project. The committee also discussed deaccessioning and resiting artworks, with no action taken, and received updates on the Lending Library launch and Nolensville Pike transit shelter reinstallation.

Thu Nov 14, 2024

Health Board

Board to vote on keeping air pollution fee at $40/ton for 2024

The Board of Health will consider granting a one-year variance to keep the annual air pollution permit fee at $40 per ton of regulated pollutants (except carbon monoxide) for calendar year 2024, instead of the CPI-adjusted rate of $63.69 per ton. The lower fee is projected to collect $332,252 for the Title V program and $162,000 for the general air pollution fund, which exceeds the budgeted needs of $322,000 and $150,000 respectively.

air-pollutionfeespermitspublic-healthbudget
✓ Decided: Board approves $15.4M Ryan White grant and 18 grants/contracts

The Board unanimously approved the Air Pollution Permit Fee Schedule for 2024, a $15,418,778 Ryan White Part A grant application, and 18 grants/contracts (items 1-15, 17-18 unanimously; item 16, a $60,000 direct appropriation to Tennessee Justice Center, passed 5-0 with one recusal). The Board also approved joining the Big Cities Health Coalition with $11,087 annual dues and re-elected Tené Franklin as Chair and Marie Griffin as Vice-Chair. No substantive decisions were made on other agenda items, which were informational updates.

Wed Nov 13, 2024

Sexually Oriented Business Licensing Board (Inactive)

Board to review entertainer and business permits for sexually oriented businesses

The Metropolitan Sexually Oriented Business Licensing Board is meeting to review new and renewal entertainer permits and business licenses issued between August 29 and November 13, 2024. The agenda also includes public comment, approval of the August 28, 2024 minutes, and an inspector's report. This is a routine administrative meeting focused on permit approvals.

licensingpermitssexually-oriented-businesspublic-meeting
Wed Nov 13, 2024

Metro Development and Housing Agency Board

MDHA board to review PILOT program and Autumn Lake agreement

The Finance and Development Committee will hear a presentation on the PILOT program and discuss a PILOT agreement for Autumn Lake, with a board decision expected in December. An amendment to the Phillips Jackson Redevelopment Plan will also be presented for a December decision. The committee will receive an update on 5th & Summer and a presentation on the Property Disposition Policy.

housingdevelopmentpilotsredevelopmentfinancepublic-housing
Wed Nov 13, 2024

Continuum of Care Homelessness Planning Council

Homelessness Planning Council holds board orientation on roles and ethics

The Homelessness Planning Council is holding a board orientation session covering the council's purpose, ethics, open meetings rules, and key homelessness terms. Topics include the Continuum of Care structure, data systems, strategic planning, and lived experience frameworks. No votes or decisions are scheduled; the meeting is entirely procedural and educational.

homelessnessboard-orientationethicscontinuum-of-carestrategic-planning
Wed Nov 13, 2024

Metro Development and Housing Agency Board

MDHA committee to consider SEMAP certification for housing programs

The Housing and Community Committee of the Metropolitan Development and Housing Agency is meeting to approve minutes, hear public comments, and consider a SEMAP certification decision. The SEMAP certification is a key item that the board is requested to decide on in November.

housingpublic-commentscertification
Wed Nov 13, 2024

Metro Development and Housing Agency Board

Board to vote on sewer separation and housing voucher policy changes

The Metro Development and Housing Agency Board will consider a resolution to change the November meeting date, approve minutes, and hear public comments. Key committee reports include the South 5th Street Sewer Separation project and updates to Housing Choice Voucher payment standards and administrative plan.

housingvoucherssewerpublic-commentsboard-meeting
Wed Nov 13, 2024

Continuum of Care Homelessness Planning Council

Council to vote on $7.55M motel conversion for homeless youth

The Homelessness Planning Council is tracking the $50 million investment in addressing homelessness, including updates on interim housing, permanent supportive housing, and supportive services. The council reviewed spending data and discussed the upcoming Metro Council vote on a $7.55 million award to convert a motel at 1210 Murfreesboro Pike into 80 units for youth aging out of foster care and deeply affordable housing.

homelessnesshousingaffordable-housingyouthbudgetpublic-healthsocial-services
Wed Nov 13, 2024

Community Review Board

Community Review Board to discuss bylaws, misconduct policy, and DOJ training update

The Nashville Community Review Board Executive Committee will meet to discuss revisions to its bylaws, an update on the sexual misconduct policy, and a memorandum of understanding. The board will also receive a case update and a report on Department of Justice training.

community-review-boardbylawspolice-oversightsexual-misconduct-policydoj-training
Tue Nov 12, 2024

Traffic and Parking Commission

Traffic & Parking Commission to vote on Gulch sidewalk vending ban

The Metro Traffic & Parking Commission will vote on expanding the downtown sidewalk vending restriction into the Gulch, bounded by Broadway, 12th Ave S, Division St, and 8th Ave S. Other items include a new all-way stop at Patterson St and 21st Ave N, residential permit parking at 477 Chestnut St, and an update on the Lebanon Pike speed reduction. The commission will also elect a Chair and Vice Chair.

trafficparkingsidewalk-vendingpedestrian-safetyspeed-limitscommission-elections
✓ Decided: Gulch sidewalk vending restriction deferred to February

The commission deferred a proposal to extend the downtown sidewalk vending restriction into the Gulch to its February meeting, with one commissioner objecting. It approved a consent agenda including an alley abandonment and a new all-way stop, and approved residential permit parking at 477 Chestnut St. The commission also re-elected Brandon Mason as chair and Robert Gibbs as vice chair, and set the December meeting for 2:30 pm.

Tue Nov 12, 2024

Continuum of Care Homelessness Planning Council

CE Oversight Committee to discuss key initiatives, standards, and grievance process

This meeting of the CE Oversight Committee includes discussion of key initiatives and a draft timeline, identification of considerations for each type of standard, and a discussion of the grievance process. The agenda is largely discussion-based with no specific votes or decisions listed.

homelessnessoversightcoordinated-entrygrievance-processnashville
Tue Nov 12, 2024

Farmers Market Board

Nashville Farmers' Market Board to discuss A&M Marketplace, commissary kitchen, and FY25 financial report.

The board will consider approval of October 2024 meeting minutes, receive updates on the A&M Marketplace and Pop Up Kitchen/Commissary Kitchen, review the FY25 financial report, and hold an election for board officers. Public comments are limited to three minutes per speaker.

farmers-marketpublic-commentfinancial-reportelectionkitchen
Tue Nov 12, 2024

Fire and Building Code Appeals Board

Board hears appeals for music venue variance and sprinkler exemption

The Fire and Building Code Appeals Board will hear two appeal cases at its November 12 meeting. One case seeks a variance to allow a 4,500-person music venue above a parking garage. The other requests exemptions from sprinkler, egress, and other code requirements for an assembly space.

fire-codebuilding-codeappealsvariancemusic-venuesprinkler-exemptionnashville
✓ Decided: Board approves music venue variance for 4,500-person capacity

The board approved a variance allowing a 4,500-person music venue above a parking garage at 446 Chestnut Street, and approved with stipulations a request to waive certain fire and building code requirements for a barn venue at 2141 Baker Road. The board also voted to recuse member Chris Dunn from the Baker Road case.

Tue Nov 12, 2024

Fair Commissioners Board

Fair Commissioners Board reviews $41M fairgrounds capital projects status

The board is reviewing the financial status of multiple capital improvement projects at the fairgrounds, including the new Exposition Center, Fair Park Phase 2, and infrastructure work. The agenda consists entirely of budget-to-date reports with no new decisions or public hearings scheduled.

fairgroundscapital-improvementsbudgetconstructionparks
Thu Nov 7, 2024

Metropolitan Council

Committee to vote on notaries, board appointments, and honorary resolutions

The Rules, Confirmations, and Public Elections Committee will vote on nine honorary resolutions, a bill modifying board structures, and multiple board and commission appointments. The agenda is largely procedural, with most items being ceremonial recognitions or routine confirmations.

notariesboards-and-commissionsappointmentsresolutionsprocedural
Thu Nov 7, 2024

Metropolitan Council

Committee to consider beer permit exemption for Turmeric on Main St. and intergovernmental radio agreement

The Government Operations and Regulations Committee will discuss three items: a resolution to waive distance requirements for a beer permit at Turmeric (975 Main St., Suite 102), an intergovernmental agreement with NES and the U.S. Marshals Service for emergency radio service, and a bill updating retail package store compliance certificates to match state law.

alcohol-permitspublic-safetyordinance-amendmentintergovernmental-agreementretail-regulations
Thu Nov 7, 2024

Human Relations Commission

Human Relations Commission plans 60th anniversary celebration

This is a planning meeting of the ad hoc committee for the 60th anniversary of the Metro Human Relations Commission. The committee will discuss promotion, volunteer recruitment, in-kind support, and décor for the event. No decisions are expected; the agenda is procedural and focused on organizing the celebration.

human-relationsanniversaryplanningvolunteersevents
Thu Nov 7, 2024

Metropolitan Council

Metro Council Veteran’s Caucus meets for routine discussion

This is a procedural meeting of the Metro Council Veteran’s Caucus with no legislative actions or public hearings. The agenda includes a welcome, discussion of Veteran’s Day and Dry January, then adjournment.

veteransprocedural
Thu Nov 7, 2024

Convention Center Authority

Convention Center Authority to hear annual audit, parking RFP

The Convention Center Authority will receive the annual audit presentation from Crosslin, discuss a parking access and revenue control system RFP, and hear an operations update including tax collections and a feasibility study introduction. The meeting also includes public comment and approval of previous minutes.

convention-centerauditparkingrfptax-collectionsfeasibility-study
Thu Nov 7, 2024

Stormwater Management Commission

Stormwater panel to hear floodway disturbance for Bellevue greenway path

The Stormwater Management Commission will consider a case to disturb the floodway and buffer for a 12-foot impervious greenway path and a vehicular bridge at 1084 Morton Mill Road in Bellevue. The commission will also vote on deferring a separate case at 3702 B Estes Road to December 5th, and discuss 2025 meeting dates.

stormwaterfloodwaygreenwaybellevuepublic-hearingpermits
Thu Nov 7, 2024

Continuum of Care Homelessness Planning Council

Homelessness council to discuss lived experience programming

The Continuum of Care Homelessness Planning Council's Lived Experience Programming meeting is set for November 7, 2024. The agenda includes a discussion on lived experience programming, along with new and other business. No specific decisions or proposals are listed.

homelessnessplanninglived-experiencemeeting
Thu Nov 7, 2024

Continuum of Care Homelessness Planning Council

Homelessness Planning Council reviews voucher use and housing data

The Continuum of Care Homelessness Planning Council is reviewing voucher utilization rates and homelessness data for the Nashville area. The agenda includes statistics on Emergency Housing Vouchers, Mainstream, VASH, FUP, and SPC vouchers, as well as total homeless counts and housing placement numbers. No decisions or proposals are noted; the meeting appears focused on data review.

homelessnessvouchershousingdata-reviewnashville
Thu Nov 7, 2024

Zoning Appeals Board

Zoning board to hear 16 variance and exception requests, including a new juvenile justice center

The Metropolitan Board of Zoning Appeals will consider 16 cases at its November 7, 2024 meeting. Items include requests for variances from setback, fence height, and parking requirements, as well as special exceptions and appeals for non-conforming structures. One case (2024-229) was dismissed for failure to advertise.

zoningvariancespublic-hearingshousingjuvenile-justicesetbacksnashville
Thu Nov 7, 2024

Metropolitan Council

Committee to vote on grants, library changing table, Fort Negley excavation

The Arts, Parks, Libraries & Entertainment Committee will consider four resolutions and one bill on second reading. Items include a grant for an adult-sized changing table at Bordeaux Branch Library, acceptance of a tennis grant and a child nutrition grant, a contract amendment, and an agreement for the descendant-led excavation at Fort Negley Park.

parkslibrariesgrantspublic-healthhistoric-preservationtennischild-nutrition
Thu Nov 7, 2024

Metropolitan Council

Council committee to vote on opioid, police, and homeless service grants

The Public Health and Safety Committee will consider eight resolutions accepting grants for opioid abatement, police technology, homeless services, and crime reduction, plus a bill on employee criminal participation. Items include funding for overdose prevention, resident safety surveys, and sexual assault kit analysis.

public-healthpolicehomeless-servicesgrantsopioidscrime-preventionemployee-conduct
Thu Nov 7, 2024

Behavioral Health and Wellness Advisory Council

Council to review bylaws and discuss co-chair vacancy

The Behavioral Health and Wellness Advisory Council will meet to review its bylaws and discuss filling a co-chair vacancy. The meeting also includes a history presentation, Q&A, and closing remarks.

behavioral-healthbylawsco-chaircouncilnashville
Thu Nov 7, 2024

Beer Permit Board

Beer board to hear 17 permit applications, 6 complaints, 14 deferrals

The Metro Beer Permit Board will consider 17 beer permit applications, including new locations, ownership changes, and special events. It will also hear 6 complaints alleging underage sales and other violations, with staff recommending civil penalties ranging from $500 to $4,000. Additionally, 14 applications are listed for indefinite deferral due to missing documents. The meeting includes public comment and approval of previous minutes.

beer-permitsalcohollicensingcomplaintspenaltiespublic-hearing
✓ Decided: Beer board grants 17 permits, defers 14, fines 6 businesses

The Metro Beer Permit Board approved all 17 beer permit applications on the agenda, including new locations, ownership changes, and special events. It deferred 14 applications indefinitely due to missing documents, with one board member recused from a vote on Jackalope Brewing Company. The board also issued civil penalties to six businesses for alleged violations, including sales to minors and failure to check ID.

Thu Nov 7, 2024 · 6:30 PM

Metropolitan Council

Council to consider zoning changes for 590 multifamily units on Clarksville Pike

The Metropolitan Council will vote on several zoning ordinances, including a change that would allow 590 multifamily residential units on Clarksville Pike. It will also consider a resolution exempting Turmeric at 975 Main St. from beer permit distance requirements and a DADU overlay district for 123.1 acres south of Douglas Avenue. Additional items include appointments to various boards and commissions.

zoninghousingappointmentspermitsdevelopment
Metropolitan Courthouse
Wed Nov 6, 2024

Metropolitan Council

Budget committee to vote on $7.5M grant for affordable housing, opioid funds

The Budget and Finance Committee will consider 36 items, including grants for opioid abatement, affordable housing construction, and police DNA backlog reduction. Key votes include a $7.55 million grant for workforce housing and a $355,200 contract for homeless health services.

budgetfinanceaffordable-housingopioidshomeless-servicespolicegrantspublic-health
Wed Nov 6, 2024

Continuum of Care Homelessness Planning Council

Coordinated Entry Oversight Committee to review policies and procedures manual

The Coordinated Entry Oversight Committee of the Nashville/Davidson County Continuum of Care is meeting to review its policies and procedures manual. The agenda includes a values and equity statement, welcome, introductions, other business, and next steps. No specific decisions or proposals are listed.

homelessnesscoordinated-entrypoliciesoversightnashville
Wed Nov 6, 2024

Metropolitan Council

Committee to review transit, sidewalk, and infrastructure agreements

The Transportation and Infrastructure Committee is reviewing 25 items, including resolutions and ordinances related to transportation projects, infrastructure improvements, and utility acceptances. Key items include approving amendments to intergovernmental agreements with TDOT for transit and sidewalk projects, and authorizing several aerial encroachments for private developments. The committee will also consider grant applications for recycling programs and various water and sewer infrastructure acceptances.

transportationinfrastructuretransitsidewalksgrantswatersewerencroachments
Wed Nov 6, 2024

Metropolitan Council

Council committee to weigh $7.55M affordable housing grant

The Planning and Zoning Committee will consider resolutions and bills on affordable housing funding, redevelopment plans, infrastructure acceptances, and aerial encroachments. Key items include a $7.55 million grant for affordable housing, a PILOT agreement for a multi-family project, and several water/sewer infrastructure acceptances.

affordable-housingzoninginfrastructuregrantsredevelopmentpublic-hearing
Wed Nov 6, 2024

Metropolitan Council

Non-profit funding process working group meets to finalize timeline

The Budget & Finance Committee's Non-Profit Funding Process Working Group is meeting to discuss an open, transparent process for funding non-profits that provide services Metro needs. They aim to finish the timeline, develop a communication plan, and discuss the Nashville Needs Fund. The next meeting is scheduled for early December.

budgetfinancenon-profitfundingnashville
Tue Nov 5, 2024

Employee Benefit Board

Employee Benefit Board to consider pension COLA and fertility benefits study

The Metropolitan Employee Benefit Board will vote on cost-of-living adjustments for Division A and B pension plans and discuss a request to study fertility benefits. The board will also consider an RFP for death audit and address verification services. Other items include approval of prior meeting minutes and review of utilization reports from Blue Cross Blue Shield and CIGNA.

pensionsbenefitsfertilitycost-of-livingaudithealth-insurance
✓ Decided: Board approves disability pensions, COLA increases, and benefit study

The Metropolitan Employee Benefit Board approved multiple disability pension requests, reexaminations, and deferrals, as well as cost-of-living adjustments for pension plans. The board also approved a study of fertility benefits and awarded a contract for death audit and address verification services.

Tue Nov 5, 2024

Parks and Recreation Board

Parks board to hear safety and security update

The Advocacy Committee of the Metropolitan Board of Parks and Recreation will meet to receive an update on Metro Parks safety and security. No votes or decisions are scheduled; the agenda is limited to a single informational item.

parkssafetysecuritycommittee-meeting
✓ Decided: Parks Board hears safety update, no votes taken

The Advocacy Committee of the Metro Board of Parks and Recreation met on November 5, 2024, and received a presentation from Metro Nashville Police and Parks Police on safety and security measures, including increased patrols, mobile cameras, lighting, social media presence, and hiring challenges. No formal decisions or votes were made during the meeting.

Tue Nov 5, 2024

Parks and Recreation Board

Board to consider renaming Cumberland Park to Wasioto Park

The Parks and Recreation Board will hear community input on a proposal to rename Cumberland Park to Wasioto Park, the original Shawnee name of the Cumberland River. The board will also vote on a consent agenda with numerous event permits and consider several new business items, including a $2 million grant for Mill Ridge Park and a 25-year lease for Lock 1 Park.

parksrenaminggrantsleaseseventspublic-hearing
✓ Decided: Parks Board approves $2M LWCF grant for Mill Ridge Park farm area

The Nashville Parks and Recreation Board approved several items, including a $2 million Land and Water Conservation Fund grant for the 'Farm' area of Mill Ridge Park, with a matching in-kind contribution from the Joe C. Davis Foundation and Friends of Mill Ridge Park. The board also accepted an $83,908.52 in-kind grant from the Centennial Park Conservancy for Parthenon improvements, approved a 25-year lease with the U.S. Army Corps of Engineers for Lock 1 Park, and approved the November consent agenda with event permits. The meeting included public comment on renaming Cumberland Park to 'Wasioto Park' and updates on capital projects and greenways.

Tue Nov 5, 2024

Election Commission

Election Commission to select and audit optical scanners from Nov. 5 election

The Davidson County Election Commission will select five optical scanners from Election Day precincts and one from an Early Voting location for a post-election audit, and schedule the audit for November 14, 2024. The meeting also includes public comments and a reminder of a future meeting on November 22.

electionauditvotingcommissionpublic-comment
✓ Decided: Election Commission selects scanners for post-election audit

The Davidson County Election Commission met and unanimously approved the random selection of six optical scanners from the November 5, 2024 election for a post-election audit. The audit is scheduled for November 14, 2024 at 9:00 a.m. at the DCEC Training Facility. No other substantive decisions were made.

Mon Nov 4, 2024

Human Relations Commission

Human Relations Commission to discuss conciliation agreements, language access, and violence interruption at Nov. 4 meeting

The Metro Human Relations Commission will hold a regular meeting to review and approve minutes, receive a financial update, and discuss old business including a conciliation agreement update, language access, and violence interruption. New business includes committee updates and community engagement. The meeting is open to the public with accommodations available upon request.

human-relationsconciliationlanguage-accessviolence-interruptioncommunity-engagement
Mon Nov 4, 2024

Continuum of Care Homelessness Planning Council

Homelessness council committee to discuss racial equity training and research

The Equity & Diversity Committee of Nashville's Continuum of Care will meet to discuss racial equity training, next steps for research on racial disparities in homelessness, and a draft anti-discrimination policy. The agenda includes routine updates and planning for the next meeting.

homelessnessracial-equityanti-discriminationcommittee-meeting
Mon Nov 4, 2024

Historical Commission

Marker Committee to review two proposed historical markers

The Marker Committee will review proposed language for two privately funded historical markers: Mills and Zibart Bookstores and Tennessee Tribune. No public comment will be taken at this meeting; the full Metro Historical Commission will consider adoption on November 18, 2024, with public comment available then.

historical-markerspublic-hearingnashville
Fri Nov 1, 2024

Metropolitan Council

Metro Council LGBTQ Caucus meets to discuss resolution calendar and events

The Metro Council LGBTQ Caucus is meeting to review the resolution calendar, discuss upcoming events, and hear a presentation from Launch Pad. The agenda also includes a discussion of Belfast's Lord Mayor visit in 2025 and a new caucus leadership position.

lgbtq-caucusmetropolitan-councilnashvilleresolution-calendarlaunch-padbelfast-visit
Thu Oct 31, 2024

Hospital Authority Board

Hospital board to vote on anesthesia and pathology contracts

The Finance Committee of the Metropolitan Hospital Authority Board of Trustees will meet to review and vote on several financial items, including the approval of minutes, financial statements, and two professional service contracts. The committee will also receive updates on the FY24 audit and revenue cycle performance.

hospitalfinancecontractsanesthesiapathology
Thu Oct 31, 2024

Continuum of Care Homelessness Planning Council

Youth Action Board to discuss Coordinated Entry and resources

This is a procedural meeting of the Youth Action Board, a subcommittee of the Continuum of Care Homelessness Planning Council. The agenda includes an overview of Coordinated Entry and available resources, as well as committee interest assessment. No decisions or votes are listed.

homelessnessyouthcoordinated-entryresourcescommittee
Thu Oct 31, 2024

Hospital Authority Board

Hospital board to vote on $441K pathology contract and anesthesia renewal

The Hospital Authority Board will consider approving a new $441,648 annual pathology services contract with Edwards Pathologist Services PLLC and a renewal of the EPIX Anesthesia of Tennessee PLLC agreement worth $3.5 million per year. The board will also vote on revised bylaws, the September meeting minutes, and the August finance report. Several informational reports on hospital utilization, marketing, quality, and the foundation are scheduled.

hospitalcontractsfinancebylawsanesthesiapathology
Wed Oct 30, 2024

Metropolitan Council

Committee seeks input on improving domestic violence case handling

The Metro Council Public Health & Safety Committee is holding a meeting to gather suggestions from stakeholders—including MNPD, the DA's Office, the Sheriff's Office, and multiple courts—on improving Nashville's judicial processes for domestic violence cases. The meeting includes a Q&A with councilmembers and discussion of next steps. No votes or decisions are scheduled; the agenda is focused on information gathering.

public-safetydomestic-violencejudicial-processpolicecourtscommittee-meeting
Tue Oct 29, 2024

Convention Center Authority

Convention Center Authority to hear annual audit report

The Finance & Audit Committee will meet to hear the annual audit presentation from Crosslin and consider approval of previous meeting minutes. The agenda is largely procedural, with the audit report being the main substantive item.

auditfinanceconvention-centerpublic-comment
Mon Oct 28, 2024

Community Review Board

CRB to discuss MOU negotiations, board vacancies, and police safety initiative

The Community Review Board will hold its monthly meeting to discuss routine business including approval of minutes and public comment. Key discussion items include MOU negotiations, filling board vacancies, and the Chief of Police Community Safety Initiative.

community-review-boardpolice-oversightmou-negotiationsboard-vacanciespublic-safety
✓ Decided: Board approves resolution to prioritize officer-involved shooting reviews

The Community Review Board approved a resolution to prioritize the review of officer-involved shooting fatality incidents within its jurisdiction that occurred on or after January 2023. The board also approved the minutes from September 23, 2024, and the Executive Director's report, both unanimously. No other substantive decisions were made; the meeting included reports and discussions on budget, case management, and board vacancies.

Mon Oct 28, 2024

Continuum of Care Homelessness Planning Council

CoC Nominating Committee to review past initiatives and plan November meeting

The Nashville/Davidson County Continuum of Care Nominating & Membership Committee is meeting to debrief past initiatives, including the Homeless Planning Council nomination process and member recruitment. They will also plan the November General Membership Meeting. The agenda is largely procedural with no specific decisions or proposals listed.

homelessnesscontinuum-of-carecommittee-meetingmembershipnashville
Mon Oct 28, 2024

Continuum of Care Homelessness Planning Council

HMIS Policies & Procedures revisions and HMIS Lead evaluation on agenda

The Data & HMIS Oversight Committee will consider recommended revisions to the HMIS Policies & Procedures Manual and review the HMIS Lead's self-evaluation. New business includes an HMIS vendor RFP and a descriptive report of participating agencies.

homelessnesshmisdataoversightpoliciesrfpequity
Mon Oct 28, 2024

Metropolitan Council

Women’s Caucus hears from safety, arts, and community leaders

The Metro Council Women’s Caucus is meeting to hear presentations from the Office of Family Safety, Community Resource Center, Metro Arts, and Judge Allegra Walker. No votes or decisions are scheduled; the agenda is informational and procedural.

women-caucuspresentationsfamily-safetycommunity-resourcesartsjudiciary
Fri Oct 25, 2024

Human Relations Commission

Commission to review bylaws and rules

The Metro Human Relations Commission is holding a committee meeting to review its bylaws and rules. The agenda includes a call to order, quorum confirmation, public comments, old business, and new business focused on the bylaws review.

human-relationsbylawsrulescommission-meeting
Fri Oct 25, 2024

Human Relations Commission

Human Relations Commission to discuss rules update and Friendsgiving event

The Metro Human Relations Commission is meeting to discuss a Rules and Bylaws committee update and a Friendsgiving event. The agenda includes public comments and new business items, with no major decisions or proposals listed.

human-relationsrules-and-bylawspublic-commentsnashville
Thu Oct 24, 2024

Planning Commission

Planning Commission adopts procedural rules, no substantive decisions

This meeting is solely to adopt the commission's internal rules and procedures, which cover membership, meetings, public hearings, and ethical standards. No specific development projects, rezonings, or contracts are being decided or discussed. The agenda is entirely procedural boilerplate.

planning-commissionrules-and-procedurespublic-hearingsethicsmeetings
✓ Decided: Planning Commission approves Talbot's Corner mixed-use rezoning

The Planning Commission approved a 61.41-acre mixed-use Specific Plan rezoning at Talbot's Corner along Dickerson Pike and West Trinity Lane, allowing up to 15-story buildings, a greenway, and new roads. The Commission also approved several other rezoning and subdivision requests, including a 265-room hotel at 751 S. 5th Street and a 260-room hotel at 1500 3rd Ave N. Numerous items were deferred to future meetings, and the Commission adopted its 2025 calendar and amended rules of procedure.

Thu Oct 24, 2024

Metro Action

Metro Action Commission to evaluate interim director and plan search

The Metropolitan Action Commission's Board of Commissioners is meeting as an ad hoc committee to discuss the interim executive director's strategic focus, set 30-60-90 day priorities, establish a performance evaluation framework, and outline a timeline for the executive director search. The agenda is procedural, with no specific decisions or dollar amounts listed.

commissionexecutive-directorevaluationsearchmeeting
Thu Oct 24, 2024

Continuum of Care Homelessness Planning Council

Executive Committee to review minutes, hear updates, and discuss FUP vouchers

The Executive Committee of the Homelessness Planning Council will review minutes from September and October meetings, receive updates from the Office of Homeless Services and the Collaborative Applicant, and discuss new business including a planning session and an application for additional Family Unification Program (FUP) vouchers from MDHA.

homelessnesscontinuum-of-careexecutive-committeefup-vouchersplanning
Thu Oct 24, 2024

Metro Action

Board to vote on $200,000 childcare study with United Way

The Metropolitan Action Commission Board will consider approving a $200,000 childcare study with United Way, along with the CSBG Plan and LIHEAP Operational Plan. The meeting also includes updates from the executive director and various program reports.

board-meetingcontractschildcaregrantscommunity-services
Wed Oct 23, 2024

Social Services Commission

Metro Social Services board meets for routine updates and approvals

The board will call to order, approve the August meeting summary, hear the director's and finance reports, and receive departmental updates. No major decisions or public hearings are scheduled; the agenda is largely procedural.

social-servicesboard-meetingprocedural
Wed Oct 23, 2024

Continuum of Care Homelessness Planning Council

Nashville homelessness council to discuss strategic plan and payment for lived-experience advisors

The Continuum of Care Homelessness Planning Council Consumer Advisory Board is meeting to discuss follow-up on its strategic plan and payment expectations for people with lived experience of homelessness. The agenda also includes welcome, introductions, other business, and next steps. No votes or funding decisions are listed.

homelessnesscontinuum-of-careconsumer-advisory-boardstrategic-planlived-experiencenashville
Wed Oct 23, 2024

Short Term Rental Appeals Board

STR board grants one appeal, denies another at Oct 23 hearing

The Nashville Short Term Rental Appeal Board heard two appeals on October 23, 2024. It granted Joshua Hein's appeal to re-establish a short-term rental permit at 1605 Lischey Ave, allowing him to reapply on November 15, 2024. It denied Robert and Marcia Schell's appeal to re-establish a permit at 1516 14th Ave N, upholding the Zoning Administrator's revocation. Both decisions were unanimous with no abstentions.

short-term-rentalsappealszoningpermitsnashville
Wed Oct 23, 2024

Community Review Board

Executive committee to discuss MOU, bylaws, board vacancies, and police safety initiative

The Community Review Board Executive Committee is meeting to discuss several operational items: a Memorandum of Understanding (MOU), rules and bylaws, board vacancies, and the Chief of Police Community Safety Initiative. The meeting includes a public comment period. No votes or decisions are listed on the agenda.

community-review-boardpolicepublic-safetybylawsboard-vacancies
Wed Oct 23, 2024

Beer Permit Board

Beer board to vote on 21 new permits, 13 deferrals, and 3 violation hearings

The Metro Beer Permit Board will consider 21 applications for new, expanded, or transferred beer permits, including venues like Ethel's Tabernacle Bar, Coral Club, and The Basement East. It will also vote on 13 applications to defer indefinitely due to missing documents, and hold hearings on three alleged underage-sale violations at EZ Mart, 7-Eleven, and Golden Bear #4, with staff recommending civil penalties or suspensions.

beer-permitsalcohol-regulationpublic-hearingsnashvillepermitsviolations
✓ Decided: Beer board approves 21 permits, defers 13, fines Golden Bear $2,000

The Metro Beer Permit Board approved 21 beer permit applications, including new locations, expansions, and ownership changes, and deferred 13 applications indefinitely due to missing documents. The board also withdrew one application, deferred two hearings to November 20, and issued a $2,000 civil penalty to Golden Bear #4 for underage sales, with an option for a 7-day suspension and 30-day probation.

Wed Oct 23, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses

The Sexually Oriented Business Licensing Board will hold a routine meeting to approve minutes, review new and renewal entertainer permits and business licenses for several periods, and hear an inspector's report. The agenda consists entirely of procedural items with no substantive policy decisions or public hearings listed.

sexually-oriented-businesslicensingpermitsnashville
Tue Oct 22, 2024

Nashville Entertainment Commission

Entertainment Commission to elect secretary, hear bylaws update

The Nashville Music, Film and Entertainment Commission will meet to elect a secretary for 2024-2025, hear a guest speaker, and receive reports from committees including an action item on a bylaws update. The meeting also includes updates on budget allocation, an open seat, and recommended code amending legislation.

entertainmentcommissionbylawsbudgetelectionsnashville
Tue Oct 22, 2024

Housing Trust Fund Commission

HTF Commission to review September financials and discuss quarterly progress report

The Housing Trust Fund Commission will review September financials and discuss a quarterly progress report. No items are scheduled for a vote. The commission will also consider combining the November and December meetings into a single session on December 3rd, which would include commissioner training and policy discussion.

housingaffordable-housingbarnes-fundfinancial-updatecommission-meeting
Mon Oct 21, 2024

Historical Commission

Historical Commission to vote on four new historical markers

The Metro Historical Commission will vote on approving four new historical markers honoring Kossie Gardner Sr., the Islamic Center of Nashville, Dr. Robert Fulton Boyd, and Drs. George Whipple Hubbard and William J. Sneed. The meeting also includes a guest speaker, a director's report, and a historic zoning report.

historical-markerspublic-commentguest-speakerzoningnashville
✓ Decided: Historical Commission approves four new historical markers

The Metropolitan Historical Commission approved four historical markers: for Kossie Gardner Sr., the Islamic Center of Nashville, Dr. RF Boyd, and Dr. George Whipple Hubbard/Dr. William J. Sneed. All were approved unanimously. The commission also approved the September 2024 meeting minutes. No other substantive decisions were made.

Mon Oct 21, 2024

Bicycle and Pedestrian Advisory Commission

BPAC to review fatal crash on Nolensville Pike and Main Street/Gallatin Pike project

The Bicycle and Pedestrian Advisory Commission will discuss a fatal crash on Nolensville Pike and a quick-build safety strategy, along with project updates on Main Street/Gallatin Pike. They will also receive updates on the shared-use mobility device program and a docked bike share RFQ. Public comments are invited on any issue.

bicyclepedestriansafetytransportationnolensville-pikemain-streetgallatin-pikeshared-mobility
✓ Decided: BPAC discusses recent fatalities, considers safety recommendations

The commission discussed recent pedestrian and scooter fatalities, including crashes on Nolensville Pike and 4th and Commerce, and considered writing letters of recommendation to MNPD, NDOT, and the Mayor regarding enforcement, infrastructure, and concrete barriers. They approved the September minutes unanimously and received an update on the Main Street/Gallatin Pike project, with construction targeted for 2025-2026. No formal votes were taken on the safety recommendations.

Mon Oct 21, 2024

Auditorium Commission

Auditorium Commission meets Oct 21; agenda not yet detailed

The Metropolitan Auditorium Commission is holding a regular meeting on October 21, 2024. The agenda contains only procedural boilerplate, including a public comment period and standard non-discrimination and ADA accommodation statements. No specific items for decision or discussion are listed.

auditoriumcommissionmeetingnashville
Mon Oct 21, 2024

Hospital Authority Board

Bylaws committee to recommend updated hospital authority bylaws

The Hospital Authority Board's Bylaws Ad Hoc Committee will review and edit the current MNHA Bylaws for recommendation to the full board for approval and adoption. The meeting also includes call to order, conflict of interest disclosures, public comment, and approval of prior meeting minutes.

bylawshospitalgovernance
Mon Oct 21, 2024

Metropolitan Council

Minority Caucus meets for routine business and legislation update

This is a procedural meeting of the Metropolitan Council Minority Caucus. The agenda includes approval of minutes, a treasurer's report, updates on the annual reception and boards/commissions, presentations, and a legislation update. No specific votes or items with dollar amounts are listed.

minority-caucusmetropolitan-councilnashvillelegislationboards-and-commissions
Fri Oct 18, 2024

Continuum of Care Homelessness Planning Council

Homelessness council plans annual Point-in-Time Count

The Point-in-Time Count Subcommittee of the Continuum of Care Homelessness Planning Council is meeting to plan the annual count of people experiencing homelessness. The agenda covers methodology, volunteer recruitment, team assignments, zones, data collection, and targeted strategies such as the youth count. This is a planning meeting for the count, not a final decision-making session.

homelessnesspoint-in-time-countplanningvolunteersdata-collection
Fri Oct 18, 2024

Civil Service Commission

Civil Service Commission to approve dozens of appointments, terminations, and eligibility registers

The Civil Service Commission will vote on a large batch of personnel actions including appointments, terminations/pensions, and eligibility register reports across multiple Metro departments. The agenda is primarily procedural, with no policy discussions or public hearings listed.

civil-servicepersonnelappointmentsterminationseligibility-registersnashville
Thu Oct 17, 2024

Transportation Licensing Commission

TLC to hold public hearings on e-bikes and pedal vehicle rules

The Transportation Licensing Commission will hold public hearings on allowing Class 2 e-bikes under SUMD rules and on pedal vehicle regulations. The commission will also elect officers, approve consent items including new wrecker and passenger vehicle company applications, and review a taxicab address change.

transportationlicensinge-bikespedal-vehiclestowingtaxicabpublic-hearing
Thu Oct 17, 2024

Zoning Appeals Board

Board to hear four zoning appeals including new homes, porch addition, fence variance

The Metropolitan Board of Zoning Appeals will hold a public hearing on four cases: a special exception for two single-family homes at 1532 Neelys Bend Rd, a variance for a front porch addition at 1516 22nd Ave N, an appeal to enclose a porch and staircase at 900 Berry St, and a variance for an 8-foot fence at 1411 McKennie Ave. The board will decide whether to grant each request.

zoningboard-of-zoning-appealsvariancesspecial-exceptionsresidentialnashville
Thu Oct 17, 2024

Arts Commission

Metro Arts Commission to discuss grant funding proposal and approve community arts program criteria

The commission will hear updates from its committees, discuss a proposal recommendation from the Grants & Funding Committee, and vote on criteria and applications for the Community Arts Leaders of Nashville program. The meeting also includes public comment, approval of prior minutes, and a financial report.

artsgrantspublic-commentcommunity-artsnashville
✓ Decided: Arts Commission approves $88,100 internship program

The Metro Arts Commission approved the Community Arts Leaders of Nashville internship program with a budget of $88,100 for 12 host sites, funding internships from January 1 to June 30, 2025. The approval was amended to ensure funding does not come from the operating budget or other grants. The commission also discussed but did not approve grant criteria, deferring to the Grants and Funding Committee for further community engagement and legal review.

Thu Oct 17, 2024

Sports Authority Board

Sports Authority Board to review stadium and arena reports

The Sports Authority Board will meet to discuss stadium project management and progress. The agenda includes updates on the Titans DBE, a Bridgestone Arena assessment, and host facility reports.

sportsstadiumsconstructionnashville
Thu Oct 17, 2024

Emergency Communication District (E-911) Board

E-911 Board to review 2024 audit and contract renewal

The Davidson County Emergency Communication District Board will hear the 2024 audit report, review September financials, and consider a contract renewal for Will Denami. The meeting also includes a public awareness update and the director's report.

e-911auditfinancial-statementcontract-renewalpublic-safety
Wed Oct 16, 2024

Historic Zoning Commission

Historic Zoning Commission reviews 20+ permits for additions, outbuildings, and violations

The Metro Historic Zoning Commission will consider 22 agenda items, including new construction, additions, outbuildings, signage, and violation cases in historic overlay districts across Nashville. The meeting includes a consent agenda for routine permits and public hearings on individual applications.

historic-zoningpermitsadditionsoutbuildingsviolationsnashville
✓ Decided: Commission approves 1906 5th Ave N addition with conditions

The Metro Historic Zoning Commission approved the addition and outbuilding at 1906 5th Avenue North with conditions, including a 12-foot setback and roof modifications. The commission also denied several violation cases, requiring corrections within 90 days. Consent items were approved except for two deferred cases.

Wed Oct 16, 2024

Continuum of Care Homelessness Planning Council

CoC committee to select project application for HUD CoC Builds funding

The Performance Evaluation Committee will discuss updates on the CoC application ranking and consolidated application, then vote on which project to submit for the CoC Builds program. New business includes reallocation and next steps for UHS and MDHA.

homelessnesscontinuum-of-carehud-fundingcoc-buildsnashville
Wed Oct 16, 2024

Metropolitan Council

Public Safety Committee hears domestic violence overview and court review

The Metro Council Public Health & Safety Committee is receiving an overview of domestic violence in Nashville and a review of the court system, followed by recommendations for improvements. No votes or binding decisions are scheduled; the session is informational with Q&A.

public-safetydomestic-violencecourtsfamily-safetycommittee-meeting
Wed Oct 16, 2024

Historic Zoning Commission

Closed legal session; no public business on agenda

The Metro Historic Zoning Commission is meeting but the only listed item is a closed session for legal counsel. No public hearings, applications, or decisions are scheduled for this meeting.

historic-zoningclosed-sessionlegal-counselprocedural
Tue Oct 15, 2024 · 6:30 PM

Metropolitan Council

Council to vote on $150,000 legal settlement and multiple board appointments

The council will consider several appointments and confirmations for boards such as the Contract and Compliance Board, Auditorium Commission, and Finance Director. It will also vote on resolutions including a $150,000 settlement of a claim against the Metro Government (RS2024-708) and a $125,000 settlement from the Self‑Insured Liability Fund (RS2024-774). Additional resolutions involve an amendment to a sole‑source contract with Fusus, LLC for surveillance technology (RS2024-792) and reallocating $3.48 million in American Rescue Plan Act funds for the Office of Family Safety (RS2024-746). The agenda also includes acceptance of health‑related grants from state agencies.

legal-settlementfinanceappointmentsgrantscontracts
Metropolitan Courthouse
Tue Oct 15, 2024

Metropolitan Council

Committee to vote on board appointments and ceremonial resolutions

The Rules, Confirmations, and Public Elections Committee will consider several ceremonial resolutions and vote on appointments to boards and commissions, including the Contract and Compliance Board, Housing Trust Fund Commission, East Bank Development Authority, and others. A late-filed resolution (RS2024-779) approving an EPA grant for air quality monitoring is also on the agenda.

appointmentsboards-and-commissionsceremonial-resolutionsair-qualityfinancehousingeast-bank
Tue Oct 15, 2024

Public Library Board

Library Board to hear reports on Looby Branch, Cyber Seniors, SEIU

The Nashville Public Library Board of Trustees will meet to approve minutes from September, receive reports from the interim director and foundation, and hear staff updates on the Looby Branch, the Cyber Seniors program, and an SEIU update. No major policy decisions or financial actions are on the agenda.

libraryboard-meetingpublic-commentstaff-reports
✓ Decided: Library Board approves updated Special Collections donation form

The Nashville Public Library Board of Trustees unanimously approved an updated Special Collections Book Donation Form with more inclusive language. The board also approved the minutes from the September 17th meeting. No other formal decisions were made; the meeting consisted primarily of reports from staff and the union.

Tue Oct 15, 2024

Metropolitan Council

Council committee to review grants, contracts, and police surveillance tech

The Public Health and Safety Committee will consider resolutions accepting grants and approving contracts for health programs, including WIC, opioid abatement, HIV/AIDS, and air quality monitoring. It will also review a contract amendment for Fusus surveillance technology and an ordinance on criminal participation by Metro employees. The agenda includes several routine grant acceptances and contract approvals.

public-healthgrantspolicesurveillanceordinancecontractsnew-years-eve
Tue Oct 15, 2024

Mechanical, Plumbing, and Electrical Examiners and Appeals Board

Board to hear appeal on plumbing fixture requirement for rehab facility

The Mechanical, Plumbing, and Electrical Examiners and Appeals Board will consider one appeal case (No. 20240051025) regarding a variance request from the plumbing code. The appellant seeks to waive the requirement for drinking fountains in a new I-1 Rehabilitative Services residence hall at 8283 River Road Pike. The meeting also includes public comment, approval of previous minutes, and other business.

plumbingappealspublic-hearingnashvillebuilding-codes
✓ Decided: Board approves drinking fountain variance for Cumberland Heights residence hall

The board approved a variance request from the requirement to provide drinking fountains in a new I-1 rehabilitative services residence hall at 8283 River Road Pike. The applicant will install water dispensers for refillable bottles and water lines for future fountains. The board also approved the August 20, 2024 minutes as written and adjourned.

Tue Oct 15, 2024

Fair Commissioners Board

Fair board reviews $41M capital projects, most near completion

The Fair Commissioners Board is reviewing the status of multiple capital improvement projects at the fairgrounds, including the new Exposition Center, Fair Park Phase 2, and infrastructure work. Most projects are nearly complete, with the Exposition Center at 100% and the Grandstands at 99%, while infrastructure work is only 21% complete. The board is also reviewing a $7.2 million Fair Park Phase 2 project that is 74% complete.

fairgroundscapital-improvementsbudgetconstructionparks
Tue Oct 15, 2024

Farmers Market Board

Farmers Market Board to elect officers, review FY25 finances

The Nashville Farmers' Market Board will meet to elect board officers, receive an executive director's report, and review the FY25 financial report. An update on the Grow Local Kitchen/Commissary Kitchen is also scheduled. Public comments are limited to three minutes per speaker.

farmers-marketboard-meetingelectionsbudgetkitchen
Tue Oct 15, 2024

Nashville Health and Well-being Leadership Council

Council to discuss 2025 Community Health Assessment strategic issues

The Nashville Health & Well-being Leadership Council will discuss strategic issues for the 2025 Community Health Assessment, review a logo proposal, and hear a wrap-up presentation on the Rooted Together Nashville grant. The meeting also includes approval of the stated agenda and August meeting minutes.

healthcommunity-health-assessmentgrantsstrategic-planning
✓ Decided: Council prioritizes housing and economic opportunity for 2025 health assessment

The Nashville Health & Well-being Leadership Council approved its stated agenda and August 20, 2024 meeting minutes. Members prioritized six strategic issues for the 2025 Community Health Assessment, with housing and economic opportunity tying for top votes; final adoption is set for December 17. The council also adopted a tree-themed logo by a 10-4 vote and heard a wrap-up of the Rooted Together Nashville food access grant.

Tue Oct 15, 2024

Metropolitan Council

Committee to vote on grants for parks, library, and greenway connector

The Arts, Parks, Libraries & Entertainment Committee will consider several resolutions accepting grants and cooperative agreements, including funding for a mural at Frankie Pierce Park, maintenance of the Sea Serpent sculpture at Fannie Mae Dees Park, and a grant application for the Opry Mills Greenway Connector. The committee will also discuss a bill to designate a temporary Special Event Zone for New Year's Eve 2024 in downtown Nashville, and receive updates from the Metro Arts Commission and department priorities.

parkslibrariesartsgrantsgreenwaynew-years-evepublic-art
Tue Oct 15, 2024

Historical Commission

Marker Committee to review four proposed historical markers

The MHC Marker Committee will meet to review and select language for four proposed historical markers. No public comment will be taken at this meeting; public input will be accepted at the full Metro Historical Commission meeting on October 21, 2024.

historical-markershistorical-commissionpublic-participationnashville
Tue Oct 15, 2024

Metropolitan Council

Council committee to consider stricter enforcement of pet store dog and cat sales rules

The Government Operations and Regulations Committee will discuss a bill (BL2024-552) that would amend Chapter 8.30 of the Metropolitan Code regarding enforcement of restrictions on retail sales of dogs and cats. The meeting includes a public comment period for items on the agenda. No votes or decisions are recorded in this agenda.

government-operationsanimal-salespublic-commentordinance
Mon Oct 14, 2024

Metropolitan Council

Council to settle Jonathan Saad's Arts Commission claim for $150,000

The Budget and Finance Committee will consider 26 items, including several legal settlements, grant acceptances, and contract approvals. Most items are on the consent agenda, meaning they may be approved in a block without individual discussion. The committee is also reviewing a bill to amend the Fire Prevention Code.

budgetfinancesettlementsgrantscontractspublic-safetyfire-code
Mon Oct 14, 2024

Traffic and Parking Commission

Commission to vote on new metered parking rates, speed limit reductions, and Gulch vending ban

The Traffic and Parking Commission will vote on several items including a new metered parking rate structure with higher rates for longer stays, reduced speed limits on Hermitage Ave/Lebanon Pike as part of Vision Zero, and extending the downtown sidewalk vending ban into the Gulch. The commission will also consider new pedestrian beacons, one-way traffic configurations, and residential permit parking requests.

parkingspeed-limitspedestrian-safetysidewalk-vendingtraffic-calmingvision-zeropublic-transit
✓ Decided: Commission approves speed limit reductions on Hermitage/Lebanon Pike

The Traffic and Parking Commission approved reduced speed limits on Hermitage Ave/Lebanon Pike from Korean Veterans Blvd to Donelson Pike, with the segment from Donelson Pike to the Wilson County Line deferred to December. The commission also approved an expanded metered parking rate structure, a sidewalk vending restriction extension into the Gulch (deferred one month), and several other items. All decisions were made with no objections except for the speed limit motion, which Commissioner Kornutick objected to.

Mon Oct 14, 2024

Metropolitan Council

Planning & Zoning Committee considers 32 items including rezoning and infrastructure

The Planning and Zoning Committee is meeting to discuss and vote on 32 items, including resolutions for road repairs and sewer infrastructure, and bills on second and third reading for zoning changes, historic preservation overlays, and specific plan amendments. Notable items include a resolution for resurfacing 2.624 miles of Franklin Limestone Road ($0), and multiple zoning changes for properties across Nashville.

zoninginfrastructureroadssewerhistoric-preservationmixed-useplanning
Mon Oct 14, 2024

Metropolitan Council

Committee to vote on Franklin Limestone Road resurfacing agreement

The Transportation and Infrastructure Committee is deciding on 11 items, including an intergovernmental agreement with TDOT to repair and resurface 2.624 miles of Franklin Limestone Road, accepting a grant to continue the Food Scrap Pickup Pilot program, and several sewer and water main projects. The meeting also includes public comment and a chair report.

transportationinfrastructureroadssewerwatergrantspublic-works
Mon Oct 14, 2024

Arts Commission

Arts Commission to discuss FY25 grant criteria

The Metro Arts Grants & Funding Committee will meet to explore and potentially take action on criteria for Fiscal Year 2025 grants. The agenda includes public comment, approval of August 2024 minutes, and discussion of new or old business. No specific grant amounts or project names are listed.

artsgrantsfundingpublic-commentcommittee-meeting
Thu Oct 10, 2024

Beer Permit Board

Beer board to vote on 33 new permits, 22 deferrals, and 6 fines

The Metro Beer Permit Board will consider 33 applications for new, transferred, or expanded beer permits, including restaurants, bars, and special event permits. It will also vote on 22 applications to defer indefinitely due to missing documents, and decide on 6 complaints with proposed civil penalties. The meeting includes public comment and approval of previous minutes.

beer-permitsalcohollicensingfinespublic-hearingnashville
✓ Decided: Beer board approves 21 permits, defers 13, fines Golden Bear $2,000

The Metro Beer Permit Board approved 21 beer permit applications, including new locations, expansions, and ownership changes, and deferred 13 applications indefinitely due to missing documents. The board also withdrew one application after staff verified the business had closed, and deferred two hearings to November 20 due to inspector or witness absences. In a contested hearing, Golden Bear #4 was fined $2,000 (or 7-day suspension plus probation) after two ID-check violations were removed.

Thu Oct 10, 2024

Health Board

October Board of Health meeting canceled; next meeting November 14

The October 10, 2024, regular meeting of the Nashville Board of Health has been canceled. The next regular meeting is scheduled for Thursday, November 14, 2024. The agenda contains only procedural boilerplate and a notice about appeal rights for employment decisions.

cancelled-meetingboard-of-healthnashville
Thu Oct 10, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals; affordable housing and outreach off track

The Shelter Committee of the Continuum of Care Homelessness Planning Council met to review current goals and metrics. Several goals are on track, including shelter capacity, encampment plan revision, document readiness, and voucher utilization. However, increasing affordable housing capacity, establishing efficient communication with HPC/Comms/CoC, and identifying outreach capacity are off track. The committee also discussed a revision of the camp engagement plan, the landscape of street outreach, and winter preparations.

homelessnessshelteraffordable-housingoutreachencampmentwinter-preparationsmetrics
Wed Oct 9, 2024

Greenways and Open Space Commission

Commission to walk proposed 440 Greenway route from Sevier Park to Browns Creek Park

The Greenways and Open Space Commission will hold a field trip to walk the proposed route of the 440 Greenway connecting Sevier Park to Browns Creek Park. The meeting includes a call to order, approval of previous meeting minutes, and a public comment period. The walk will use sidewalks, streets, and paved greenway trails.

greenwaysparkstransportationpublic-commentfield-trip
Wed Oct 9, 2024

Industrial Development Board

Industrial Development Board to vote on TNECD grant amendments for Amazon, Holcim

The board will consider approving state grant amendments for Amazon.com Services and Holcim Solutions, and receive a financial update from Metro Finance. Public comment is open at the meeting.

industrial-development-boardgrantsamazonholcimpublic-comment
✓ Decided: IDB approves amendments to Amazon and Holcim state grants

The Industrial Development Board approved amendments to previously approved state grants for Amazon Services, LLC and Holcim Solutions and Products US, LLC, primarily to align dates and reflect a name change. The board also approved the September 11 meeting minutes and discussed a potential small business grant program funded by bond application and closing fees. No public comments were made, and the meeting adjourned at 10:33 a.m.

Wed Oct 9, 2024

Industrial Development Board

Industrial Development Board to discuss small business grants

The Industrial Development Board Ad Hoc Committee will hold a public meeting to discuss small business grants. The agenda includes a public comment period and approval of prior meeting minutes.

industrial-development-boardsmall-business-grantspublic-commentad-hoc-committee
Wed Oct 9, 2024

Continuum of Care Homelessness Planning Council

CoC committees update on funding, charter, and homeless strategy

The Nashville Continuum of Care Homelessness Planning Council's October 2024 meeting provides updates from multiple committees, including the Performance Evaluation Committee's ranking of local CoC grant applications (pending HPC vote), the Data & HMIS Committee's finalized HMIS Policies and Procedures Manual open for public comment until October 4, and the Shelter, Weather, Outreach & Prevention Committee's feedback on the Outdoor Homelessness Strategy. The meeting also covers governance charter revisions, membership recruitment, and preparations for the January 2025 Point-in-Time Count.

homelessnesscontinuum-of-carehmispoint-in-time-countgrant-fundingshelteroutreachgovernance
Wed Oct 9, 2024

Nashville Education, Community and Arts Television Board

NECAT board to discuss financials, chair report, and studio updates

The Nashville Education, Community and Arts Television Board will hold a regular meeting to approve minutes, review financials, hear a chair report, and receive an update from Nashville Public Library on studio operations. No specific decisions or proposals are listed beyond routine business.

televisionpublic-accessnashvilleboard-meetinglibrary
Wed Oct 9, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses from Aug 29–Oct 9

The board will consider new and renewal entertainer permits and business licenses for three periods between August 29 and October 9, 2024. It will also hear the inspector’s report and approve minutes from the August 28 meeting. A public comment period is scheduled.

licensingpermitspublic-commentminutes
Wed Oct 9, 2024

Metropolitan Council

Procurement Process Working Group reviews Metro department procurement data

The Budget & Finance Committee's Procurement Process Working Group will meet to receive a brief overview of the procurement process, review a Metro department procurement summary broken down by dollar amount and number of procurements, and select a department for further review.

procurementbudgetfinancemetropolitan-councilnashville
Tue Oct 8, 2024

Metropolitan Council

Working group reviews salary savings data, plans department follow-up

The Human Resources Working Group of the Budget & Finance Committee will review salary savings data provided by the Finance Department, identify departments for follow-up, and create 3-5 questions for a department questionnaire. No votes or binding decisions are scheduled; the meeting is a discussion and planning session.

budgetfinancehuman-resourcessalaryworking-group
Tue Oct 8, 2024

Metro Development and Housing Agency Board

Board to vote on executive director contract renewal and PILOT deal

The MDHA Board will consider renewing the executive director's contract after a mid-year performance review, and vote on a PILOT agreement for Whispering Oaks. Other items include partial disposition of 101 Gatewood Avenue and a substantial amendment to the HOME-ARP Action Plan. The meeting also includes introduction of new board members and election of board officers.

housingdevelopmentexecutive-directorpilot-agreementboard-electionshome-arp
Tue Oct 8, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup continues work on federal criteria to end veteran homelessness

The Continuum of Care Veterans Workgroup will review data from the Office of Homeless Services and MDHA, continue work on USICH Federal Criteria and Benchmarks for Ending Veteran Homelessness, and receive Built for Zero updates. The meeting includes standard procedural items such as introductions, minutes review, and agency updates.

homelessnessveteransdata-reviewfederal-criteriabuilt-for-zeronashville
Tue Oct 8, 2024

Fair Commissioners Board

Board to consider MOU for new transit stop on Nolensville Pike

The Board of Fair Commissioners will consider a memorandum of understanding with the Metro Transit Authority for construction of an inbound transit stop on Nolensville Pike. The board will also receive monthly informational reports, including a personnel subcommittee recommendation on performance evaluation processes and Employee Handbook updates. Public comment is limited to action items only.

transitfairgroundspersonnelpublic-commentnashville
Tue Oct 8, 2024

Fire and Building Code Appeals Board

Board to hear appeal of fence code violation at 745 Harpeth Pkwy. West

The Fire and Building Code Appeals Board will hold a public hearing and decide on one appeal case: a property owner at 745 Harpeth Pkwy. West requests to keep an existing fence that violates the 2018 IBC code because the contractor was unaware of the requirement that cross beams face the interior. The meeting also includes a public comment period and approval of previous minutes.

fire-and-building-code-appealsfence-codeappealpublic-hearingnashville
✓ Decided: Board approves fence appeal at 745 Harpeth Pkwy. West (7-1)

The Board approved Appeal Case No. 20240083844, allowing the appellant to keep an existing fence at 745 Harpeth Pkwy. West despite a code violation requiring cross beams to face the interior. The approval was based on a constructability/hardship issue with the chain link fence. The motion passed 7-1, with one member voting against. No other substantive decisions were made; the meeting included no public comments and no other business.

Tue Oct 8, 2024

Work Release Commission

Work Release Commission approves two inmates, continues one

The Nashville Work Release Commission reviewed work release applications and approved Ricky Davis and Darnell Whitworth, while continuing Princeton Reece's case. The board also discussed candidates' charges, history, behavior, and treatment programs, along with old business on past approvals and employment.

work-releaseinmatescorrectionsnashville
✓ Decided: Work Release Commission approves two inmates, continues one

The Work Release Commission approved work release for Ricky Davis and Darnell Whitworth, and continued the application of Princeton Reece for further review. The board discussed each candidate's charges, history, institutional behavior, and treatment program participation. No other substantive decisions were made.

Tue Oct 8, 2024

Metropolitan Council

Pets Policy Working Group meets to review MACC audit

The Pets Policy Working Group will meet on October 8, 2024. The agenda includes a presentation by Director Ashley Harrington and a review of the MACC Audit.

petspolicyaudit
Mon Oct 7, 2024

Historical Commission

Marker Committee to review four proposed historical markers

The Marker Committee will meet to select language for four proposed historical markers honoring Kossie Gardner Sr., the Islamic Center of Nashville, Dr. R.F. Boyd, and Dr. George Hubbard/Dr. William Sneed. No public comment will be taken at this committee meeting; public comment will be available at the full Metro Historical Commission meeting on October 21, 2024.

historical-markerspublic-artparticipatory-budgetcommittee-meeting
Mon Oct 7, 2024

Agricultural Extension Board

Extension board hears quarterly updates on agriculture, nutrition, and 4-H programs

The Davidson County Agricultural Extension Board received its Quarter 4 2024 update, covering activities in Agriculture, Family & Consumer Sciences, and 4-H Youth Development. The report highlights school gardens, nutrition classes, farm tours, and 4-H club expansions. No votes or formal decisions are noted; the agenda is a presentation of ongoing programs.

agricultureextension4-hnutritionschool-gardenscommunity-programsnashville
Mon Oct 7, 2024

Human Relations Commission

Human Relations Commission to discuss director salary, conciliation agreement, and anti-hate campaign

The Metro Human Relations Commission will hold a regular meeting to review and approve minutes, receive a financial update, and discuss several items including a director salary increase, a conciliation agreement update, violence interruption efforts, a 'No Hate' campaign, and planning for its 60th Anniversary event. The meeting is open to the public.

human-relationscommission-meetingsalaryconciliationviolence-interruptionanti-hateanniversary
Mon Oct 7, 2024

Continuum of Care Homelessness Planning Council

CoC Equity Committee to review data, plan racial equity training

The Equity & Diversity Committee of Nashville's Continuum of Care will meet to review CoC-funded program data, discuss racial equity training, and plan next steps for research on racial disparities in homelessness. The agenda includes reading the CoC's anti-racism pledge and updates from members.

homelessnessracial-equitytrainingdata-reviewcommittee-meeting
Thu Oct 3, 2024

Metro Development and Housing Agency Board

Housing committee to review voucher funding, payment standards, and plan revisions

The Housing and Community Committee is meeting to discuss Housing Choice Voucher funding and utilization, Small Area Fair Market Payment Standards, and revisions to the HCV Administrative Plan. Board decisions on the payment standards and plan revisions are requested in November. The agenda also includes public comments and approval of previous minutes.

housingvoucherspublic-housingpolicymeeting
Thu Oct 3, 2024

Convention Center Authority

Committee to review FY 2025 sales goals and incentive plan

The Community Relations, Marketing & Operations Committee will meet to discuss FY 2025 sales goals and a sales incentive plan. The agenda also includes approval of August 28, 2023 meeting minutes and a public comment period.

convention-centersalesmarketingoperationspublic-comment
Thu Oct 3, 2024

Parks and Recreation Board

Parks board holds work retreat with team building and hike

This is a procedural work session focused on team building and alignment activities, not a decision-making meeting. The board will participate in morning exercises, lunch, a hike, and afternoon discussions before concluding with reflections.

parksrecreationteam-buildingretreatnashville
Thu Oct 3, 2024

Metro Development and Housing Agency Board

Committee to vote on Whispering Oaks PILOT agreement

The Finance and Development Committee will consider a PILOT agreement for Whispering Oaks and discuss the South 5th Street Sewer Separation project. The meeting also includes approval of prior minutes and public comments.

housinginfrastructurepilot-agreementsewerdevelopment
Thu Oct 3, 2024

Stormwater Management Commission

Stormwater Commission to hear Nashville Gun Club floodway variance

The Stormwater Management Commission will consider two variance requests: Nashville Gun Club seeks floodway disturbance for a building and compensating cut, and Harris Neelys Bend Road requests a box culvert for a stream crossing. Two cases are deferred to November. The meeting also includes approval of prior minutes and decision letters.

stormwaterfloodwayvariancepublic-hearingnashville
Thu Oct 3, 2024

Downtown Code Design Review Committee

Parcel 9 signage entitlements review for Nashville Yards

The Downtown Code Design Review Committee is reviewing a proposal for signage entitlements on Parcel 9 of the Nashville Yards development. The proposal includes skyline, digital, and tenant signage across multiple building elevations, with several signs noted as noncompliant due to size or height exceeding code limits. The committee will decide whether to approve the requested sign area and variances.

signagedowntown-codedesign-reviewnashville-yardsparcel-9variancesdigital-signage
Thu Oct 3, 2024

Zoning Appeals Board

Zoning board to hear 9 appeals including batting facility, billboard, and housing projects

The Metropolitan Board of Zoning Appeals will hear nine cases, including requests for special exceptions, variances, and appeals. Items range from an indoor batting facility on Highway 70 to a digital billboard conversion on Massman Drive and multiple residential construction projects. One case (2024-220) has been withdrawn by the appellant, and another (2024-225) is deferred to a later meeting.

zoningvariancesspecial-exceptionsbillboardhousingcommercial-developmentpublic-hearing
Wed Oct 2, 2024

Continuum of Care Homelessness Planning Council

CE Oversight Committee to review Coordinated Entry policies

The committee will discuss updates from the CE Core Working Group and review a draft of Coordinated Entry policies and procedures. The meeting also includes an evaluation discussion update from the committee chair meeting.

homelessnesscoordinated-entrypolicy-reviewnashville
Wed Oct 2, 2024

Health and Educational Facilities Board

Vanderbilt seeks $450M in tax-exempt bonds for medical center expansion

The board will hold a public hearing and vote on final approval for Vanderbilt University Medical Center to issue up to $450 million in tax-exempt revenue bonds. The bonds would fund projects at VUMC's main campus, 56 White Bridge Road, and 3319 West End Avenue. The board will also elect an assistant secretary and discuss legal representation.

bondshealthcarepublic-hearingvanderbilt
Tue Oct 1, 2024

Parks and Recreation Board

Parks Board to approve two conservation greenway easements

The board will vote on dedicating conservation greenway easements at 2600 Pennington Bend Rd (0.37 acres) and 0 Maxwell Road (1.86 acres) to expand the Cumberland River and Hurricane Creek greenways. It will also consider a consent agenda with numerous event permits, a $900 USTA Tennis Hosting grant, and a charity pickleball tournament. Presentations include an East Bank development update and annual reports from Friends of Metro Parks disABILITIES and Friends of Metro Dance.

parksgreenwaysconservationeventsgrantseast-bank-developmentnashville
✓ Decided: Board accepts two greenway easements for future trail expansion

The Board approved the acceptance of two dedicated conservation greenway easements: one at 2600 Pennington Bend Rd (0.37 acres) for the Cumberland River Greenway and one at 0 Maxwell Road (1.86 acres) for the Hurricane Creek Greenway. Both were accepted as part of development conditions. The Board also approved the October consent agenda, including various event permits, and accepted a $900 USTA Tennis Hosting grant.

Tue Oct 1, 2024

Parks and Recreation Board

Board to vote on two conservation greenway easements

The Parks and Recreation Board Acquisition Committee will consider approving two conservation greenway easements: one on Pennington Bend Rd (0.37 acres) for the Cumberland River Greenway, and one on Maxwell Road (1.86 acres) for the Hurricane Creek Greenway. Both are conditions of development approvals.

parksgreenwaysconservationeasementsdevelopment
✓ Decided: Parks board recommends two greenway easements for approval

The Acquisition Committee recommended approval of two dedicated Conservation Greenway Easements: one on 0.37 acres at 2600 Pennington Bend Rd to expand the Cumberland River Greenway, and another on 1.86 acres at 0 Maxwell Road to expand the Hurricane Creek Greenway. Both recommendations will go to the full Board of Parks and Recreation for final action.

Tue Oct 1, 2024

Metropolitan Council

Council committee to vote on $11,616 library afterschool grant and park grant

The Arts, Parks, Libraries & Entertainment Committee will consider two resolutions: one appropriating $11,616 from the Nashville Public Library to Elmington Elevates for afterschool programming, and another approving a BlueCross Healthy Places in-kind grant for improvements at Cedar Hill Park in Madison. Public comment is allowed on these items.

parkslibrariesgrantsafterschool-programspublic-comment
Tue Oct 1, 2024

Metropolitan Council

Committee to consider building material restrictions for 250-unit development on West Trinity Lane

The Rules, Confirmations, and Public Elections Committee will consider a late-filed substitute ordinance that would impose building material restrictions on a proposed 250-unit multi-family development at 847 and 865 West Trinity Lane. The committee will also vote on several board and commission appointments, including a new Finance Director, and consider a resolution recognizing the Nashville Public Education Foundation's 20th anniversary.

zoninghousingdevelopmentfinanceappointmentspublic-lands
Tue Oct 1, 2024

Metropolitan Council

Council committee to review domestic violence stats and ARPA fund reallocations

The Public Health and Safety Committee is meeting to hear a presentation on domestic violence statistics in Davidson County and to vote on several resolutions, including reallocating American Rescue Plan Act funds and approving grants and contracts. The agenda includes both substantive items and routine approvals.

public-healthpublic-safetydomestic-violencegrantsarpa-fundspolicecontracts
Tue Oct 1, 2024

Continuum of Care Homelessness Planning Council

CE Oversight Committee meets to brainstorm initiatives and timeline

The CE Oversight Committee of the Nashville/Davidson County Continuum of Care is holding a meeting to discuss past initiatives, brainstorm new committee initiatives and a timeline, and outline next steps. The agenda includes standard procedural items such as welcome, introductions, conflicts of interest disclosure, and a values & equity statement. No specific decisions or proposals are listed.

homelessnesscontinuum-of-careoversightnashvilleplanning
Tue Oct 1, 2024

Employee Benefit Board

Employee Benefit Board reviews health plan utilization and pension cases

The Metropolitan Employee Benefit Board will consider disability and service pension requests, hear appeals, and review utilization reports from Blue Cross Blue Shield and CIGNA, including updates on Humira biosimilars and 2025 formulary changes. The meeting also includes a public comment period and approval of previous minutes.

employee-benefitspensionshealth-insurancepublic-commentnashville
✓ Decided: Board approves disability pensions, defers two injury claims

The Metropolitan Employee Benefit Board approved two new disability pension requests, deferred two others pending clarification, and continued several reexaminations. It also approved service pensions, disability-to-service conversions, survivor benefits, and social security referrals. The meeting was procedural with no public comments.

Tue Oct 1, 2024

Metro Development and Housing Agency Board

Board reviews executive director's mid-year performance and contract renewal

The Management Review Committee will conduct a mid-year review of the Executive Director's 2024 performance and discuss renewal of the Executive Director's contract. The meeting includes public comments and approval of prior minutes.

housingexecutive-directorperformance-reviewcontract-renewal
Tue Oct 1, 2024

Employee Benefit Board

Employee Benefit Board Medical and Life Committee to hear Cigna PPO appeal

The Medical and Life Committee of the Metropolitan Employee Benefit Board will meet on October 1, 2024, to discuss a self-insured Cigna PPO plan appeal involving a dependent of a pensioner from the Fire Department. The agenda includes a public comment period for up to five speakers.

employee-benefitspublic-commentinsurance-appealfire-department
Tue Oct 1, 2024

Metropolitan Council

Council committee to weigh beer permit exemption, short-term rental rules

The Government Operations and Regulations Committee will consider three items: a resolution to exempt Kore on Chapel Avenue from minimum distance requirements for a beer permit, a bill amending short-term rental property regulations, and a resolution accepting a state grant for digital access facilities. Public comment is limited to eight minutes total.

alcohol-permitsshort-term-rentalsdigital-accessgrantspublic-hearing
Tue Oct 1, 2024

Fair Commissioners Board

Fair Board sub-committee to review director and staff performance evaluations

The Personnel Sub-Committee of the Board of Fair Commissioners is meeting to discuss performance evaluations for The Fairgrounds Nashville Director and staff, as well as general personnel processes. No votes or decisions are listed on the agenda; the meeting is limited to discussion and new business.

fairgroundspersonnelperformance-evaluationsnashville
✓ Decided: Fair Board subcommittee sets April deadline for director performance review

The Personnel Sub-Committee of the Board of Fair Commissioners met and discussed performance evaluations, personnel processes, and the employee handbook. They decided to recommend to the full board that the director's performance review be completed by April, with the vice-chair to complete it if the chair does not, and that the staff evaluation process remain unchanged. They also agreed to recommend updating the employee handbook, which had not been revised since 2018. No formal votes were taken; these are recommendations for the next regular board meeting.

Tue Oct 1, 2024 · 6:30 PM

Metropolitan Council

Council to consider zoning changes and board appointments

The Metropolitan Council is meeting to vote on several zoning amendments and the appointment of officials to various city boards and commissions. The agenda includes public hearings on short-term rental regulations and specific property rezonings.

zoningappointmentsshort-term-rentalshistoric-preservationhousing
Metropolitan Courthouse
Mon Sep 30, 2024

Metropolitan Council

Committee to reallocate $15M in ARPA funds for Cayce Place infrastructure

The Transportation and Infrastructure Committee will consider 10 resolutions, including reallocating $15 million in ARPA funds for Cayce Place infrastructure, approving an interlocal agreement with Belle Meade for traffic signal work, and authorizing the purchase of a flood-prone property on Ardee Avenue. Several items involve amendments to previous ordinances for sewer and water main work at specific properties.

transportationinfrastructurearpa-fundscayce-placesewerwatertraffic-signalsflood-prone-property
Mon Sep 30, 2024

Metropolitan Council

Council considers $860M bond issue and $500K for financial counseling

The Budget and Finance Committee will consider 29 resolutions, including a major $860 million general obligation bond issuance, a $500,000 grant to United Way for financial counseling for low-income residents, and multiple reallocations of American Rescue Plan Act funds. The committee will also vote on several tax-incentive agreements for affordable housing projects and various grants and settlements.

budgetbondsaffordable-housinggrantsarpa-fundsfinancial-counselingpublic-safety
Mon Sep 30, 2024

Metropolitan Council

Council committee to consider $11.7M in affordable housing grants and multiple PILOT agreements

The Planning and Zoning Committee will hear a capital improvements budget kickoff presentation and vote on resolutions including reallocating ARP funds for affordable housing, authorizing PILOT agreements for three multi-family projects, and approving up to $11.7 million in Barnes Fund grants for affordable housing construction and rehabilitation. The committee will also consider a zoning change for properties on Arthur Avenue and several sewer/water infrastructure amendments.

zoningaffordable-housingbudgetcapital-improvementspublic-housinginfrastructuregrants
Fri Sep 27, 2024

Continuum of Care Homelessness Planning Council

Housing Opportunities Committee sets priorities and scope

The Housing Opportunities Committee of the Continuum of Care Homelessness Planning Council will discuss its priorities, scope, and the Unified Housing Strategy. The meeting also covers determining meeting frequency and identifying potential committee members. No votes or decisions are recorded; the agenda is procedural and discussion-oriented.

homelessnesshousingcontinuum-of-carecommitteenashville
Thu Sep 26, 2024

Arts Commission

Arts Commission to vote on officer slate for 2024-2025 at special called meeting

This is a special called meeting of the Metro Arts Commission. The main action item is a vote on the Nominating Committee's recommendation for the 2024-2025 officer slate. The meeting also includes public comment and approval of previous minutes.

arts-commissionboard-meetingofficer-electionnashville
Thu Sep 26, 2024

Planning Commission

Planning Commission to vote on 320-unit apartment complex, mixed-use projects

The Metropolitan Planning Commission will consider 21 development items, including a 320-unit apartment complex at 54th Avenue North, a 120-home subdivision on Cane Ridge Road, and several mixed-use rezoning requests. Most items are recommended for deferral to October 24, 2024, while a few are slated for approval. The commission also will accept new employee contracts and a report on green streets performance metrics.

planning-commissionzoninghousingmixed-usesubdivisionrezoningdevelopment
✓ Decided: Planning Commission approves R Manuel Centennial SP amendment for 320 units

The Planning Commission approved an amendment to the R Manuel Centennial Specific Plan, allowing up to 320 multi-family residential units and a height increase to five stories in Zone 1 at 54th Avenue North. The Commission also approved a rezoning for 120 single-family lots at Cane Ridge Road, a mixed-use development at 12th Avenue South & Beechwood, a final plat for Cedars of Cane Ridge Phase 1, a Starbucks drive-through in Madison, and a rezoning to industrial at Haynie Avenue. Several items were deferred to the October 24, 2024 meeting, including the Marina Grove and Talbot's Corner rezoning requests.

🏢 Building at this address: 5 m tall
Thu Sep 26, 2024

Continuum of Care Homelessness Planning Council

Executive Committee to review minutes and plan upcoming meetings

The Executive Committee of the Homelessness Planning Council will meet to review minutes from previous meetings, receive updates from the Office of Homeless Services and other committees, and discuss planning for the October HPC agenda, member orientation, and a board retreat. The agenda is largely procedural with no major decisions or funding items listed.

homelessnesscontinuum-of-careexecutive-committeemeeting-minutesplanning
Thu Sep 26, 2024

Investment Committee

Investment Committee reviews pension performance and investment recommendations

The Metropolitan Employee Benefit System Investment Committee will review 1st Quarter 2024 pension performance and consider various investment recommendations. The meeting includes updates on operations, new policies, and private market guidelines.

pensionfinanceinvestmentsgovernment-benefits
✓ Decided: Committee approves $73M in new private equity and credit commitments

The Investment Committee approved three new investment commitments totaling up to $73 million: $30 million to Axiom Asia Fund VII, $33 million to Centerbridge Capital Partners V, and a $10 million increase to Pimco Corporate Opportunities Fund IV. The committee also approved a new Travel Policy, a Liquidity Discretion Policy, and an amendment to the Investment Policy Statement. All votes were unanimous.

Thu Sep 26, 2024

Hospital Authority Board

Finance Committee to vote on $3.4M emergency physician contract and other spending

The Metropolitan Hospital Authority Board Finance Committee will consider approving several contracts and capital expenditures, including a $3.37 million amendment for Southeastern Emergency Physicians, a $533,928 cath lab HVAC construction project, and a $1 million Oracle device refresh. The committee will also review unaudited financial statements for May, June, and July 2024, and hear a revenue cycle update.

hospitalfinancecontractscapital-expenditurebehavioral-healthemergency-services
Thu Sep 26, 2024

Work Release Commission

Work Release Commission approves 3 inmates for work release

The Work Release Commission Board reviewed and approved work release applications for three inmates, continued one application, and discussed candidates' charges, history, behavior, and treatment programs. The meeting also covered past approvals and continued employment.

work-releasecorrectionsinmatesnashville
✓ Decided: Work Release Commission approves three inmates, continues one

The Work Release Commission reviewed applications and approved work release for Paul Aniel, Jonathan Johnson, and Pamela Davis. Anthony Conrad's application was continued for further review. The board discussed candidates' charges, history, behavior, and treatment programs.

Thu Sep 26, 2024

Metro Action

Metro Action Commission to vote on Head Start reports, CSBG plan, and staff changes

The Metropolitan Action Commission Board of Commissioners will consider approving the August 22, 2024 meeting minutes, appoint an Executive Director Evaluation Ad Hoc Committee, and vote on several items including Head Start and Early Head Start Program Information Reports for FY24, the Community Services Block Grant (CSBG) Plan, and job descriptions/position changes/organization restructure. The meeting also includes reports from the Executive Director, Finance, and various program areas.

head-startcsbgboard-meetingpersonnelfinancecommunity-services
✓ Decided: Interim executive director appointed; search continues after offer declined

The board unanimously appointed Oluwadamilola Dairo as interim executive director and formed an ad hoc committee to continue the executive director search, after the person offered the position declined. The board also approved Dr. Stephanie Ross as Early Education Director, approved job description changes, and appointed a Policy Council representative. The financial report was deferred pending certification.

Thu Sep 26, 2024

Hospital Authority Board

Hospital board to vote on $372K emergency physician contract increase

The Hospital Authority Board will consider approving several contracts and capital expenditures, including a $372,855 annual increase for Southeastern Emergency Physicians, a $533,928 HVAC project for cath lab construction, and a $1,000,698.97 Oracle device refresh. The board will also elect officers for fiscal year 2025 and receive committee and financial reports.

hospitalcontractsbudgetcapital-expendituresboard-elections
Wed Sep 25, 2024

Continuum of Care Homelessness Planning Council

CAB sustainability and strategic planning discussion

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board will meet to discuss sustainability and strategic planning. The agenda includes breakout sessions and other business items.

homelessnessplanningconsumer-advisory-boardstrategic-planning
Wed Sep 25, 2024

Beer Permit Board

Beer board to consider 16 new permits, 9 deferrals, 2 violations

The Metro Beer Permit Board will vote on 16 applications for new or expanded beer permits, including on-sale, off-sale, caterer, and special event permits at locations across Nashville. The board will also consider deferring 9 applications due to missing documents, and will hold hearings on two alleged underage sale violations with recommended civil penalties. One applicant, Von Elrod's, has requested to withdraw its special event application.

beer-permitsalcohollicensingpublic-hearingsviolationsnashville
✓ Decided: Beer Permit Board meeting cancelled due to lack of quorum

The September 25, 2024 meeting of the Metropolitan Beer Permit Board was cancelled because no quorum was present. All agenda items, including applications, hearings, and board discussions, were moved to the next meeting agenda. No decisions were made.

Wed Sep 25, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses for two periods

The Sexually Oriented Business Licensing Board will hold a public comment period, approve August meeting minutes, and review new and renewal entertainer permits and business licenses for two date ranges. The agenda is largely procedural, with no substantive policy decisions or public hearings listed.

licensingpermitspublic-commentminutesinspector-report
Wed Sep 25, 2024

Metropolitan Council

Council group reviews non-profit grant process timeline

The Budget & Finance Committee's Non-Profit Funding Process Working Group is meeting to review the history and current state of the city's grant-making process. The group will discuss suggested timeline updates, updates from departments that give grants, and activities that might need a home. No final decisions are on the agenda; the meeting is primarily for discussion and planning next steps.

budgetfinancenon-profitgrants
Wed Sep 25, 2024

Short Term Rental Appeals Board

STR board grants 3 appeals, denies 1 for Nashville rentals

The Nashville Short Term Rental Appeal Board heard four appeals on 9/25/2024 from property owners seeking to re-establish the ability to legally operate short-term rental properties. The board granted appeals for properties on Clifton Ave, Brick Church Ln, and Baptist World Center Dr, and denied the appeal for a property on S 20th St. All decisions were unanimous with no dissenting votes.

short-term-rentalsappeals-boardzoningnashville
Tue Sep 24, 2024

Housing Trust Fund Commission

Housing Trust Fund to vote on contract amendments and policy changes

The Metropolitan Housing Trust Fund Commission will vote on several contract amendments for Round 10 grantees, including extensions for six organizations and a budget revision for Urban Housing Solutions. The commission will also discuss policy changes such as counting bedrooms instead of units and adjusting AMI thresholds, as well as a timeline for Round 15 grants.

affordable-housinghousing-trust-fundcontract-amendmentspolicy-discussiongrantsnashville
✓ Decided: Housing Trust Fund approves Round 10 contract extensions and Round 15 timeline

The commission unanimously approved six Round 10 contract extensions for various affordable housing projects, a proposed Round 15 funding timeline, and a new progress report policy. They also discussed potential policy changes for future rounds, including counting bedrooms instead of units and adjusting AMI thresholds, but took no formal action on these topics.

Tue Sep 24, 2024

Arts Commission

Arts Commission committee to define equity and antiracism terms

The Anti-Racism and Equity Committee of the Metro Arts Commission will meet to discuss and potentially approve definitions for equity and antiracism, conduct a preliminary review of guidelines, and prioritize goals for fiscal year 2025. The meeting includes public comment and approval of prior minutes.

artsequityantiracismguidelinesgoals
Tue Sep 24, 2024

Equalization Board

Board hears property tax appeals for 18 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for 18 commercial properties across Nashville and Goodlettsville, all filed by Evans & Petree. The board will also take public comment, approve prior minutes, and handle old and new business. Decisions may be appealed to the State Board of Equalization.

property-taxequalization-boardcommercial-propertyappealsnashville
✓ Decided: Board approves property value changes for 10 Nashville-area appeals

The Metropolitan Board of Equalization approved value changes for 10 of 14 property tax appeals, denied changes for 4, and withdrew 2 appeals at the appellant's request. All approved changes were unanimous and applied a sale ratio of 0.7143 to reduce assessed values. The board also approved the meeting minutes and adjourned.

Tue Sep 24, 2024

Equalization Board

Board hears 20 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 20 commercial properties, including parcels on Rivergate Pkwy, Broadway, and Nolensville Pike. The board, appointed by the mayor and confirmed by the council, hears appeals of property assessments. Decisions may be appealed to the State Board of Equalization.

property-taxappealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves property value reductions for 10 Nashville-area hotels

The Metropolitan Board of Equalization approved reduced property assessments for 10 commercial properties, mostly hotels, using a sale ratio of 0.7143, and denied changes for 4 others. Two appeals were withdrawn at the appellant's request. All decisions were unanimous.

Tue Sep 24, 2024

Metropolitan Council

Women’s Caucus hears progress reports from sexual assault and violence prevention groups

The Metro Council Women’s Caucus is meeting to hear progress reports from the Sexual Assault Center, Raphah Institute, and United Way. The group will also vote on new business for the 2024-2025 term and approve previous meeting minutes.

sexual-assaultviolence-preventionsocial-servicescouncil-caucus
Mon Sep 23, 2024

Metro Development and Housing Agency Board

Board reviews executive director performance and contract renewal

The Management Review Committee will conduct a mid-year review of the Executive Director's 2024 performance and discuss contract renewal. The meeting includes public comments and approval of prior minutes.

housingexecutive-directorperformance-reviewcontract-renewal
Mon Sep 23, 2024

Continuum of Care Homelessness Planning Council

HMIS lead evaluation process to be developed

The Data & HMIS Oversight Committee will develop an evaluation process for the HMIS lead and discuss research support for CoC committees, including outdoor homelessness strategy and equity research. The meeting includes review of prior minutes and conflict of interest disclosures.

homelessnesshmisdataoversightequitynashville
Mon Sep 23, 2024

Community Review Board

Community Review Board to discuss sexual misconduct policy and MOU negotiations

The Community Review Board is holding its monthly meeting to discuss several policy updates and ongoing negotiations. Key items include a report on the Sexual Misconduct Policy, updates on MOU negotiations, and a status update on a 61-page complaint investigation. The board will also consider a whistleblower policy update and rules and bylaws changes.

community-review-boardsexual-misconduct-policymou-negotiationswhistleblower-policyrules-and-bylawsinvestigationnashville
✓ Decided: CRB approves five administrative case closures, advances MOU talks

The Community Review Board approved five administrative case closures, including cases withdrawn, resolved via mediation, or not meeting investigation criteria. The board also discussed ongoing MOU negotiations with MNPD, aiming for a vote on a final agreement at the next meeting, and received updates on the Zero Tolerance Sexual Misconduct Policy implementation and outreach events.

Mon Sep 23, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 30 commercial properties across Nashville and Davidson County. The board, an independent body appointed by the mayor and confirmed by the council, will decide on property tax assessments; decisions can be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves property value changes for 14 appeals, withdraws 12

The Metropolitan Board of Equalization heard 26 property assessment appeals on September 23, 2024. It approved value changes for 14 properties, denied changes (no change) for 5 Walmart properties, and withdrew 12 appeals at the appellants' request. One appeal was continued to the next day. All decisions were unanimous.

Mon Sep 23, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 30 commercial properties. The board, which is independent from the Office of Assessments, will hear appeals from Evans & Petree at 8:30 AM and 1:00 PM. Decisions may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationpublic-hearing
✓ Decided: Board approves property value changes for 14 appeals

The Metropolitan Board of Equalization heard 26 property assessment appeals on September 23, 2024. The board approved value changes for 14 properties, denied changes for 5 Walmart properties, and withdrew 10 appeals at the appellant's request. One appeal was continued to the next day.

Fri Sep 20, 2024

Continuum of Care Homelessness Planning Council

Subcommittee plans annual homeless count methodology and volunteer logistics

The Point-in-Time Count Subcommittee of the Continuum of Care Homelessness Planning Council will meet to plan the methodology for the annual homeless count, including HUD worksheet review, volunteer recruitment, team assignments, zones, data collection, and youth count strategies. A draft timeline will be discussed. The meeting includes a values and equity statement reading.

homelessnesspoint-in-time-countvolunteersdata-collectionyouthnashville
Fri Sep 20, 2024

Metro Action

Metro Action Commission to discuss executive director candidates

The board will hold an executive committee meeting to discuss candidates for the executive director position. The agenda includes a call to order and adjournment, with the main item being candidate discussion.

metropolitan-action-commissionexecutive-directorpersonnelnashville
✓ Decided: Executive committee discusses executive director candidates

The meeting was called to order and included a discussion of executive director candidates. No formal decisions or votes were recorded; the meeting adjourned without substantive action.

Thu Sep 19, 2024

Continuum of Care Homelessness Planning Council

Youth Advisory Board meets to discuss school initiatives and mental health support

The Continuum of Care Homelessness Planning Council's Youth Advisory Board is meeting to discuss updates, follow-ups on school initiatives and mental health/peer support, and new business. The agenda includes standard procedural items such as welcome, introductions, and adjournment.

homelessnessyouthmental-healthschool-initiativespeer-supportcontinuum-of-care
Thu Sep 19, 2024

Zoning Appeals Board

Board to hear 13 zoning appeals including batting facility, church expansion, and bank

The Metropolitan Board of Zoning Appeals will consider 13 cases, including two deferred from August: a special exception for an indoor batting facility at 9022 Highway 70 and a Sunday school/gym addition for St. George Coptic Orthodox Church at 2412 Foster Ave. New items include variances for a roof over a front deck at 628 Georgetown Dr, a monument sign at 2510 Gallatin Ave, a kennel at 6268 Nolensville Pike, a townhome building at 605 C 21st Ave N, a bank at 4026 Lebanon Pike, and several residential additions. The board will decide on each request after public hearing.

zoningvariancesspecial-exceptionsnashvilleboard-of-zoning-appealspublic-hearing
Thu Sep 19, 2024

Emergency Communication District (E-911) Board

E-911 board to review August finances, hear director report

The Davidson County Emergency Communication District board will meet to approve August meeting minutes, review the August financial statement, receive a public awareness update, hear the director's report, and introduce the new Metro Radio Shop manager. The board will also hold an election for the TENA board.

Thu Sep 19, 2024

Transportation Licensing Commission

TLC proposes allowing pedal vehicles on Broadway during evening rush with approved routes

The Transportation Licensing Commission is proposing rule amendments to allow pedal vehicles to operate during the 4-6 p.m. weekday rush hour on approved routes, and to establish new slow/no-ride zones for shared micromobility devices (SUMDs) including on Broadway, 2nd Avenue, and Vanderbilt University areas. The changes also include a potential no-ride zone at Nashville Yards if approved.

pedal vehiclesshared micromobilityrush hourno-ride zonestransportation licensing
✓ Decided: TLC revokes taxi permit, approves pedal vehicle rule change

The Transportation Licensing Commission revoked the taxicab driver permit of Youssef Shehata Micheal (5-0) after an emergency suspension hearing. It also approved a rule change limiting pedal vehicle operations during rush hours (3-2), and approved a docked bikeshare RFQ with added local experience criteria (5-0).

Thu Sep 19, 2024

Wastewater Hearing Authority

Wastewater board to discuss FOG policy revisions and enforcement

The Wastewater Hearing Authority is meeting to review and approve prior meeting minutes, discuss revisions to the FOG (fats, oils, and grease) policy draft, and receive an update on the FOG Enforcement program. The board will also honor outgoing members Mr. Gilles and Dr. Thackston for their years of service.

wastewaterfog-policyenforcementboard-meetingpublic-utilities
✓ Decided: Wastewater Hearing Authority approves updated FOG policy

The Authority unanimously approved the revised FOG (Fats, Oils, and Grease) Policy, which includes new requirements such as sink strainers for food service industries and codifies previously enacted changes. The Authority also reviewed 117 outstanding permit violations, with a focus on significant threats to the collection system, and discussed an upcoming Enforcement Response Guide for the December meeting.

Thu Sep 19, 2024

Procurement Standards Board

Procurement Standards Board reviews sole source procurement rules

The board is discussing proposed updates to Regulation 4.12.060, which governs sole source procurement for Metro. The regulation outlines conditions, negotiation requirements, and record-keeping for purchases made from a single supplier. A list of items approved for sole source procurement is included, such as pharmaceuticals, utilities, and subscriptions.

procurementsole-sourceregulationpurchasingmetro-government
✓ Decided: Board approves sole-source regulation change

The Procurement Standards Board unanimously approved a modification to Regulation 4.12.060, requiring suppliers to agree to standard terms before a sole source is granted and clarifying that services available from only one source may bypass the sole source process. The board also approved the previous meeting's minutes and received a presentation on the FY 25 Procurement Strategy, which was discussed but not formally voted on.

Wed Sep 18, 2024

Historic Zoning Commission

MHZC to review 20+ preservation permits, including demolition hardship case

The Metro Historic Zoning Commission will consider 20 applications for work in historic overlays, including new construction, additions, signage, and a demolition hardship request at 1619 B Boscobel. Several items are flagged for notification or deferral issues. The meeting also includes adoption of prior minutes and commissioner training.

historic-preservationzoningpermitsdemolitionsignagenashville
✓ Decided: Commission approves demolition of 1619 B Boscobel on economic hardship grounds

The Metro Historic Zoning Commission approved the full demolition of structures at 1619 B Boscobel, citing the building's condition, a Property Standards demolition order, and economic hardship. The commission also approved several new construction and infill projects with conditions, and denied two applications for non-compliance with design guidelines. The meeting minutes were adopted and the agenda was approved with revisions.

Wed Sep 18, 2024

Continuum of Care Homelessness Planning Council

Committee to rate new and domestic violence bonus CoC funding applications

The Performance Evaluation Committee will rate new and domestic violence bonus Continuum of Care funding applications as an action item. The meeting also includes updates on CoCBuilds NOFO, FY2024-2025 CoC funding competition, and the Youth Homelessness Demonstration Program submission.

homelessnessfundingcontinuum-of-caregrantsdomestic-violenceyouth
Wed Sep 18, 2024

Community Review Board

Community Review Board to discuss sexual misconduct debrief and MOU update

The Executive Committee of the Community Review Board is meeting to discuss a debrief with Metro City Council on the NCRB Zero Tolerance Sexual Misconduct policy, an update on a Memorandum of Understanding (MOU), and remarks from a U.S. Department of Justice official. The meeting includes public comment and is otherwise routine.

community-review-boardsexual-misconductmoupublic-safetycity-council
Wed Sep 18, 2024

Arts Commission

Nominating Committee to recommend 2024-2025 slate of officers

The Nominating Committee of the Metro Arts Commission will meet to discuss and make recommendations for the full Commission, including a slate of officers for the 2024-2025 term. The agenda includes public comment, approval of prior minutes, and action items.

arts-commissionnominating-committeeofficerspublic-comment
Wed Sep 18, 2024

Tourism and Convention Commission

Tourism commission meeting set for May 11, 2023, with no listed agenda items

This is a procedural meeting notice for the Metro Tourism and Convention Commission. The agenda contains only logistics—date, time, location, and parking instructions—with no listed discussion items, votes, or public hearings.

tourismcommissionmeetingprocedural
Tue Sep 17, 2024 · 6:30 PM

Metropolitan Council

Council considers $26.2 million in affordable housing grants

The Metropolitan Council is meeting to vote on several grant resolutions and board appointments. Key items include funding for affordable housing and the election of a President Pro Tempore.

affordable-housinggrantsappointmentsbudgethousing
✓ Decided: Council elects Sepulveda as President Pro Tempore, approves $26.2M housing grants

The Metropolitan Council elected Council Member Sandra Sepulveda as President Pro Tempore for a one-year term, with a vote of 24 to 9. The Council also approved a resolution authorizing up to $26,234,615 in grants from the Barnes Fund for Affordable Housing to nonprofits for constructing and rehabilitating affordable housing, and adopted a resolution declaring racism a public health crisis. Several appointments and board elections were confirmed, and a resolution to settle Jonathan Saad's claims for $150,000 was deferred to the October 15 meeting.

Metropolitan Courthouse
Tue Sep 17, 2024

Public Library Board

Library Board to consider naming policy resolution and 2025 meeting dates

The Nashville Public Library Board of Trustees will meet to consider a naming policy resolution (Resolution 2024-04) and approve meeting dates for 2025. The board will also hear reports from the interim library director and foundation, and receive a branch overview and bookmobile update.

librarynaming-policymeeting-datesbookmobilepublic-library
✓ Decided: Library Board adopts naming policy for branch facilities

The Nashville Public Library Board of Trustees approved a new Naming Policy for branch facilities, which outlines how naming and recognition signage will be decided, including coordination with the Library Foundation. The board also approved the minutes from the July 16, 2024 meeting and the schedule for next year's board meetings. A revised Special Collections gift form was discussed but not approved; it will be brought back to a future meeting after edits.

Tue Sep 17, 2024

Metropolitan Council

Committee to vote on restricting handbill solicitation to daylight hours

The Government Operations and Regulations Committee will consider two bills on second reading. BL2024-509 would restrict handbill solicitation on private property to daylight hours. BL2024-517 would approve an amendment to extend and increase the value of a contract with InfoSapient, Inc.

handbillssolicitationcontractinfo-sapientpublic-safety
Tue Sep 17, 2024

Arts Commission

Arts Commission budget committee to review FY24 closeout and FY25 budget

The Budget and Administrative Oversight Committee of the Nashville Arts Commission will meet to receive updates on the FY24 budget closeout, FY25 budget, audit findings, and administrative procedures. The meeting includes a public comment period limited to 20 minutes total, with each speaker allowed up to 2 minutes. No votes or decisions are listed on the agenda.

artsbudgetauditadministrative-procedurespublic-comment
Tue Sep 17, 2024

Metropolitan Council

Council committee to vote on police zero-tolerance sexual misconduct policy

The Public Health and Safety Committee will consider resolutions and bills on topics including police conduct, handbill solicitation, disguises, buffer zones, and several grants. The most notable item is a resolution requesting a zero-tolerance policy for sexual misconduct in the police department. The committee will also review amendments to city codes on criminal participation by employees and other public safety measures.

policepublic-safetygrantsordinanceshealthzoning
Tue Sep 17, 2024

Equalization Board

Board hears property value appeals for dozens of residential and commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments. The morning session (8:30 AM) covers a single large residential appeal by Ryan Cundiff involving dozens of parcels on Elvira Ave, Caperton Pl, and Cogdill Ln in Nashville. The afternoon session (1:00 PM) covers a commercial appeal by Derrick Hammond/Chris Kirby for properties including 123 Northcreek Blvd, 136 Gallatin Pike, and others across Nashville and Goodlettsville.

property-taxappealsequalization-boardresidentialcommercialnashville
✓ Decided: Board approves 63 Porchlight East Hill property value appeals

The Metropolitan Board of Equalization approved 63 property value appeals for Porchlight East Hill, LLC, adjusting total values based on a sale ratio of 0.7143. The board also heard 18 other appeals, approving changes for several properties and denying changes for others, with two appeals withdrawn at the appellant's request.

Tue Sep 17, 2024

Metropolitan Council

Council committee to vote on $330K for afterschool library programs

The Arts, Parks, Libraries & Entertainment Committee will consider three resolutions and two bills. Key items include appropriating $330,265 for afterschool and summer programming through the Nashville After Zone Alliance, accepting a grant for Aaittafama’ Archaeological Park master plan implementation, and approving a grant for meals at 15 community center after-school programs. The committee will also discuss amendments to the Arts Commission membership criteria and a greenway conservation easement agreement.

artsparkslibrariesafterschool-programsgrantsgreenwayarts-commission
Tue Sep 17, 2024

Metropolitan Council

Committee to vote on $26.2M affordable housing grant amendment

The Rules, Confirmations, and Public Elections Committee will consider a late-filed amendment authorizing $26,234,615 in Barnes Fund grants for affordable housing. The committee will also vote on resolutions declaring racism a public health crisis and requesting a zero-tolerance police policy for sexual misconduct, plus several recognitions and board appointments.

affordable-housingpublic-healthpoliceartsboards-and-commissionsresolutionsbudget
Tue Sep 17, 2024

Farmers Market Board

Farmers Market Board to review FY24 year-end report and tree replacement project

The Nashville Farmers' Market Board will meet to approve July 2024 minutes, hear an executive director's report, and review the FY24 year-end financial report. They will also discuss the Root Nashville Tree Replacement Project. Public comments are limited to three minutes per speaker.

farmers-marketbudgettreespublic-comment
✓ Decided: Farmers Market Board approves Root Nashville tree replacement project

The board approved moving forward with Root Nashville's proposal to replace and provide about 55 trees at no cost to the market. It also approved the July 16, 2024 meeting minutes. The board discussed tenant rent delinquencies and directed that the lease be followed, including issuing a notice of default to a tenant owing over $18,000.

Tue Sep 17, 2024

Equalization Board

Board hears property value appeals for 60+ residential and commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments. The morning session (8:30 AM) covers a single large residential appeal by Ryan Cundiff involving dozens of parcels on Elvira Ave, Caperton Pl, and Cogdill Ln in Nashville. The afternoon session (1:00 PM) covers commercial appeals by Derrick Hammond/Chris Kirby for properties including 123 Northcreek Blvd, 136 Gallatin Pike, and others across Nashville and Goodlettsville.

property-taxappealsequalization-boardresidentialcommercialnashville
✓ Decided: Board approves 63 Porchlight East Hill property value appeals

The Metropolitan Board of Equalization approved 63 property value appeals for Porchlight East Hill, LLC, adjusting total values based on a sale ratio of 0.7143. The board also heard appeals for commercial properties, approving several value changes and denying others, with some appeals withdrawn by the appellants. The meeting was chaired temporarily by Alexa Coulton due to the absence of the Chair and Vice Chair.

Mon Sep 16, 2024

Metropolitan Council

Council committee to vote on $26M in Barnes Fund affordable housing grants

The Planning & Zoning Committee will consider 25 items, including resolutions authorizing up to $26.2 million in Barnes Fund grants for affordable housing construction and rehabilitation, a PILOT agreement for a multi-family project at 1622 Rosa L Parks Blvd, and several zoning changes on second and third reading. Public comment is limited to two minutes per speaker, with eight minutes total.

zoningaffordable-housinggrantspilotsplanningcemetery-preservationstormwatereasements
Mon Sep 16, 2024

Metropolitan Council

Council committee to vote on $26.2M in affordable housing grants

The Budget and Finance Committee will consider 27 items, including a resolution authorizing up to $26,234,615 from the Barnes Fund for affordable housing construction and rehabilitation. Other notable items include a $150,000 settlement for an Arts Commission claim, a PILOT agreement for a multifamily project at 1622 Rosa L Parks Blvd, and several grants for public health, safety, and parks programs. Most items are on the consent agenda, meaning they may be approved without discussion.

budgetfinanceaffordable-housinggrantspublic-safetytransportationparks
Mon Sep 16, 2024

Bicycle and Pedestrian Advisory Commission

BPAC to review Athena Bikeways and Demonbreun Hill roundabout

The Bicycle and Pedestrian Advisory Commission will hear project updates on the Athena Bikeways and Demonbreun Hill roundabout delineation, along with discussions on bike lane impacts during tree watering and an introduction to the commission. Public comments are invited.

bicyclepedestrianbikewaysroundabouttree-wateringpublic-comment
Mon Sep 16, 2024

Equalization Board

Board hears property tax appeals for 25 commercial parcels

The Metropolitan Board of Equalization holds formal appeal hearings on property assessments for 25 commercial parcels. Two appellants, Ralph Mainland and Ryan Cundiff, are scheduled for separate sessions at 8:30 AM and 1:00 PM. The board will also take public comment, approve minutes, and handle old and new business.

property-taxappealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves 15 property tax appeals, reducing assessed values

The Metropolitan Board of Equalization approved 15 of 16 property tax appeals, reducing assessed values for commercial properties across Nashville, applying a sale ratio of 0.7143. One appeal was withdrawn at the appellant's request. All votes were unanimous.

Mon Sep 16, 2024

Metropolitan Council

Committee to vote on Nolensville Pike safety grant, sewage agreements, and code changes

The Transportation and Infrastructure Committee will consider a $2.5 million SMART grant application to improve safety for vulnerable road users along Nolensville Pike, authorize sewage treatment agreements with six neighboring cities and a utility district, accept a donation for a school composting initiative, and vote on several code amendments including buffer zones around public buildings and restrictions on unauthorized highway signs.

transportationinfrastructurepublic-safetysewagegrantscode-amendmentsgreenwaysstormwater
Mon Sep 16, 2024

Equalization Board

Board hears property tax appeals for 20+ commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for 20+ commercial parcels. Two appellants, Ralph Mainland and Ryan Cundiff, have scheduled hearings at 8:30 AM and 1:00 PM respectively. The board will also take public comment, approve minutes, and handle old and new business.

property-taxappealscommercial-propertyboard-of-equalizationpublic-hearing
✓ Decided: Board approves property value reductions for 15 commercial parcels

The Metropolitan Board of Equalization approved property value changes for 15 commercial parcels, mostly reducing assessed values based on a sale ratio of 0.7143. All motions were unanimous. One appeal was withdrawn at the appellant's request. The board also approved minutes from four prior meetings.

Mon Sep 16, 2024

Historical Commission

Historical Commission to hear cemetery survey update and international collaboration proposal

The Metropolitan Historical Commission will vote on August minutes, hear public comments, and receive updates on the Davidson County Cemetery Survey Phase III, an international collaboration opportunity, and reports from the director and historic zoning officer.

historical-commissioncemetery-surveyhistoric-zoningpublic-commentgrants
✓ Decided: Commission approves August minutes; hears cemetery survey update

The Metropolitan Historical Commission unanimously approved the August 2024 meeting minutes. Staff and guests presented an update on Phase III of the Davidson County Cemetery Survey, reporting 98 verified cemeteries and five new additions. No other substantive decisions were made; the meeting was largely informational.

Fri Sep 13, 2024

Nashville Entertainment Commission

Entertainment Commission executive committee discusses bylaws, budget, and code amendments

The Nashville Music, Film, and Entertainment Commission Executive Committee is meeting to discuss unfinished business including bylaws updates, an ad hoc job description committee update, budget allocation clarification, and recommended code amending legislation. No votes or decisions are listed on the agenda; the items are listed as updates and discussion topics.

entertainmentmusicfilmbylawsbudgetcode-amendmentsstrategic-planning
Thu Sep 12, 2024

Planning Commission

Planning Commission to consider rezoning for hospital, storage, and housing projects

The Planning Commission will vote on several rezoning and subdivision requests, including a hospital use at 800 Dickerson Pike, a self-storage facility at 3525 Central Pike, and multiple housing developments. Several items are recommended for deferral to later meetings. The meeting also includes consent agenda items and reports.

zoninghousingdevelopmenthospitalstoragesubdivisionplanning-commission
✓ Decided: Planning Commission approves hospital, storage, and multiple residential projects

The Planning Commission approved several rezoning and subdivision requests, including a hospital use at 800 Dickerson Pike, a self-service storage facility at 3525 Central Pike, and multiple residential developments. Several other items were deferred to future meetings. All votes were unanimous (7-0).

Thu Sep 12, 2024

Health Board

Mayor proclaims September 2024 Suicide Prevention Month

The Health Board is receiving a proclamation from Mayor Freddie O'Connell recognizing September 2024 as Suicide Prevention Month in Nashville. The proclamation highlights suicide statistics in Tennessee and encourages public awareness and support for prevention resources.

healthsuicide-preventionproclamationpublic-health
Thu Sep 12, 2024

Beer Permit Board

Beer board to vote on 29 permit applications and 9 underage-sale fines

The Metro Beer Permit Board will consider 29 beer permit applications, including new locations, ownership changes, and special event permits, plus 31 requests to defer applications indefinitely due to missing documents. The board will also hear 9 complaints alleging underage beer sales, with staff recommending civil penalties ranging from $1,500 to $3,000. Three applicants have requested to withdraw their applications, which staff recommends approving.

beer-permitsalcohol-regulationpublic-hearingfinesspecial-eventsnashville
✓ Decided: Beer board grants 29 permits, defers 30, issues 10 citations

The Metro Beer Permit Board approved all 29 applications on the agenda, including new locations, ownership changes, and special events. It deferred 30 applications indefinitely due to missing documents, and withdrew 3 applications at the applicants' request. The board also issued 10 civil penalties for alleged underage sales, ranging from $1,500 to $3,000, as recommended by staff.

Thu Sep 12, 2024

COVID-19 Financial Oversight Committee

COVID-19 oversight committee to review contract amendments and fund reallocations

The COVID-19 Financial Oversight Committee is meeting to discuss and potentially approve contract amendments for three organizations and reallocate existing funds across several departments and agencies. The agenda includes public comment and reporting updates, but no specific dollar amounts or decisions are listed.

covid-19oversightcontractsfundingpublic-comment
Thu Sep 12, 2024

Equalization Board

Board hears property tax appeals for 30+ parcels across Nashville

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 30 residential and commercial parcels. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals from property owner Evans & Petree. Decisions can be appealed to the State Board of Equalization.

property-taxappealsequalization-boardnashvillecommercial-propertyresidential-property
✓ Decided: Board approves property value changes for 11 Nashville parcels

The Metropolitan Board of Equalization approved value changes for 11 commercial properties, applying a sale ratio of 0.7143, and continued two appeals to September 23, 2024. Eight appeals were withdrawn at the appellant's request. All decisions were unanimous.

Thu Sep 12, 2024

Sports Authority Board

Board to vote on budget and design for enclosed football stadium

The Sports Authority Board will consider and vote on a resolution approving budget and design matters for an enclosed football stadium. The meeting also includes a public comment period, approval of previous meeting minutes, an executive director's report, and a Titans DBE update with a monthly stadium report.

sports-authoritystadiumbudgetdesigntitansnashville
✓ Decided: Sports Authority approves stadium budget and design resolution

The Sports Authority Board unanimously approved a resolution approving the 50% construction plans, the GMP Amendment, the project budget, and a memorandum of understanding with the Titans for the enclosed football stadium. The resolution also acknowledges the Titans' ability to pay their share and satisfies conditions for the October 1, 2024 funding release date. The board also approved the minutes from the August 15, 2024 meeting and the July 18, 2024 ethics training.

Thu Sep 12, 2024

Sports Authority Board

Sports Authority to vote on enclosed football stadium budget and design

The Sports Authority Finance Committee is meeting to consider approving meeting minutes and a resolution on budget and design matters for an enclosed football stadium. The public can comment on agenda items, with a two-minute limit per speaker.

sports-authoritystadiumbudgetdesignpublic-meeting
Thu Sep 12, 2024

Equalization Board

Board hears property value appeals for 30+ parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 30 residential and commercial parcels. The board will also take public comment, approve minutes, and handle old and new business. Decisions can be appealed to the State Board of Equalization.

property-taxappealsboard-of-equalizationnashville
✓ Decided: Board approves property value changes for multiple Nashville parcels

The Metropolitan Board of Equalization heard appeals and approved value changes for several properties, applying a sale ratio of 0.7143. The board also continued two appeals to a later date and withdrew several others at the appellant's request. All decisions were unanimous.

Wed Sep 11, 2024

Equalization Board

Board hears property tax appeals for 30 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for property tax assessments on 30 commercial properties, all listed under the same appellant, Evans & Petree. The board will also take public comments, approve minutes, and handle old and new business. Decisions can be appealed to the State Board of Equalization.

property-taxappealscommercial-propertyequalization-boardpublic-comment
✓ Decided: Board approves property value reductions for multiple Nashville parcels

The Metropolitan Board of Equalization approved property value reductions for several parcels owned by Byline Property Owner LLC, MKVB Acklen LLC, and Nashville Phase III Property Holder, LLC, all based on a sale ratio of 0.7143. Several other appeals were withdrawn at the request of the appellants. The meeting was adjourned at 3:24 PM.

Wed Sep 11, 2024

Industrial Development Board

Industrial Development Board Ad Hoc Committee meets for annual report discussion

The Industrial Development Board's Ad Hoc Committee is meeting to discuss the annual report and receive a legislative update. The agenda includes approval of prior meeting minutes and a public comment period. No specific decisions or proposals are listed.

industrial-development-boardad-hoc-committeeannual-reportpublic-commentnashville
✓ Decided: Nashville IDB ad hoc committee discusses affordable housing, annual report

The ad hoc committee of the Industrial Development Board met and discussed new state legislation that could grant the board additional authority to encourage affordable housing. They also discussed introducing an annual report summarizing completed projects. No formal decisions were made; the prior meeting minutes were tabled for future review.

Wed Sep 11, 2024

Continuum of Care Homelessness Planning Council

Council tracks $50M homelessness investment with data updates

The Continuum of Care Homelessness Planning Council is reviewing the status of $50 million in Metro funding for homelessness programs, including interim housing, permanent supportive housing, and supportive services. The agenda provides detailed spending and demographic data through July 2024, showing progress and remaining funds for each initiative.

homelessnesshousingbudgetsupportive-servicesaffordable-housingdata-reporting
Wed Sep 11, 2024

Equalization Board

Board of Equalization hears property tax appeals for 30 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on September 11, 2024, for 30 commercial properties listed under the Evans & Petree appointment. The board, which is independent of the Office of Assessments, will decide on these property tax appeals; its decisions may be appealed to the State Board of Equalization. The agenda also includes public comment, approval of minutes, and other routine items.

property-taxappealsboard-of-equalizationcommercial-propertypublic-comment
✓ Decided: Board approves property value reductions for multiple appeals

The Metropolitan Board of Equalization heard property assessment appeals on September 11, 2024, approving reductions for several properties based on a sale ratio of 0.7143. The board unanimously approved changes for Byline Property Owner LLC, MKVB Acklen LLC, and Nashville Phase III Property Holder LLC. Several other appeals were withdrawn at the appellant's request. The meeting adjourned at 3:24 PM.

Wed Sep 11, 2024

Industrial Development Board

Industrial Development Board hears revenue bond update for Cleveland Park project

The board will receive a non-action update on a revenue bond for Nashville Leased Housing Associates III, LP (Dominium) at 900 Cleveland Park, and hear TNECD grants updates. Public comment is allowed, and prior meeting minutes will be approved.

industrial-development-boardrevenue-bondshousinggrantspublic-comment
✓ Decided: Board approves June minutes; Dominium revenue bond closed

The Industrial Development Board approved the June 12 meeting minutes, with Chair Hodge abstaining. An update confirmed the Nashville Leased Housing Associates III revenue bond for 900 at Cleveland Park has closed, with all post-closing items completed. No other substantive decisions were made; the meeting was procedural and informational.

Wed Sep 11, 2024

Metropolitan Council

Procurement Process Working Group meets to schedule and plan work

The Budget & Finance Committee's Procurement Process Working Group is meeting to discuss scheduling and a work plan. The agenda contains only procedural items with no specific proposals or decisions listed.

procurementbudgetfinanceworking-groupnashville
Wed Sep 11, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board to review permits and licenses

The Metropolitan Sexually Oriented Business Licensing Board is meeting to handle routine licensing matters, including new and renewal entertainer permits and business licenses, along with an inspector's report. The agenda is largely procedural, with no specific items or dollar amounts listed.

licensingpermitsbusinessentertainerpublic-comment
Wed Sep 11, 2024

Metropolitan Council

Budget committee to discuss Metro fund accountability and financial oversight

The Metro Council Budget & Finance Committee is meeting to discuss Metro Fund Allocation Accountability and the Council's role in financial oversight. The agenda includes a guest speaker on financial oversight and an update on boards and commissions. No votes or specific funding decisions are scheduled; the meeting is primarily informational and procedural.

budgetfinanceoversightboards-and-commissionsmetropolitan-council
Tue Sep 10, 2024

Work Release Commission

Work Release Commission approves 3 inmates, denies 1

The Work Release Commission reviewed applications and approved Charles Holt, Timothy Lott, and Konte Wheeler for work release, while denying Steven Summers. The board also discussed candidates' charges, history, behavior, and treatment programs.

work-releasecorrectionsinmatesnashville
✓ Decided: Work Release Commission approves three inmates, denies one

The Work Release Commission reviewed applications and approved Charles Holt, Timothy Lott, and Konte Wheeler for work release, while denying Steven Summers. The board also discussed candidates' charges, history, behavior, and treatment programs, and reviewed past approvals and continued employment.

Tue Sep 10, 2024

Metro Development and Housing Agency Board

MDHA board to vote on 2025 budget, two PILOT agreements

The Metro Development and Housing Agency Board will consider approving the 2025 agency operating budget, a driver safety matching grant program, and two PILOT (payment in lieu of taxes) agreements for the Burning Tree and Northview properties. The meeting also includes approval of prior minutes and public comments.

budgethousingdevelopmentpilotsgrantssafety
Tue Sep 10, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup continues federal criteria review for ending homelessness

The Continuum of Care Veterans Workgroup will review data from OHS and MDHA, continue work on USICH Federal Criteria and Benchmarks for Ending Veteran Homelessness, and receive Built for Zero updates. The meeting includes routine items such as introductions, minutes review, and agency updates.

homelessnessveteransdata-reviewfederal-criterianashville
Tue Sep 10, 2024

Equalization Board

Board hears property tax appeals for 30+ Nashville parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for numerous residential and commercial parcels across Nashville. The board, which is independent of the Property Assessor's Office, will hear appeals from property owner Evans & Petree in two sessions (8:30 AM and 1:00 PM). Decisions can be appealed to the State Board of Equalization.

property-taxappealsboard-of-equalizationnashville
✓ Decided: Board approves multiple property value changes using sale ratio

The Metropolitan Board of Equalization heard property assessment appeals on September 10, 2024, approving changes to total assessed values for several properties, all applying a sale ratio of 0.7143. Two appeals were continued to September 23, 2024, and four appeals were withdrawn at the appellant's request. All motions were approved unanimously.

Tue Sep 10, 2024

Fire and Building Code Appeals Board

Board hears appeal to waive fire sprinkler requirement at 106 Acklen Park Drive

The Nashville Fire and Building Code Appeals Board will hear two appeals at its September 10, 2024 meeting. One appeal seeks relief from the automatic sprinkler system installation requirement for a Group R building at 106 Acklen Park Drive. The other appeals a stairway width requirement at 101 Church Street, where the existing stair is two inches too narrow. The board will also take public comments and approve last month's minutes.

fire-codebuilding-codeappealssprinklersstairsnashville
✓ Decided: Board denies sprinkler appeal, approves stair width stipulation

The Board denied an appeal seeking relief from a fire sprinkler installation requirement at 106 Acklen Park Drive (7-0), and approved with stipulation an appeal regarding a stairway width at 101 Church Street (7-0). The Board also voted to appoint Lauren Hollier as Temporary Chairman due to the absence of the chairman and vice-chairman (6-0).

Tue Sep 10, 2024

Fair Commissioners Board

Fair board reviews $41M expo center project nearly complete

The Fair Commissioners Board is reviewing the status of several capital improvement projects at the fairgrounds, including the nearly completed $41 million Exposition Center project (99.5% complete) and the partially completed Fair Park Phase 2 (73% complete) and Infrastructure Part 2 (15% complete) projects. The agenda consists entirely of project budget and progress updates with no decisions or public hearings listed.

fairgroundscapital-improvementsbudgetconstructionparks
Tue Sep 10, 2024

Equalization Board

Board hears property tax appeals for 30+ parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 30 residential and commercial parcels. The board, which is independent from the Assessor's Office, will hear cases from property owner Evans & Petree in two sessions at 8:30 AM and 1:00 PM. Decisions can be appealed to the State Board of Equalization.

property-taxappealsequalization-boardnashville
✓ Decided: Board approves property value changes for 12 appeals

The Metropolitan Board of Equalization heard 12 property assessment appeals on September 10, 2024, approving value changes for 10 parcels and withdrawing 2 appeals at the appellant's request. All approved changes were unanimous and applied a sale ratio of 0.7143. Two additional appeals were continued to September 23, 2024.

Tue Sep 10, 2024

Civil Service Commission

Civil Service Commission to approve dozens of hires, terminations, and pensions

The Metropolitan Civil Service Commission will vote on a large batch of appointments, terminations/pensions, and eligibility registers across multiple Metro departments. The agenda also includes several human resource items, such as an open-range salary increase request for a police department employee, injury-on-duty extensions for sheriff's office and parks employees, and an equity adjustment for the police department.

civil-servicepersonnelappointmentsterminationspensionspolicefiresheriff
Tue Sep 10, 2024

Audit Committee

Audit committee to review follow-ups on pension, property standards, and police intervention audits

The Metropolitan Nashville Audit Committee will discuss follow-up recommendations on three recent audits: pension investments, property standards complaints, and the MNPD Employee Intervention System. They will also tentatively discuss an audit of the Department of Finance's Public Property Division and conduct an annual self-assessment. The meeting includes public comment, approval of minutes, and an executive session on the FY2024 financial statements audit.

auditpensionproperty-standardspolicefinancebudgetexecutive-session
Tue Sep 10, 2024

Sustainability Advisory Committee

Sustainability committee to hear building performance, waste recycling updates

The Sustainability Advisory Committee will receive presentations on a High Performance Building Report Dashboard, Metro Facilities Benchmarking Results, and Construction and Demolition Recycling Opportunities. An update on recent federal grant activities for sustainability and resilience projects will also be provided.

sustainabilitybuildingsenergyrecyclinggrantsresilience
Mon Sep 9, 2024

Human Relations Commission

Human Relations Commission discusses 60th anniversary and conciliation agreement

The Metro Human Relations Commission is meeting to discuss routine business including approval of minutes, a financial update, and new commissioner orientation. New business items include community engagement, committee reports, planning for the commission's 60th anniversary event, and an update on a conciliation agreement.

human-relationscommission-meetingcommunity-engagementanniversaryconciliation-agreement
✓ Decided: Commission approves meeting minutes, discusses conciliation agreement update

The Metro Human Relations Commission held a routine meeting, approving the previous meeting's minutes with edits. Commissioners discussed the financial report, received committee updates, and reviewed a conciliation agreement, with a working group established and an update expected in October. No substantive policy decisions were made.

Mon Sep 9, 2024

Traffic and Parking Commission

Commission to consider extending sidewalk vending ban into the Gulch

The Traffic and Parking Commission will hear a presentation on extending the downtown sidewalk vending restriction into the Gulch area, bounded by Broadway, 12th Ave S, Division St, and 8th Ave S. A vote is expected in October. The commission will also consider approving a standing list of parking fee waivers for special events and receive updates on speed limit changes on Hermitage Ave/Lebanon Pk and a denied request for all-way stop signs on Cheatham Place.

trafficparkingsidewalk-vendingspeed-limitsstop-signsvalet-parkingvision-zero
✓ Decided: Commission approves consent agenda items, defers speed limit and stop sign decisions

The Traffic and Parking Commission approved the consent agenda, including a stop sign relocation on Madison Blvd and Denson Ave, and revocation of an abandoned valet lane at 12th Ave S & Laurel St with new 24/7 pay parking. The commission deferred decisions on all-way stop signs at Cheatham Place intersections and speed limit reductions on Hermitage Ave/Lebanon Pk to future meetings. No vote was taken on the downtown sidewalk vending restriction expansion into the Gulch, which was informational only.

Mon Sep 9, 2024

Solid Waste Region Board

Solid Waste Region Board hears TDEC landfill capacity report

The Davidson County Solid Waste Region Board is meeting to receive presentations from the Tennessee Department of Environment and Conservation (TDEC) on landfill capacity reports and from Barge on solid waste issues affecting Nashville, including TCA and Jackson Law. The meeting includes a Q&A session. No votes or decisions are scheduled.

solid-wastelandfilltdecnashvillepublic-meeting
Mon Sep 9, 2024

Continuum of Care Homelessness Planning Council

Equity committee discusses racial disparities research and training

The Equity & Diversity Committee of Nashville's Continuum of Care will discuss next steps for racial disparities research and racial equity training. The meeting includes updates on a racial equity resources webpage and the Performance Evaluation Committee. The agenda is largely discussion-based with no votes or concrete decisions listed.

homelessnessracial-equitydiversitytrainingresearch
Mon Sep 9, 2024

Continuum of Care Homelessness Planning Council

Chair and Vice Chair orientation for Homelessness Planning Council

This meeting is a procedural orientation for the incoming Chair and Vice Chair of the Continuum of Care Homelessness Planning Council. The agenda includes preparation for the September HPC meeting and next steps, with no substantive decisions or discussions listed.

homelessnesscontinuum-of-careorientationprocedural
Mon Sep 9, 2024

Equalization Board

Board hears property tax appeals for dozens of Nashville parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for residential property tax assessments. The agenda lists over 100 parcels across Nashville and Antioch, all filed under the name Evans & Petree. No audio conference or supporting documentation is noted for any appeal.

property-taxtax-appealsboard-of-equalizationnashvilleantiochresidential-property
✓ Decided: Board approves property value reductions for dozens of Nashville parcels

The Metropolitan Board of Equalization approved multiple property assessment appeals, reducing total values for residential and commercial parcels based on a sale ratio of 0.7143. One appeal was withdrawn at the appellant's request. All motions were approved unanimously.

Mon Sep 9, 2024

Equalization Board

Board hears property tax appeals for dozens of residential parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for numerous residential parcels across Nashville and Antioch. The agenda lists over 100 parcels, all listed as residential, with no supporting documentation provided. The board will also consider approval of previous meeting minutes and allow public comment on agenda items.

property-taxappealsboard-of-equalizationresidentialnashvilleantioch
✓ Decided: Board approves property value reductions for dozens of Nashville parcels

The Metropolitan Board of Equalization approved property value changes for numerous parcels, including a single-family home on Lynnwood Blvd and over 100 parcels in the Zermatt Ave and Rivendell Terrace areas, all applying a sale ratio of 0.7143. One appeal was withdrawn at the appellant's request. The board also approved value changes for commercial properties on Rivergate Pkwy and Mainstream Dr.

Mon Sep 9, 2024

Metropolitan Council

Executive Committee to discuss social media policy and public comment rules

The Metro Council Executive Committee is meeting to discuss proposed policies on social media accounts and ceremonial copies of proclamations, as well as public comment rules implementation and caucus support services. The agenda also includes updates on council continuing education, meeting scheduling, and historic courthouse renovations. No binding votes or specific financial items are listed.

council-procedurespublic-commentsocial-mediaproclamationscourthouse-renovationcaucus-support
Mon Sep 9, 2024

Historical Commission

Committee to review three proposed historical markers

The Marker Committee will review proposed language for three historical markers honoring Kossie Gardner Sr., Dr. R.F. Boyd, and Dr. George Hubbard/Dr. William Sneed. No public comment will be taken at this meeting; the full Metro Historical Commission will consider adoption on September 16, 2024, with public comment available then.

historical-markerspublic-historycommittee-meeting
Mon Sep 9, 2024

Metropolitan Council

Minority Caucus meets for routine business and planning

This is a procedural meeting of the Metropolitan Council Minority Caucus. The agenda includes approval of minutes, a treasurer's report, and updates on old and new business items such as boards and commissions, a caucus retreat, and a reception. No legislative actions or public hearings are scheduled.

minority-caucusmetropolitan-councilnashvilleproceduralmeeting
Fri Sep 6, 2024

Metro Action

Metro Action Commission to discuss executive director search

The Metropolitan Action Commission Board of Commissioners is holding a special called meeting to discuss and receive a recommendation on the executive director search. The agenda includes only the call to order, an executive committee report on the search, and adjournment.

commissionexecutive-director-searchpersonnel
Thu Sep 5, 2024

Metro Development and Housing Agency Board

MDHA board to vote on 2025 budget, three PILOT agreements

The Finance and Development Committee will discuss and recommend action on the 2025 Agency Operating Budget, three PILOT (Payment in Lieu of Taxes) agreements for Burning Tree, Northview, and Whispering Oaks, and a partial disposition of 101 Gateway Avenue. A decision on the budget and two PILOTs is requested in September, with the remaining items targeted for October.

budgethousingpilotsproperty-dispositionmdhanashville
Thu Sep 5, 2024

Metro Development and Housing Agency Board

MDHA committee to hear lease termination presentation

The Housing and Community Committee will hear a presentation on MDHA lease terminations. The meeting also includes approval of prior minutes and public comments.

housingpublic-housingleases
Thu Sep 5, 2024

Convention Center Authority

Convention Center Authority to weigh expansion feasibility study

The Convention Center Authority will meet to approve minutes, hear an operations update, and discuss several requests for proposals (RFPs), including a feasibility study for a possible Music City Center expansion, elevator/escalator maintenance services, and an audio-visual contract extension. The board will also receive updates on DBE participation and tax collections.

convention-centerrfpexpansionmaintenancecontractsdbetax-collections
Thu Sep 5, 2024

Stormwater Management Commission

Stormwater Commission to hear three floodway variance cases

The Stormwater Management Commission will consider three variance requests involving floodway disturbances for residential and commercial projects. Cases include a home and pool on Estes Road, a building at Nashville Gun Club, and road/bridge work at Ariza Bellevue. The meeting also includes approval of prior minutes and decision letters.

stormwaterfloodwayvariancesconstructionnashville
Thu Sep 5, 2024

Downtown Code Design Review Committee

Morris Hotel adaptive reuse concept plan up for vote; Downtown market study presented

The Downtown Code Design Review Committee will hold a public hearing and vote on a concept plan for the Morris Hotel, an adaptive reuse of a 5-story building with a rooftop addition. Staff will also present an update on the Downtown Market Study and entitlements analysis.

downtown-codedesign-reviewadaptive-reusehotelmarket-studypublic-hearing
Wed Sep 4, 2024

Continuum of Care Homelessness Planning Council

Coordinated Entry Oversight Committee to review policies, lead evaluation, and new assessment tool

The committee will discuss a draft timeline for key strategic initiatives, including updating Coordinated Entry policies and procedures, evaluating the Coordinated Entry lead, and creating a new assessment tool. The meeting also includes a values and equity statement, welcome, conflict of interest disclosures, and other business.

homelessnesscoordinated-entrypoliciesevaluationassessment-toolnashville
Wed Sep 4, 2024

Metropolitan Council

HR working group sets goals and schedule

This is the first meeting of a new working group focused on human resources. The agenda is procedural: introductions, goal-setting, and scheduling future meetings. No substantive decisions or proposals are on the agenda.

human-resourcesbudgetfinanceworking-groupprocedural
Tue Sep 3, 2024

Election Commission

Commission to approve candidate list for Nov. 5 ballot

The Davidson County Election Commission will meet to approve the official candidate list for the November 5, 2024 election and schedule absentee counting, provisional ballot processing, and post-election audits. The agenda also includes public comments, approval of prior meeting minutes, and an AOE report.

election-commissionelectionsballotabsentee-votingprovisional-ballotsaudit
✓ Decided: Election Commission approves Nov. 5 ballot candidate lists

The Davidson County Election Commission unanimously approved the candidate lists for the November 5, 2024 municipal elections, along with scheduling for absentee and provisional counting boards and related post-election audits. The commission also approved minutes from the August 14 meeting and reviewed voter registration applications. All motions passed unanimously.

Tue Sep 3, 2024

Parks and Recreation Board

Public Art Committee to vote on $5,000 dog park mural at Frankie Pierce Park

The Public Art Committee will consider a proposal from Boyle Investment Company to accept a mural for the dog park at Frankie Pierce Park, valued at approximately $5,000. The mural must be approved by the Parks Department before installation, and the department retains authority to remove it if needed. All costs and maintenance are covered by Capitol View, with no financial obligation for Metro Parks.

parkspublic-artmuralfrankie-pierce-parkcapitol-viewcouncil-district-19
✓ Decided: Public Art Committee approves Capitol View mural at Frankie Pierce Park dog park

The Public Art Committee recommended approval of Boyle Investment Company d/b/a Capitol View's proposed mural for the dog park at Frankie Pierce Park, valued at approximately $5,000. The mural must receive prior approval from the Parks Department before work begins, and the department retains authority to remove it if necessary. All costs and maintenance will be paid by Capitol View, with no financial obligation to Metro Parks.

Tue Sep 3, 2024

Parks and Recreation Board

Parks Board considers greenway easements, park naming, and Opry Mills connector

The Parks and Recreation Board is reviewing several land easement requests to expand the city's greenway network. The agenda also includes proposals for park name changes, mural approvals, and a major grant application for the Opry Mills Greenways Connector.

parksgreenwaysland usepublic artinfrastructure
✓ Decided: Parks Board approves $12.8M grant request for Opry Mills Greenway Connector

The Board approved a grant application for up to $12,821,417.78 (70% of the estimated $18.3M project) for the Opry Mills Greenway Connector, with Metro providing a 30% match. It also approved a 90-day extension of the parking agreement with Cheekwood, a mural at Frankie Pierce Park, and a grant for repairs to the Sea Serpent sculpture. The Board began the renaming process for Cumberland Park to Wasioto Park and deferred two greenway easement requests to the Acquisition Committee.

Tue Sep 3, 2024

Parks and Recreation Board

Board to vote on naming Clare's Meadow and renaming Cumberland Park

The Naming Committee will consider two naming requests: one to name a 6-acre area in Percy Warner Park as 'Clare's Meadow' in honor of the late Clare Armistead, and another to rename Cumberland Park to 'Wasioto Park', the original Shawnee name of the Cumberland River. Public comment will be heard before decisions.

parksnamingpublic-hearingindigenoushonorific
✓ Decided: Parks board recommends naming Percy Warner area 'Clare's Meadow'

The Naming Committee recommended approval for naming a 6-acre area in Percy Warner Park 'Clare's Meadow' in honor of the late Clare Armistead, and recommended beginning the renaming process for Cumberland Park to Wasioto Park. Both recommendations will go to the full Board of Parks and Recreation for final action.

Tue Sep 3, 2024

Parks and Recreation Board

Board to vote on three conservation greenway easements

The Acquisition Committee will consider three staff requests to approve dedicated Conservation Greenway Easements on properties in Council Districts 9, 35, and 1. Each easement was a condition of Metro Council's approval of preliminary development plans. The meeting includes a public comment period.

parksgreenwaysconservation-easementsdevelopment-conditionspublic-comment
✓ Decided: Parks board recommends 3 greenway easements for approval

The Acquisition Committee recommended approval of three dedicated Conservation Greenway Easements, all tied to Metro Council-approved developments. The easements will conserve open space and support future greenway connections, including the Cumberland River, Harpeth River, and Whites Creek Greenways. No public comments were made, and no other substantive decisions were taken.

Tue Sep 3, 2024

Metropolitan Council

Budget committee to vote on $200K in juvenile court grants, police FinCEN access

The Budget and Finance Committee will consider 16 items, including appropriating $200,000 from Juvenile Court to nonprofit grants, approving police access to federal financial data via FinCEN, settling three property damage claims totaling about $67,000, and extending Nashville Gas Company's franchise. Several resolutions accept grants from the Nashville Public Library Foundation for library programs and positions.

budgetpolicegrantslibrariesjuvenile-courtproperty-settlementsgas-franchisemilitary-training
Tue Sep 3, 2024

Metropolitan Council

Council committee to consider algae, moss, mildew ordinance amendment

The Government Operations and Regulations Committee is meeting to consider BL2024-441, an ordinance amending Section 16.24.340 of the Metropolitan Code regarding algae, moss, mildew, lichen, and fungus. The committee will also take public comment on this item. No other substantive business is listed.

ordinancecode-amendmentpublic-commentcommittee-meeting
Tue Sep 3, 2024

Metropolitan Council

Council committee to review Arts Commission membership changes and library grants

The Arts, Parks, Libraries & Entertainment Committee is meeting to consider five resolutions accepting grants from the Nashville Public Library Foundation for library programs and positions, plus a bill amending the Metropolitan Nashville Arts Commission's membership and funding criteria. Public comment is allowed on agenda items.

artslibrariesgrantsparkslegislation
Tue Sep 3, 2024

Metropolitan Council

Committee to vote on Nashville Gas franchise extension, noise barrier beautification

The Transportation and Infrastructure Committee will consider resolutions supporting a noise barrier beautification at Mulberry Street and 6th Avenue South, and extending the license and franchise of Nashville Gas Company. The committee will also vote on several bills authorizing sewer, water, and stormwater infrastructure projects, street name designations, and right-of-way abandonments.

transportationinfrastructurefranchisestormwaterright-of-waysewerwater
Tue Sep 3, 2024

Employee Benefit Board

Board to consider police medical pension, death benefit for Lori L. Lazo

The Metropolitan Employee Benefit Board will meet to approve minutes, hear appeals, and consider disability and service pensions. Specific actions include reconsidering a medical pension for a Metro Nashville Police Department employee and approving an in-line-of-duty death benefit for Lori L. Lazo. The board will also elect a vice-chair for the remainder of 2024 and receive utilization reports from Blue Cross Blue Shield and CIGNA.

pensionspolicedeath-benefitbenefitspublic-comment
✓ Decided: Board approves $100K in-line-of-duty death benefit for Lori L. Lazo

The Metropolitan Employee Benefit Board approved an additional $100,000 in-line-of-duty death benefit for the estate of Lori L. Lazo, a General Services employee who died in July 2024. The board also approved a new disability pension for James N. Franklin, deferred another for Joseph A. Clinard, continued several reexaminations, and denied a reconsideration for Jeanne S. Hesson. All actions were approved without objection except where noted.

Tue Sep 3, 2024

Metropolitan Council

Public Health & Safety Committee to vote on $200K in juvenile court grants, police data access, and lease amendment

The Public Health and Safety Committee is meeting to discuss and vote on three resolutions: appropriating $200,000 from Juvenile Court to nonprofit Community Partnership Fund grants, approving a lease amendment for office space at 1281 Murfreesboro Pike, and authorizing an intergovernmental agreement for the police department to access financial data from FinCEN. Public comment is allowed on agenda items.

public-health-and-safetygrantspolicefinanceleasejuvenile-court
Tue Sep 3, 2024

Metropolitan Council

Planning committee considers Vanderbilt encroachments, stormwater projects, and a rezoning

The Planning and Zoning Committee will discuss 15 items including resolutions for a military training license at 1414 County Hospital Road and a lease amendment at 1281 Murfreesboro Pike, bills on second reading for Vanderbilt University encroachments at 25th Avenue and Highland Avenue, stormwater improvement projects on Bresslyn Road and Rhine Drive, and a bill on third reading to rezone 231 Glenrose Ave. from RS5 to RM20-A-NS.

zoningstormwatervanderbiltpublic-worksmilitaryleaseplanning
Tue Sep 3, 2024

Metropolitan Council

Rules committee to vote on requiring proof of residency for public comment

The Rules, Confirmations, and Public Elections Committee will consider a proposed rule change requiring Davidson County residency proof to speak at council meetings, and will vote on several board appointments and ceremonial resolutions. The committee also has a late-filed zoning amendment for 92 single-family lots on Mt. View Road.

public-commentzoninghousingarts-commissionboard-appointmentsrules-of-procedurenashville
Tue Sep 3, 2024 · 6:30 PM

Metropolitan Council

Council to vote on cancelling Gallatin Pike Urban Design Overlay

The Metropolitan Council will consider several board appointments and confirmations, and will vote on multiple zoning ordinance changes. The most significant item is an ordinance (BL2024-483) to cancel the Gallatin Pike Urban Design Overlay covering 208.57 acres. Additional proposals include rezoning parcels for multi‑family housing and changes to specific plan boundaries.

zoningboard-appointmentsordinanceshousingplanning
✓ Decided: Council approves 92-lot Mt. View Road subdivision on third reading

The Metropolitan Council approved a zoning change for 6103 Mt. View Road to permit 92 single-family lots, passing on third reading with a 35-0 vote. The council also passed several zoning bills on second reading, including a rezoning for 119 multi-family units at 7088 Burkitt Rd, and deferred others. A resolution to allow MNPD direct access to federal financial data was approved 35-3.

Metropolitan Courthouse
Fri Aug 30, 2024

Continuum of Care Homelessness Planning Council

CoC Executive Committee to review ARPA funding and outdoor homelessness strategy

The Executive Committee of the Homelessness Planning Council will review July and August meeting minutes, receive updates on HUD technical assistance, committee activities, and CoC funding opportunities. Key items include discussion of $50 million in American Rescue Plan Act funding and the Outdoor Homelessness Strategy. The committee will also plan orientations for the HPC Chair, Vice Chair, and members, as well as a board retreat.

homelessnessfundingamerican-rescue-planoutdoor-strategycommittee-meetingnashville
Thu Aug 29, 2024

Hospital Authority Board

Finance Committee to vote on $3.37M emergency physician contract increase

The Finance Committee will consider approval of several contracts and capital expenditures, including a $372,855 annual increase for Southeastern Emergency Physicians, a $533,928 cath lab HVAC project, and a $477,480 annual trauma call coverage agreement. The committee will also review financial statements for May and June 2024.

hospitalfinancecontractscapital-expenditureemergency-servicesradiologyconstruction
Thu Aug 29, 2024

Equalization Board

Board hears property value appeals for 50+ commercial and residential parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 50 parcels, including commercial properties in downtown Nashville and residential properties in several neighborhoods. The board, which is independent from the Property Assessor's Office, will hear appeals from Evans & Petree in two sessions at 8:30 AM and 1:00 PM. Decisions can be appealed to the State Board of Equalization.

property-taxappealsequalization-boardcommercial-propertyresidential-propertynashville
Thu Aug 29, 2024

Hospital Authority Board

Hospital board to vote on $372K ER contract increase, $534K cath lab HVAC

The Hospital Authority Board will vote on several contracts and capital expenditures, including a $372,855 annual increase for Southeastern Emergency Physicians and a $533,928 cath lab HVAC construction project. The board will also elect officers for fiscal year 2025 and consider a resolution authorizing assumed corporate names.

hospital-authoritycontractscapital-expendituresemergency-servicesconstructionmedical-equipmentboard-elections
Thu Aug 29, 2024

Equalization Board

Board hears property tax appeals for 60+ commercial and residential parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 60 parcels, including commercial properties on Church St, Commerce St, and Exchange Ln in Nashville, and residential properties on Riverside Dr, Indiana Ave, and 41st Ave. The board will also consider appeals for properties in Antioch, Brentwood, and other areas. The meeting includes a public comment period for up to 10 speakers.

property-taxappealsequalization-boardnashvillecommercial-propertyresidential-property
Wed Aug 28, 2024

Short Term Rental Appeals Board

STR Appeal Board denies one, grants two short-term rental appeals

The board heard three appeals from property owners seeking to re-establish short-term rental operations. One appeal (Case STR 2024-024, 1455 Snell Blvd) was denied; two were granted: Case STR 2024-025 (815 Main St 306) with a condition to re-apply by 09-24-2024, and Case STR 2024-026 (2027 Rosemary Ln) with no conditions.

short-term-rentalsappealszoningnashville
Wed Aug 28, 2024

Continuum of Care Homelessness Planning Council

Consumer Advisory Board seeks members with lived homelessness experience

This is a recruitment notice for Nashville's Consumer Advisory Board (CAB), a committee of the Continuum of Care that advises on homelessness strategies. The board is working with the National Alliance to End Homelessness to set goals and bylaws. Members are compensated $20/hour. The meeting itself is not detailed; the agenda is primarily informational.

homelessnessadvisory-boardcontinuum-of-carecompensationnashville
Wed Aug 28, 2024

Beer Permit Board

Beer Permit Board meeting canceled due to lack of quorum

The August 28, 2024 meeting of the Metropolitan Beer Permit Board was canceled because a quorum of board members was not present. No decisions or discussions took place. The agenda included 38 items: 15 applications for approval, 17 applications to defer indefinitely due to missing documents, 2 applications for discussion and decision, and 3 hearings with alleged violations.

beer-permitsalcohol-regulationpublic-hearingsenforcementnashville
✓ Decided: Nashville Beer Board meeting canceled due to lack of quorum

The August 28, 2024 meeting of the Metropolitan Beer Permit Board was canceled because no quorum was present. No applications were considered, no decisions were made, and no hearings were held. The next meeting is scheduled for September 12, 2024.

Wed Aug 28, 2024

Equalization Board

Board hears property tax appeals for 30+ commercial and residential parcels

The Metropolitan Board of Equalization holds formal appeal hearings on property assessments for 30+ parcels, mostly commercial, across Nashville and Antioch. The board, independent from the Assessor's Office, will hear appeals from property owner Evans & Petree in two sessions. Decisions can be appealed to the State Board of Equalization.

property-taxappealsboard-of-equalizationcommercial-propertyresidential-propertynashville
Wed Aug 28, 2024

Equalization Board

Board hears 30 property tax appeals from commercial and residential owners

The Metropolitan Board of Equalization will hold formal appeal hearings on 30 properties, mostly commercial, at 8:30 AM and 1:00 PM. The board, independent from the Property Assessor's Office, will decide on property value disputes that can be appealed to the State Board of Equalization. A public comment period is scheduled at the start of the meeting.

property-taxtax-appealsboard-of-equalizationcommercial-propertyresidential-propertypublic-comment
Wed Aug 28, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board to review permits and licenses from May through August 2024

The board will hold a public comment period, approve minutes from May 22, 2024, and review new and renewal entertainer permits and business licenses across multiple date ranges from May 23 to August 28, 2024. An inspector's report is also on the agenda.

sexually-oriented-businesslicensingpermitspublic-commentnashville
Tue Aug 27, 2024

Metro Action

Commission to discuss executive director candidates

The Metropolitan Action Commission Board of Commissioners is holding an executive committee meeting to discuss candidates for the executive director position. The agenda includes a call to order, discussion of candidates, and adjournment.

commissionexecutive-directorpersonnel
Tue Aug 27, 2024

Housing Trust Fund Commission

Housing Trust Fund Commission reviews $19.5M Catalyst Fund for affordable housing

The Commission is reviewing the Nashville Catalyst Fund, a $19.5 million ARP-funded strike fund that provides early-stage loans to affordable housing developers. The fund aims to leverage Metro's capital at least 2:1 with private investment and has secured a $50 million revolving credit facility led by First Horizon Bank. The agenda is a presentation overview with no votes or decisions listed.

affordable-housingcatalyst-fundhousing-trust-fundarp-fundingcommunity-developmentloans
✓ Decided: Commission awards $7.55M ARPA funds to Omni Foundation for 80-unit supportive housing

The Commission approved a $7,551,528.75 grant to Omni Family Foundation (d/b/a I am Next) for an 80-unit permanent supportive housing project for youth aging out of foster care, with two members abstaining. It also approved a contract extension for Affordable Housing Resources and the FY25 budget. The meeting included updates on finances, draws, and procedural changes.

Tue Aug 27, 2024

Work Release Commission

Work Release Commission approves two inmates, denies two others

The Work Release Commission reviewed applications and approved Dustin Bowman and Jeremiah Donnell for work release, while denying Denzel Dotson and Ronnie Whitney. The board also discussed candidates' charges, history, behavior, and treatment programs.

work-releaseinmatescorrectionsnashville
✓ Decided: Work Release Commission approves two, denies two candidates

The Work Release Commission reviewed applications and approved Dustin Bowman and Jeremiah Donnell for work release, while denying Denzel Dotson and Ronnie Whitney. The board also discussed candidates' charges, history, behavior, and treatment programs, as well as old business regarding past approvals and continued employment.

Tue Aug 27, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 30 commercial properties, all filed by Evans & Petree. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals on properties including 1212 McGavock St, 1200 Broadway, and 1301 Lebanon Pike.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves 20 property tax appeals, reducing values

The Metropolitan Board of Equalization heard 21 property tax appeals on August 27, 2024, approving 20 of them and withdrawing 2. All approved appeals reduced assessed values, mostly by applying a sale ratio of 0.7143. One appeal regarding classification at 1212 Demonbreun St was denied, keeping the property commercial. The board also elected a temporary chair due to the absence of the chair and vice chair.

🏢 Registered nonprofit at this address: Empire Arts Foundation (Arts & culture)
🏢 Building at this address: 10 m tall
Tue Aug 27, 2024

Equalization Board

Board hears property tax appeals for 25 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for 25 commercial properties, all filed by Evans & Petree. The board will also consider approving minutes, hear public comments, and address old and new business. No dollar amounts or decisions are listed in the agenda.

property-taxappealscommercial-propertypublic-hearingequalization-board
✓ Decided: Board approves 20 property tax appeals, mostly reducing values

The Metropolitan Board of Equalization heard 22 property tax appeals on August 27, 2024, approving 20 of them and withdrawing 2 at the appellant's request. Most approved appeals reduced assessed values using a sale ratio of 0.7143, while one appeal to change classification from commercial to residential was denied. All decisions were unanimous.

🏢 Registered nonprofit at this address: Empire Arts Foundation (Arts & culture)
🏢 Building at this address: 10 m tall
Tue Aug 27, 2024

Metropolitan Council

Women’s Caucus hears Nashville Babies and sexual misconduct reports

The Metropolitan Women’s Caucus is meeting to vote on previous minutes and receive two presentations: one on the Nashville Babies program and another on a sexual misconduct report. No legislative actions or decisions are on the agenda beyond the minutes vote.

womenbabiessexual-misconductpresentationminutes
Tue Aug 27, 2024

Metropolitan Council

Immigrant Caucus discusses language access at Percy Priest

The Metropolitan Immigrant Caucus is meeting to discuss language access at Percy Priest, the 'Our State, Our Languages' initiative, and a Unity March. The agenda includes approval of minutes and open discussion.

immigrant-caucuslanguage-accesspercy-priestunity-march
Mon Aug 26, 2024

Community Review Board

Community Review Board to discuss sexual misconduct policy and MOU negotiations

The Nashville Community Review Board is holding its monthly meeting to discuss administrative case closures, a sexual misconduct policy report, MOU negotiations, a board vacancy, and a legal proposal. Public comment is limited to 2 minutes per speaker on agenda items.

community-review-boardpolice-oversightpolicylegalpublic-comment
✓ Decided: CRB approves legal services agreement with Brazil Clark, PLLC

The Community Review Board unanimously approved a legal representation agreement with Brazil Clark, PLLC for additional counsel and consultation services, which will be sent to the Metro Nashville Law Director and Clerk for signing. The board also unanimously approved the sexual misconduct policy report, with an amendment to send copies to Mayor O'Connell, Chief Drake, Metro Council, and media outlets. Four administrative case closures were approved unanimously, and the board accepted the executive director's report and the July 22, 2024 meeting minutes.

Mon Aug 26, 2024

Equalization Board

Board hears property tax appeals for 50+ parcels across Nashville

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 50 residential and commercial parcels. The board, which is independent from the Assessor's Office, will hear appeals from property owner Evans & Petree in two sessions at 8:30 AM and 1:00 PM. Decisions can be appealed to the State Board of Equalization.

property-taxappealsequalization-boardnashvillepublic-hearing
✓ Decided: Board approves property value reductions for 30+ Nashville parcels

The Metropolitan Board of Equalization heard property assessment appeals on August 26, 2024, approving value reductions for most appealed parcels using a sale ratio of 0.7143, and withdrawing several appeals at the appellant's request. The board also approved minutes and adjourned.

Mon Aug 26, 2024

Continuum of Care Homelessness Planning Council

Council to vote on tighter HMIS data security and user background rules

The Continuum of Care Homelessness Planning Council is discussing proposed revisions to the HMIS Policies and Procedures Manual. The changes include new background check requirements for end users, a ban on sharing client data with AI tools, and limits on user licenses per agency. The council will decide whether to adopt these revisions.

homelessnesshmisdata-privacybackground-checksailicensingpolicies
Mon Aug 26, 2024

Equalization Board

Board hears property value appeals for 50+ parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 50 residential and commercial parcels, including properties on Mcferrin Ave, Ramsey St, and Broad Way. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals from Evans & Petree in two sessions at 8:30 AM and 1:00 PM. No audio conference or supporting documentation is noted for these hearings.

property-taxappealsequalization-boardnashville
✓ Decided: Board approves property value reductions for multiple Nashville appeals

The Metropolitan Board of Equalization heard property assessment appeals and approved reductions for most, applying a sale ratio of 0.7143. Several appeals were withdrawn at the appellant's request, and a few parcels had no change to land value. All motions were unanimous.

Thu Aug 22, 2024

Planning Commission

Planning Commission to vote on 395-unit apartment project at 2nd & Van Buren

The Planning Commission will consider 25 items, including zone changes, specific plan amendments, and subdivision plats. Key votes include a 395-unit apartment project at 2nd Avenue North and Van Buren Street, a 288-unit complex on Burkitt Road, and a 250-unit development on West Trinity Lane. Several items are recommended for deferral to future meetings.

zoninghousingplanning-commissionmulti-familyspecific-plansubdivisionurban-design-overlay
✓ Decided: Planning Commission approves 395-unit development at 2nd & Van Buren

The Planning Commission approved several Specific Plan (SP) amendments and rezoning requests, including a 395-unit multi-family development at 2nd Avenue North and Van Buren Street, a 288-unit development at Burkitt Road, and a 250-unit development at West Trinity Lane. The Commission also approved the Edgehill Neighborhood Plan as a supplemental policy to the Green Hills-Midtown Community Plan. Several items were deferred to future meetings, and one rezoning request was disapproved.

🏢 Building at this address: 12 m tall
Thu Aug 22, 2024

Metro Action

Board to vote on $563K in contract modifications for youth workforce program

The Metropolitan Action Commission Board will consider approving two contract modifications for the WIOA Workforce Essentials program, adding a total of $563,333.50 to serve 145 youth. The board will also review the Head Start/Early Head Start self-assessment, receive travel data and bylaws, and discuss the executive director evaluation and search.

workforce-developmentyouthcontractshead-startearly-educationgrantsboard-meeting
✓ Decided: Metro Action Commission approves executive director transition steps

The board unanimously approved Cheryl Jett as liaison between the board and the new executive director, and approved use of Kresge Foundation discretionary funds for the transition. It also approved the Head Start/Early Head Start Self-Assessment FY24, several financial reports, and a $2,403,333 WIOA Workforce Essentials modification. Dr. Cynthia Croom's annual performance evaluation was approved with a 3% salary increase plus 4% COLA.

Thu Aug 22, 2024

Equalization Board

Board hears property value appeals for 77 parcels in Nashville and Antioch

The Metropolitan Board of Equalization will hold formal appeal hearings for 77 residential properties, all listed under appellant Caitlyn Smagh. The board will decide whether to adjust the assessed values of these parcels, which are located on Hillside Cottage Lane, Sterling Ridge, Riverview Lane, Altavista Court, Horizon Drive, and Hamilton Crossing Square. No audio conference or supporting documentation is noted for this hearing.

property-taxequalization-boardappealsnashvilleantioch
✓ Decided: Board approves 100+ property tax appeals, reducing land values

The Metropolitan Board of Equalization approved numerous property tax appeals, primarily reducing land values for West Nashville Residences, LLC and Century Communities of Tennessee, LLC parcels. The board also approved a value change for The Vanderbilt University and denied a change for Germantown II, LLC. All decisions were made unanimously.

Wed Aug 21, 2024

Historic Zoning Commission

MHZC to review 20+ projects in historic overlays, including violations

The Metro Historic Zoning Commission will consider 20+ applications for new construction, additions, and violations in Nashville's historic overlay districts. Items include a new infill project at 201-205 Broadway and violation cases at 905 N 12th St and 2223 30th Ave S. The meeting also includes adoption of prior minutes and administrative permits.

historic-zoningpreservationpublic-hearingviolationsnew-constructionadditionsnashville
✓ Decided: Commission denies demolition of historic house at 905 N. 12th St., orders reconstruction

The Metro Historic Zoning Commission unanimously denied the after-the-fact demolition of the contributing house at 905 N. 12th St., requiring reconstruction of the main massing. It also denied the as-built project at 2223 30th Ave S, ordering corrections within 90 days. Several new construction and addition projects were approved with conditions, while some applications were deferred or withdrawn.

Wed Aug 21, 2024

Equalization Board

Board hears property tax appeals for 30 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for 30 commercial parcels across Nashville and Davidson County. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals from property owner Caitlyn Smagh. Decisions may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationpublic-hearing
✓ Decided: Board approves 24 property tax appeals, reducing assessed values

The Metropolitan Board of Equalization heard 27 property assessment appeals on August 21, 2024, approving reductions for 24 properties and denying changes for 3. All decisions were unanimous. One appeal was withdrawn at the appellant's request.

Wed Aug 21, 2024

Equalization Board

Board hears property tax appeals for 30+ commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on August 21, 2024, for property owners contesting their commercial property assessments. The agenda lists over 30 parcels across Nashville and surrounding areas, with hearings at 8:30 AM and 1:00 PM. The board will also take public comments, approve minutes, and handle old and new business.

property-taxappealscommercial-propertyboard-of-equalizationpublic-hearing
✓ Decided: Board approves 25 property tax appeals, reducing assessed values

The Metropolitan Board of Equalization heard 25 property assessment appeals on August 21, 2024, approving reductions for most properties based on a sale ratio of 0.7143, and denying changes for three properties. One appeal was withdrawn. All decisions were unanimous.

Wed Aug 21, 2024

Health and Educational Facilities Board

Board to consider $289M in housing bonds for 7 projects

The Health and Educational Facilities Board will hold a public hearing and consider preliminary approval for $50 million in bonds for Lyric Antioch Affordable Housing, plus final approvals for six other multifamily housing bond requests totaling up to $239 million. The board will also vote on a payment-in-lieu-of-tax agreement for Hampton Street Property and receive a debt obligation report from Vanderbilt University.

housingbondsaffordable-housingpublic-hearingpilotvanderbilt-university
Wed Aug 21, 2024

Metro Action

Commission to interview executive director candidates and evaluate current director

The Metropolitan Action Commission's Executive Committee is meeting to interview candidates for the executive director position and to conduct an evaluation of the current executive director. The agenda includes only these personnel matters and standard procedural items, with no other substantive business listed.

personnelexecutive-directorcommission-meeting
Wed Aug 21, 2024

Continuum of Care Homelessness Planning Council

CoC committee to rate renewal funding applications for homeless programs

The Performance Evaluation Committee of Nashville's Continuum of Care will rate renewal applications for homeless funding and discuss next steps for new CoC and DV bonus applications. The meeting includes public comments and updates on the Youth Homelessness Demonstration Program.

homelessnessfundingpublic-commentyouthdomestic-violence
Wed Aug 21, 2024

Continuum of Care Homelessness Planning Council

Homelessness council committee sets scope, timeline for new assessment tool

The CE Oversight Committee of Nashville's Continuum of Care is meeting to establish its purpose, norms, and timeline. They will discuss policies and procedures, the creation of a new assessment tool, and the evaluation of the CE Lead. This is an organizational meeting focused on planning, not on specific funding or program decisions.

homelessnesscontinuum-of-carecommitteeassessment-toolplanning
Wed Aug 21, 2024

Community Review Board

Executive committee to discuss board vacancy, misconduct presentation, and MOU update

The Community Review Board Executive Committee is meeting to discuss several operational items, including a board seat vacancy, a sexual misconduct presentation, case records, an MOU update, a legal proposal, and the removal of the MNPD OPA Director. The meeting also includes public comment and new business.

community-review-boardexecutive-committeepolice-oversightsexual-misconductboard-vacancy
Tue Aug 20, 2024 · 6:30 PM

Metropolitan Council

✓ Decided: Council approves 233-unit Pettus Road development and East Bank authority

The Metropolitan Council approved a rezoning for 233 multi-family units and a fire station on Pettus Road, and established an East Bank Development Authority. A large consent agenda was adopted, including funding for homeless services, library programs, and various infrastructure projects. Several appointments were confirmed, while others were deferred or re-referred.

Metropolitan Courthouse
Tue Aug 20, 2024

Mechanical, Plumbing, and Electrical Examiners and Appeals Board

Board to hear appeal on plumbing fixtures for Pin Hook Road structure

The Mechanical, Plumbing, and Electrical Examiners and Appeals Board will hold a public meeting to consider an appeal case, approve minutes, and handle registrations, examinations, and permits. The main item is a variance request for a carport structure at 3618 Pin Hook Road, where the owner seeks to reduce permanent plumbing fixtures by using portable toilets for occasional events.

appealsplumbingvariancepermitsmeeting
✓ Decided: Board approves plumbing variance for Pin Hook Road carport

The board approved a variance allowing a carport structure at 3618 Pin Hook Road to use portable toilets and drinking water for occasional community picnics, instead of installing permanent plumbing fixtures. The approval was unanimous (7-0). No other substantive decisions were made; the meeting included only procedural items and adjournment.

Tue Aug 20, 2024

Metropolitan Council

Council committee to vote on $138,700 for homeless recovery beds

The Public Health and Safety Committee will consider 13 resolutions, including accepting grants for viral hepatitis, tuberculosis, and air pollution programs, and appropriating $138,700 to Welcome Home Ministries for recovery beds for homeless individuals with substance abuse disorders. The committee will also hear a presentation on Metro Animal Care & Control's 2023 summary.

public-healthhomeless-servicesgrantspolicefire-departmentanimal-controlsubstance-abuse
Tue Aug 20, 2024

Metropolitan Council

Library contracts, park grants, and arts commission changes on agenda

The Arts, Parks, Libraries & Entertainment Committee will discuss seven items including software contracts for the Nashville Public Library, a $508,330 appropriation for afterschool programs, a grant for battlefield land acquisition, and amendments to the Arts Commission membership. A presentation on Metro Parks maintenance requests is also scheduled.

librariesparksartsgrantsyouth-programscontractsbattlefield-preservation
Tue Aug 20, 2024

Nashville Health and Well-being Leadership Council

Council to discuss 2025 health assessment priorities

The Nashville Health & Well-being Leadership Council will discuss and potentially adopt its by-laws and vision, and will prioritize strategic issues for the 2025 Community Health Assessment. The meeting also includes approval of July minutes and announcements.

healthcommunity-assessmentby-lawsstrategic-planning
✓ Decided: Council adopts amended bylaws and new vision statement

The Nashville Health & Well-being Leadership Council approved its amended bylaws, focusing on public comment and community voice sections, and adopted a revised vision statement emphasizing equitable recognition and investment in well-being. The council also approved the July 16 meeting minutes and the stated agenda. No other substantive decisions were made.

Tue Aug 20, 2024

Metropolitan Council

Committee to vote on beer permit exemption for Music City Gyros

The Government Operations and Regulations Committee will consider a resolution exempting Music City Gyros Hunter's Station from minimum distance requirements for a beer permit, a joint funding agreement with USGS for lidar data, and several bills on short-term rentals and mechanical code amendments.

beer-permitszoningshort-term-rentalsmechanical-codelidarpublic-hearing
Tue Aug 20, 2024

Metropolitan Council

Committee to consider election kiosk contract and board appointments

The Rules, Confirmations, and Public Elections Committee will vote on a cooperative purchasing agreement for voter registration kiosks for the Election Commission, consider several ceremonial resolutions, and review appointments to the Arts Commission, Auditorium Commission, Farmers Market Board, and other boards. The agenda also includes bills on Arts Commission membership and ethical conduct board procedures.

electionsartsethicsboards-and-commissionsappointmentsvoting-equipment
Tue Aug 20, 2024

Metro Action

Metro Action Commission to interview executive director candidates

The board is meeting to interview candidates for the executive director position. No other substantive business is on the agenda.

commissionexecutive-directorpersonnelnashville
Tue Aug 20, 2024

Equalization Board

Board hears property value appeals for 40+ commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 40 commercial parcels across Nashville. The board will hear appeals from Cowan Street Properties and Caitlyn Smagh, covering properties including hotels, office buildings, and commercial lots. Decisions may be appealed to the State Board of Equalization.

property-taxequalization-boardcommercial-propertyappealsnashville
✓ Decided: Board approves 30 property tax appeals, mostly reducing values

The Metropolitan Board of Equalization heard 30 property assessment appeals on August 20, 2024, approving changes to 24 assessments and denying changes to 6. Most approved changes reduced property values using a sale ratio of 0.7143. One appeal was withdrawn at the appellant's request.

Tue Aug 20, 2024

Equalization Board

Board hears property tax appeals for 30+ commercial parcels

The Metropolitan Board of Equalization holds formal appeal hearings on property assessments for multiple commercial properties across Nashville. Appellants include Cowan Street Properties and Caitlyn Smagh, covering parcels on Cowan St, Great Circle Rd, Marriott Dr, and others. The board will decide on these appeals, which can be further appealed to the State Board of Equalization.

property-taxappealscommercial-propertyboard-of-equalizationpublic-hearing
✓ Decided: Board approves 30 property tax appeals, mostly reducing values

The Metropolitan Board of Equalization heard 30 property assessment appeals on August 20, 2024, and approved changes to 24 of them, mostly reducing assessed values based on a sale ratio of 0.7143. Six appeals were denied (no change), and one was withdrawn. All decisions were unanimous.

Mon Aug 19, 2024

Metropolitan Council

Council committee to vote on 28 items including grants, contracts, and a school land purchase

The Budget and Finance Committee will consider 28 items, mostly consent resolutions for grants, contracts, and appropriations. Notable items include a PILOT agreement for a housing project at 400 South 5th Street, a $138,700 appropriation for recovery beds for homeless individuals, and a bill on third reading to purchase properties for a new elementary school in Antioch.

budgetfinancehousinghomeless-servicesparksschoolspublic-safetygrants
Mon Aug 19, 2024

Historical Commission

Historical Commission to vote on two new historical markers

The Metropolitan Historical Commission will vote on approving two historical markers: one for Pearl Creswell and the Creswell House (participatory budget), and one for the Compton-Burton House (privately funded). The meeting also includes a guest speaker from the Tennessee Wars Commission and reports on historic zoning and the director's update.

historical-commissionhistorical-markerspublic-hearingnashville
✓ Decided: Historical Commission approves two Nashville historical markers

The Metropolitan Historical Commission unanimously approved two historical markers: one for Pearl Sanders Creswell/Creswell House at 910 17th Avenue North and one for Compton-Burton House and Farm along Burton Hills Boulevard. The commission also approved text changes for the Compton-Burton marker, adding 'and never rebuilt' and removing 'to the property.' No other substantive decisions were made; the meeting included a guest presentation and staff reports.

Mon Aug 19, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings on 30 commercial properties. The board, which is independent from the Property Assessor's Office, will hear appeals from property owners challenging their assessed values. Decisions can be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationpublic-hearing
✓ Decided: Board approves 25 property tax appeals, adjusts values

The Metropolitan Board of Equalization heard 25 property tax appeals on August 19, 2024, all presented by Caitlyn Smagh of Ryan, LLC. The board unanimously approved motions to change the assessed value on 19 properties, applying a sale ratio of 0.7143, and to keep the value unchanged on 6 properties. All decisions were unanimous.

Mon Aug 19, 2024

Bicycle and Pedestrian Advisory Commission

Bicycle and Pedestrian Advisory Commission meeting on August 19, 2024

The committee will discuss the Cumberland River Compact and receive updates on the Athena and Church bikeways projects. Members will also discuss subcommittee creation and meeting frequency.

transportationbikingpedestrianinfrastructureriver-compact
Mon Aug 19, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 30 commercial properties, including parcels on West End Ave, Church St, and Dell Pkwy. The board, which is independent from the Assessor's Office, will decide on property tax assessments; its decisions can be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves property value changes for 30+ Nashville appeals

The Metropolitan Board of Equalization heard 33 property assessment appeals, all presented by Ryan, LLC, and voted unanimously on each. The board approved value changes for 24 properties, applying a sale ratio of 0.7143 to reduce assessed values, and denied changes for 9 properties, keeping their original values. All decisions were unanimous.

Mon Aug 19, 2024

Metropolitan Council

Transportation committee to vote on sidewalk, parking, and road projects

The Transportation and Infrastructure Committee will consider resolutions authorizing contracts for a transportation analytics platform, sidewalk reconstruction, and flood-prone property purchases, along with several sewer and water main projects. A presentation on Complete and Green Streets design guidelines is also scheduled.

transportationinfrastructuresidewalkparkingstormwatersewerflood
Mon Aug 19, 2024

Metropolitan Council

Council to weigh 230-unit Pettus Road development and East Bank rezoning

The Planning and Zoning Committee is reviewing a wide range of zoning changes, development approvals, and infrastructure agreements. Key items include a proposed 230-unit multi-family development with a fire station on Pettus Road, a major mixed-use rezoning near Hickory Hollow, and the creation of an East Bank Subdistrict in the Downtown Code. The committee will also consider several sewer, water, and sidewalk agreements.

zoninghousingdevelopmentinfrastructurepublic-hearing
Fri Aug 16, 2024

Continuum of Care Homelessness Planning Council

Homelessness council subcommittee to plan annual Point-in-Time Count

The Point-in-Time Count Subcommittee of the Continuum of Care Homelessness Planning Council will meet to discuss methodology for the annual homeless count, including HUD planning, volunteer recruitment, zone assignments, data collection, and youth count strategies. The meeting includes a values statement on racial equity.

homelessnesspoint-in-time-countdata-collectionvolunteer-recruitmentracial-equitynashville
Fri Aug 16, 2024

Human Relations Commission

Human Relations Commission committee to review bylaws and rules

The Bylaws and Rules Ad hoc Committee of the Metro Human Relations Commission is meeting to review its bylaws and rules. The agenda includes call to order, quorum confirmation, public comments, old business, and new business focused on the bylaws review. No specific proposals or decisions are listed.

human-relationsbylawsrulescommittee
Fri Aug 16, 2024

Human Relations Commission

Executive Committee to set goals and review orientation materials

The Metro Human Relations Commission's Executive Committee will discuss its purpose, procedures, and goals for the new term, review orientation materials for an upcoming training, and consider an executed Title VI Conciliation Agreement. The meeting is largely procedural and organizational.

human-relationsexecutive-committeeorientationtitle-viprocedural
Thu Aug 15, 2024

District Energy System Advisory Board

District Energy Board to review FY25 budget and contractor performance

The Metro Nashville District Energy System Advisory Board will discuss and review the FY25 budget, FY24 costs, natural gas purchasing status, and contractor performance. The meeting also includes updates on customer sales, marketing, and capital projects.

district-energybudgetnatural-gascontractor-performancecapital-projectsnashville
Thu Aug 15, 2024

Sports Authority Board

Sports Authority to review Bridgestone Arena capital plan, SEC tournament costs

The Sports Authority Finance Committee will consider several resolutions, including a capital asset management plan for Bridgestone Arena, reimbursement to Powers Management for 2024 SEC Tournament costs, and engagement of Capital Project Solutions for Nissan Stadium capital project reviews. The board will also vote on a second amendment for construction management services related to MLS Stadium infrastructure and a memorandum of understanding with the Fair Commission.

sports-authoritybridgestone-arenanissan-stadiummls-stadiumsec-tournamentcapital-projectsconstruction
Thu Aug 15, 2024

Sports Authority Board

Sports Authority to review Bridgestone Arena capital plan, MLS stadium contracts

The Sports Authority Board will consider several resolutions including a capital asset management plan for Bridgestone Arena, reimbursement for SEC Tournament costs, and a contract amendment for MLS stadium infrastructure. They will also discuss the East Bank Stadium project and receive a progress update on Nissan Stadium.

sports-authoritybridgestone-arenanissan-stadiummls-stadiumcapital-projectscontractspublic-meeting
Thu Aug 15, 2024

Zoning Appeals Board

Zoning board to hear mixed-use project, batting facility, and home variances

The Metropolitan Board of Zoning Appeals will consider several requests for variances and special exceptions, including a mixed-use building at 2200-2204 Elliston Pl, an indoor batting facility at 9022 Highway 70, and multiple single-family residence variances. Two cases are deferred from prior meetings and one has been withdrawn.

zoningvariancesspecial-exceptionsmixed-usesingle-familyreligious-institutionrecreation
Thu Aug 15, 2024

Arts Commission

Arts Commission to review public art proposals for Strobel House and Looby Center

The Metro Arts Commission will consider design proposals for public art at the Strobel House and the Z. Alexander Looby Community Center, and receive updates from several committees including Grants, Anti-Racism & Equity, and Budget & Oversight. The meeting includes public comment, approval of July minutes, and an artist spotlight.

arts-commissionpublic-artcommunity-centersgrantsequitybudget
Thu Aug 15, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals on capacity, encampments, and housing

The Shelter Committee is reviewing current goals, including shelter capacity, encampment plans, and document barriers. Some goals are on track, while increasing affordable housing capacity and voucher utilization are off track. The committee will also hear agency updates and discuss a revision of the camp engagement plan and family sheltering needs.

shelterhomelessnesshousingencampmentsvouchersfamily-sheltering
Thu Aug 15, 2024

Equalization Board

Board hears 38 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 38 commercial properties across Nashville, Madison, Brentwood, and Goodlettsville. The board, an independent body appointed by the mayor and confirmed by the council, will decide on property value disputes that can be appealed to the State Board of Equalization. A public comment period is scheduled at the start of the meeting.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves 13 property tax appeals, reduces assessed values

The Metropolitan Board of Equalization heard property tax appeals on August 15, 2024, approving 13 appeals that reduced assessed values for commercial properties, and withdrawing 17 appeals at the appellants' request. All approved changes were unanimous and applied a sale ratio of 0.7143.

Thu Aug 15, 2024

Equalization Board

Board hears 40+ commercial property tax appeals Aug 15

The Metropolitan Board of Equalization holds formal appeal hearings on commercial property assessments, with sessions at 8:30 AM and 1:00 PM. The agenda lists dozens of specific commercial parcels across Nashville, Madison, Goodlettsville, and Brentwood, all appealed by Evans & Petree. No supporting documentation or audio conference is noted for any appeal. The board's decisions can be appealed to the State Board of Equalization.

property-taxappealscommercial-propertyequalization-boardnashville
✓ Decided: Board approves multiple property value reductions using sale ratio

The Metropolitan Board of Equalization approved several property assessment appeals, reducing total values based on a sale ratio of 0.7143. The board also approved minutes from prior meetings and elected temporary chairs for both sessions. Multiple appeals were withdrawn at the appellant's request.

Thu Aug 15, 2024

Emergency Communication District (E-911) Board

E-911 Board to review July financials and public awareness update

The Davidson County Emergency Communication District Board will meet to adopt minutes from June, review the July 2024 financial statement, and receive a public awareness update. No major policy decisions or contracts are on the agenda.

e-911emergency-communicationfinancial-reportpublic-awarenessboard-meeting
Thu Aug 15, 2024

Transportation Licensing Commission

TLC proposes rule change on pedal vehicle operating hours

The Transportation Licensing Commission is discussing a proposed amendment to Section 702 regarding operational hours for pedal vehicles. The change would allow operation during previously restricted morning and afternoon rush hours on routes approved by TLC and NDOT officials.

transportationlicensingpedal-vehiclesrulesnashville
✓ Decided: TLC approves Nashville Bar Bike extra pedal carriage permit, denies Music City Crawler

The Transportation Licensing Commission approved one additional pedal carriage permit for Nashville Bar Bike, conditioned on surrendering its Nashville Bar Bus entertainment transportation permit, and denied Music City Crawler's application for an extra permit. The commission also approved a $75 lienholder processing fee for wrecker companies, deferred several disciplinary hearings and a proposed rule change on pedal vehicle hours, and approved multiple vehicle-for-hire applications.

Wed Aug 14, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission executive committee to discuss bylaws, budget, and code amendments

The Nashville Music, Film and Entertainment Commission's Executive Committee is meeting to handle unfinished business, including a bylaws update, a budget allocation update, and a recommendation on code-amending legislation. The agenda is largely procedural, with no new business listed. Public comment is permitted.

entertainmentbylawsbudgetlegislationstrategic-planning
Wed Aug 14, 2024

Nashville Entertainment Commission

Bylaws committee to review suggested updates from Executive Committee

The Ad Hoc Bylaws Committee of the Nashville Music, Film, and Entertainment Commission is meeting to consider suggested updates to its bylaws from the Executive Committee, with a possible action item. The agenda is otherwise procedural, including a public comment period and routine items.

bylawsentertainment-commissionmusic-film-and-entertainment-commissionnashville
Wed Aug 14, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission meets August 14, 2024

The Commission will elect officers for the 2024-2025 term and review updates on several ongoing items. Action items include reviewing the Executive Director job description and bylaws updates.

government-administrationemploymentbudgetlegislation
✓ Decided: Commission re-elects Butler chair, approves job description with HR language

The Nashville Music, Film, and Entertainment Commission re-elected Max Butler as Chair and Jeff Gordon as Vice Chair unanimously. It approved the executive director job description with Metro HR's recommended language allowing industry experience to substitute for a college degree. The secretary election was deferred to the next meeting. The commission also amended its bylaws to clarify committee establishment and membership rules.

Wed Aug 14, 2024

Social Services Commission

Metro Social Services board to review executive director's performance

The board will consider approving meeting summaries from June and July, hear a finance report, and receive the director's administrative report. A nomination/personnel committee will discuss the executive director's performance evaluation.

social-servicesboard-meetingfinancepersonnelperformance-evaluation
Wed Aug 14, 2024

Election Commission

Election Commission to certify primary and approve November election plans

The Davidson County Election Commission will certify the August 1 primary and municipal election results, approve poll workers and early voting for the November 5 general and special elections, and schedule a certification meeting for November 22. The agenda also includes public comments, minutes approval, and an AOE report.

election-commissionelectionsearly-votingpoll-workerscertification
✓ Decided: Election Commission certifies Aug. 1 primary and local election results

The Davidson County Election Commission certified the results of the August 1, 2024 Republican and Democratic primaries, County General election, State Judicial Retention Questions, and Oak Hill Municipal Election. The board also approved poll officials and the early voting schedule for the November 5, 2024 elections, and set a certification meeting for November 22, 2024.

Wed Aug 14, 2024

Equalization Board

Property tax appeal hearings for 40+ parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments. The agenda lists one residential appeal at 8:30 AM and a series of commercial property appeals by Evans & Petree starting at 8:45 AM and continuing at 1:00 PM. No supporting documentation or audio conference is noted for any appeal.

property-taxappealsequalization-boardnashvillecommercial-propertyresidential-property
✓ Decided: Board approves 25 property tax appeals, reduces assessed values

The Metropolitan Board of Equalization heard 30 property tax appeals on August 14, 2024, approving 25 motions to change assessed values, all unanimously. Most changes applied a sale ratio of 0.7143 to reduce land and improvement values. Five appeals were withdrawn at the appellant's request. The board also approved minutes and adjourned.

Wed Aug 14, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses from May to August

The Metropolitan Sexually Oriented Business Licensing Board is meeting to approve minutes from May 22, 2024, and to consider new and renewal entertainer permits and business licenses for several periods from May 23 to August 14, 2024. The board will also hear an inspector's report and a public comment period.

sexually-oriented-businesslicensingpermitsnashville
Wed Aug 14, 2024

Continuum of Care Homelessness Planning Council

Homelessness Planning Council to elect chair and vice chair

The Nashville-Davidson County Continuum of Care Homelessness Planning Council will meet to elect a new chair and vice chair, review minutes, and receive updates from the Office of Homeless Services and MDHA. They will also discuss the Strobel House referral process, Youth Action Board, and FY2024 funding opportunities.

homelessnesselectionsfundinghmisyouth
Wed Aug 14, 2024

Equalization Board

Board hears property tax appeals for dozens of Nashville parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for multiple residential and commercial parcels across Nashville. The agenda lists two appellants—Vanessa Tseng (one residential property) and Evans & Petree (dozens of commercial properties)—with hearings at 8:30 AM and 1:00 PM. The board will also take public comments, review minutes, and handle old and new business. Decisions can be appealed to the State Board of Equalization.

property-taxappealsequalization-boardcommercial-propertyresidential-property
✓ Decided: Board approves 25 property tax appeals, reducing assessed values

The Metropolitan Board of Equalization heard 30 property assessment appeals on August 14, 2024, approving 25 motions to change property values, denying none, and withdrawing 5 appeals at the appellants' request. All approved changes were unanimous and applied a sale ratio of 0.7143 to reduce assessed values.

Wed Aug 14, 2024

Arts Commission

Arts Commission nominating committee to recommend officers and chairs

The Nominating Committee of the Metro Arts Commission will meet to discuss and make recommendations for the full Commission, including the 2024-2025 slate of officers and committee chair appointments. The meeting includes a public comment period and is scheduled for August 14, 2024.

arts-commissionnominating-committeeofficer-appointmentspublic-comment
Tue Aug 13, 2024

Civil Service Commission

Civil Service Commission to approve dozens of appointments, terminations, and pensions

The Metropolitan Civil Service Commission will meet to approve routine personnel actions, including appointments, terminations, and pensions, as well as an eligibility register report. The agenda is largely procedural, with no policy discussions or public hearings listed.

civil-servicepersonnelappointmentsterminationspensionshuman-resources
✓ Decided: Civil Service Commission approves appointments, terminations, and eligibility register

The commission approved the appointments, terminations/pensions, and eligibility register report as listed, with no objections. It also accepted an agreed order for D. Howse, approved an initial order for J. Westmoreland, granted an increment advance for Captain Terrance Graves, extended injury-on-duty leave for three employees, accepted revisions to Civil Service Policy 7.2 C-I/8.2 C-I, and extended the IAFF MOU for six months. No public comments were made.

Tue Aug 13, 2024

Fire and Building Code Appeals Board

Fire and Building Code Appeals Board hears four appeals on code variances

The Board will hear four appeal cases seeking variances from fire and building code requirements, including party wall openings, fire alarm sound levels, and parking garage clear height. The meeting also includes a public comment period and approval of previous minutes.

fire-codebuilding-codeappealsvariancesnashville
✓ Decided: Board approves 3 of 4 building code appeals, denies parking height appeal

The Board of Fire and Building Code Appeals approved three appeals and denied one. Approved: a party wall easement at 2108 B 8th Avenue South, a hotel fire alarm sound level variance at 627 Old Hickory Blvd., and a party wall roof drainage opening at 301 B Union Street. Denied: a parking garage ceiling height variance at 3025 Charlotte Avenue. All votes were 6-0.

Tue Aug 13, 2024

Metro Development and Housing Agency Board

MDHA board to consider two PILOT agreements for housing projects

The Metro Development and Housing Agency Board will meet to approve minutes, hear public comments, and receive committee reports. The main business is considering two Payment in Lieu of Taxes (PILOT) agreements for the Trinity Flats and North River developments, which are likely to affect affordable housing. The rest of the agenda is procedural.

housingpilotsfinancedevelopment
Tue Aug 13, 2024

Metro Action

Commission to interview executive director candidates

The Metropolitan Action Commission's Executive Committee is meeting to interview candidates for the executive director position. The agenda includes only the call to order, the candidate interviews, and adjournment, with no other business items.

commissionexecutive-directorhiringmeeting
Tue Aug 13, 2024

Metro Development and Housing Agency Board

MDHA committee to hear affordable housing occupancy and lease termination updates

The Housing and Community Committee will receive presentations on affordable housing occupancy, waiting lists, and tenant accounts receivable, as well as MDHA lease terminations. No votes or decisions are scheduled; the agenda is primarily informational and procedural.

affordable-housinghousingpublic-housingtenantsleases
Tue Aug 13, 2024

Metro Development and Housing Agency Board

MDHA committee previews 2025 budget, three PILOT agreements

The Finance and Development Committee will discuss the 2025 agency operating budget, a driver safety matching grant program, and three PILOT (payment in lieu of taxes) agreements for Trinity Flats, North River, and Burning Tree. Board decisions are requested in August or September. The meeting also includes approval of prior minutes and public comment.

budgethousingpilotspublic-safetyfinance
Tue Aug 13, 2024

Equalization Board

Board hears 40+ commercial property tax appeals in one day

The Metropolitan Board of Equalization will hold formal appeal hearings on August 13, 2024, for dozens of commercial properties across Nashville. Property owners are challenging their assessed values before the independent board, whose decisions can be appealed to the State Board of Equalization. The agenda lists 40+ parcels, all represented by Evans & Petree, with no supporting documentation or audio conference noted.

property-taxappealscommercial-propertyequalization-boardnashville
✓ Decided: Board approves multiple property value appeals using sale ratio

The Metropolitan Board of Equalization heard property assessment appeals in morning and afternoon sessions. The board approved value changes for most appealed properties, applying a sale ratio of 0.7143 to reduce assessed values, and denied changes for a few properties. Several appeals were withdrawn at the appellant's request. The afternoon session elected a temporary chair due to the absence of the chair and vice chair.

Tue Aug 13, 2024

Equalization Board

Board hears 30+ commercial property tax appeals

The Metropolitan Board of Equalization holds formal appeal hearings for commercial property owners challenging their assessed values. The agenda lists 30+ parcels, all commercial, with hearings scheduled at 8:30 AM and 1:00 PM. No dollar amounts or decisions are recorded in the agenda.

property-taxappealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves property value changes for 18 Nashville parcels

The Metropolitan Board of Equalization heard appeals on 25 properties, approving value changes for 18 and denying none. All changes were unanimously approved and applied a sale ratio of 0.7143. Seven appeals were withdrawn at the appellant's request. The board also elected a temporary chair for the afternoon session.

Tue Aug 13, 2024

Metropolitan Council

Executive Committee meets for procedural updates and chair transitions

This is a procedural meeting of the Metro Council Executive Committee. The agenda includes only routine updates from the Vice Mayor and Council Office, plus memos on committee chair transitions. No legislation, votes, or public hearings are scheduled.

metropolitan-councilexecutive-committeeprocedural-meeting
Tue Aug 13, 2024

Fair Commissioners Board

Fair Board to extend infrastructure contract for Geodis Park area through 2027

The Fair Commissioners Board is deciding on a Memorandum of Understanding with the Sports Authority to extend an existing infrastructure contract with Bell & Associates Construction, LLC through December 31, 2027. The extension adds $258,772 for maintenance of landscaping along Benton and Wedgewood Avenues at the Fairgrounds. The Fair Board would be solely responsible for the additional costs and must indemnify the Sports Authority. The MOU requires approval from the Metropolitan Council.

fair-boardsports-authorityinfrastructurecontract-extensiongeodis-parkfairgroundsbudget
Tue Aug 13, 2024

Continuum of Care Homelessness Planning Council

Council reviews federal criteria to end veteran homelessness

The Continuum of Care Homelessness Planning Council is discussing the federal Criteria and Benchmarks for Ending Veteran Homelessness, a guide for communities to achieve and confirm an end to veteran homelessness. The document outlines five criteria and four benchmarks focused on identifying all homeless veterans, providing immediate shelter, and ensuring swift access to permanent housing. No decisions or votes are recorded on this agenda.

homelessnessveteranshousingcontinuum-of-carefederal-guidelines
Tue Aug 13, 2024

Arts Commission

Arts Commission to finalize equity definitions and FY25 goals

The Metro Arts Commission's Anti-Racism and Equity Committee will discuss and potentially adopt definitions for equity and antiracism, and prioritize goals for fiscal year 2025. The meeting includes public comment and approval of prior minutes.

artsequityantiracismpublic-commentgoals
Mon Aug 12, 2024

Equalization Board

Board hears 30+ commercial property tax appeals from Evans & Petree

The Metropolitan Board of Equalization will hold formal appeal hearings for commercial property tax assessments. The agenda lists over 30 parcels, all represented by Evans & Petree, with no supporting documentation or audio conference noted. The board will also take public comment, approve minutes, and handle old and new business.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board approves 20 property tax appeals, reduces values

The Metropolitan Board of Equalization heard 20 property tax appeals, approving all with reduced assessed values based on a sale ratio of 0.7143. Five appeals were withdrawn at the appellant's request. The board also approved the meeting minutes and adjourned.

Mon Aug 12, 2024

Traffic and Parking Commission

Commission to vote on right-of-way abandonments for Metro Water plant expansion

The Traffic and Parking Commission will consider several consent agenda items including right-of-way abandonments for Metro Water Services' Dry Creek plant expansion and the Paseo South Gulch development, new pedestrian and traffic control devices, and a truck restriction on Knight Drive. Regular agenda items include a draft sidewalk vending ordinance adding probation as a penalty and a draft loading zone ordinance giving NDOT flexibility to set time limits. Unfinished business items on a smart loading pilot and speed limit reductions on Hermitage Ave/Lebanon Pk are deferred for additional stakeholder engagement.

trafficparkingright-of-waypedestrian-safetytruck-restrictionsidewalk-vendingloading-zones
✓ Decided: Commission approves sidewalk vending and loading ordinance revisions

The Traffic and Parking Commission approved revisions to sidewalk vending and loading ordinances, and lifted a permit suspension for Munchies LLC. Several traffic control requests were approved on the consent agenda, while other items were deferred for further study.

Mon Aug 12, 2024

Equalization Board

Board hears 30+ commercial property tax appeals from Evans & Petree

The Metropolitan Board of Equalization will hold formal appeal hearings for commercial properties represented by Evans & Petree. The board will hear appeals on 30+ parcels across Nashville, including properties on Woodfolk Ave, French Landing Dr, Donelson Pike, and Gallatin Ave. No supporting documentation or audio conference is listed for these appeals.

property-taxcommercial-propertyappealsequalization-boardnashville
✓ Decided: Board approves 20 property tax appeals, reduces values

The Metropolitan Board of Equalization approved 20 property tax appeals, reducing assessed values for commercial and residential properties across Nashville. All motions were unanimous, applying a sale ratio of 0.7143 to adjust values. Five appeals were withdrawn at the appellant's request.

Mon Aug 12, 2024

Metropolitan Council

Minority Caucus meeting scheduled for August 12, 2024

The Minority Caucus will meet at Kingdom Café & Grill to discuss internal business and presentations. The agenda includes a treasurer's report, discussion of new interns, and a youth presentation by Gideon's Army.

government-operationscommunity-events
Mon Aug 12, 2024

Continuum of Care Homelessness Planning Council

CoC Equity Committee to discuss racial disparities research and equity tools

The Equity & Diversity Committee of Nashville's Continuum of Care will meet to discuss updates to racial equity resources and an equity scoring rubric, review next steps for racial disparities research using data from the Mary Parrish Center and the Homeless Management Information System, and discuss racial equity training. The meeting includes a reading of the CoC's anti-racism pledge.

homelessnessracial-equitydatatrainingnashville
Mon Aug 12, 2024

Arts Commission

Arts Commission grants committee to review FY24 closeout and restructuring

The Grants and Funding Committee will discuss updates on FY24 second payments, the Thrive Conciliation Agreement, and a closeout report for Fiscal 2024 operating grants. The committee will also review restructuring of operating grants and a walk-through of the council process. No final votes are scheduled; the meeting is primarily for discussion and updates.

artsgrantscommitteebudgetthrive
Fri Aug 9, 2024

Continuum of Care Homelessness Planning Council

CoC chairs meet to review charter, strategic plan, and lived-experience engagement

The Continuum of Care Joint Committee Chairs Collaborative will meet to review the updated CoC Charter, discuss roles and responsibilities, and cover Robert’s Rules of Order and the TN Open Meetings Act. They will also explore ways to engage people with lived experience, including collaboration with the Consumer Advisory Board (CAB) and Youth Advisory Board (YAB), and revisit strategic plan responsibilities and committee goals.

homelessnesscontinuum-of-carestrategic-planningpublic-meetinglived-experiencegovernance
Thu Aug 8, 2024

Planning Commission

Planning Commission to consider 23 items, most deferred to later meetings

The Nashville Planning Commission will hold a regular meeting on August 8, 2024, to consider 23 items including rezonings, specific plan amendments, and subdivision plats. Many items are recommended for deferral to later meetings, while others are on the consent agenda or have staff recommendations for approval. The commission will also handle routine business such as approving minutes and reports.

zoningplanningrezoningspecific-plansubdivisionoverlay-districthousing
✓ Decided: Planning Commission approves Rock Harbor Marina mixed-use rezoning

The Planning Commission approved a rezoning for the Rock Harbor Marina site at 525 and 517 Basswood Ave., allowing a mixed-use development with up to 300 multi-family units, a marina, restaurants, and limited short-term rentals. The commission also approved a Neighborhood Landmark Overlay for Patsy Cline's former home at 815 Nella Drive, permitting a short-term rental, museum, and production studio. Several other rezoning and subdivision requests were approved, while numerous items were deferred to future meetings.

Thu Aug 8, 2024

Beer Permit Board

Beer Board to decide on 11 new permits, 16 deferrals, 8 complaints

The Metro Beer Permit Board will consider 11 new beer permit applications, including for Friends in Low Places, Bridgestone Arena expansion, and a Robert's 25th Anniversary special event. Sixteen applications are recommended for deferral due to missing documents. The board will also decide on eight complaints alleging underage sales, with proposed civil penalties ranging from $2,000 to $3,000.

beer-permitsalcohol-regulationpublic-hearingcomplaintspermitsnashville
✓ Decided: Beer board grants 11 permits, defers 16, fines 8 businesses

The Metro Beer Permit Board approved 11 new or transferred beer permits, deferred 16 applications indefinitely due to missing documents, and issued civil penalties to 8 businesses for underage sales and related violations. One application was withdrawn after the owner's criminal conviction was discussed.

Thu Aug 8, 2024

Health Board

Board of Health to approve job posting for new Public Health Director

The Board of Health is discussing the hiring process for a new Public Health Director, including approval of the job posting, marketing materials, and timeline. Board members are asked to hold dates for interviews and to submit recommendations for advertising, candidate recruitment, and interview questions by September 2, 2024. The agenda also includes identifying board members for a subject matter expert panel and an interview panel.

public-healthhiringboard-of-healthpersonnelnashville
✓ Decided: Board approves director search posting, grants, and interim pay

The Board of Health approved the HR posting, marketing piece, and timeline for the Director of Health search, along with a 17% out-of-class pay increase for Dr. Joanna Shaw-KaiKai as Interim Director and Chief Medical Officer. It also approved one grant application and eight grants/contracts, including a $5,688,500 direct appropriation to the Mental Health Coop. All votes were unanimous.

Thu Aug 8, 2024

Equalization Board

Board hears 40+ commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings on property tax assessments for dozens of commercial properties across Nashville and Davidson County. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals from property owner Caitlyn Smagh for parcels including 3474 Dickerson Pike, 2400 Buena Vista Pike, and others. Decisions may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
Thu Aug 8, 2024

Arts Commission

Arts committee to review three public art proposals, including Frederick Douglass Park

The Public Art Committee will consider three action items: a temporary art proposal for Frederick Douglass Park by the Nashville Tree Foundation, a design proposal by Omari Booker for Strobel House, and a design proposal by Creative Girls Rock for Looby Community Center. The committee will also discuss the temporary art process and evaluate the lending library collection. Public comments are limited to 20 minutes total, with 2 minutes per speaker.

public-artarts-commissiondesign-proposalsparkscommunity-centers
Thu Aug 8, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 30 commercial properties. The board, which is independent from the Office of Assessments, will hear appeals from property owners challenging their assessed values. Decisions may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationpublic-hearing
Wed Aug 7, 2024

Equalization Board

Board hears property tax appeals for 30+ commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for over 30 commercial parcels across Nashville and Madison. Two appellants — Cowan Street Properties and Caitlyn Smagh — are scheduled for separate sessions at 8:30 AM and 1:00 PM. The board will also take public comment, approve minutes, and handle old and new business.

property-taxappealscommercial-propertyboard-of-equalizationnashville
Wed Aug 7, 2024

Greenways and Open Space Commission

Greenways Commission to discuss open space acquisitions and 440 Greenway field trip

The Greenways and Open Space Commission will consider June meeting minutes, hear public comments, and discuss open space acquisitions and project updates. Staff will present the Greenways for Nashville report and Metro department updates. The chair will report on an October field trip along the 440 Greenway from Sevier Park to Gale Lane Park and Browns Creek Park.

greenwaysopen-spaceparkstrailsacquisitionsfield-tripnashville
Wed Aug 7, 2024

Arts Commission

Arts Commission nominating committee to recommend officers and chairs

The Nominating Committee of the Nashville Arts Commission is meeting to discuss and prepare recommendations for the full Commission, including the 2024-2025 slate of officers and committee chair appointments. The agenda also includes a review of committee responsibilities and a timeline. Public comment is limited to 20 minutes total, with 2 minutes per speaker.

arts-commissionnominating-committeeappointmentspublic-comment
✓ Decided: Arts Commission tables officer slate until Aug. 14

The Nominating Committee tabled the selection of a slate of officers for the Metro Arts Commission to allow Commissioners West and Kurtz to respond about their interest in the chair and vice chair roles. The committee will reconvene on August 14 to vote on the slate. No other substantive decisions were made.

Wed Aug 7, 2024

Equalization Board

Metro Board of Equalization hears property tax appeals for 40+ commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on August 7, 2024, for commercial property owners contesting their property assessments. The agenda lists dozens of parcels across Nashville, including properties on Cowan Street, Vantage Way, and Century Boulevard. The board will also take public comments, approve minutes, and handle old and new business.

property-taxappealscommercial-propertyboard-of-equalizationpublic-hearing
Tue Aug 6, 2024 · 6:30 PM

Metropolitan Council

Metro Council to vote on zoning changes and board appointments

The Metropolitan Council will consider multiple zoning ordinances, including changes for properties on Pettus Road, Warbler Way, Hillsboro Circle, and Hickory Hollow Parkway. Several board appointments and rule amendments are also on the agenda. Public hearings will include Spanish interpretation services.

appointmentszoninghousingpublic-hearingrules-procedure
✓ Decided: Council advances charter amendments, approves 40-unit Buena Vista Pike rezoning

The Metropolitan Council approved a resolution placing two charter amendments on the ballot, including one on affordable housing, and deferred the overall resolution to January 2026. It also passed on third reading a rezoning at 2840-2842 Buena Vista Pike to permit 40 multi-family units (32-0). Numerous zoning bills passed second reading and were referred to committees, while several appointments were deferred or re-referred.

Metropolitan Courthouse
Tue Aug 6, 2024

Metropolitan Council

Charter Revision Committee considers ballot amendments

The Charter Revision Committee is meeting to consider proposed amendments to the Metropolitan Government charter. The committee will vote on resolutions to place charter amendments on the ballot, including three specific amendments proposed by council members.

charteramendmentsballotcommitteenashville
Tue Aug 6, 2024

Employee Benefit Board

Employee Benefit Board to consider disability pensions and pensioner dependent additions

The Metropolitan Employee Benefit Board will meet to approve prior meeting minutes, hear disability pension requests and reexaminations, and discuss pension matters including service and survivor pensions. The board will also consider a proposal to allow pensioners to add dependents outside of an eligible change in status, and receive utilization reports from Blue Cross Blue Shield and CIGNA.

employee-benefitspensionsdisabilitypublic-commenthealth-insurance
✓ Decided: Board approves multiple disability pensions and IOD claims

The Board approved several disability pension requests, reexaminations, and in-line-of-duty (IOD) medical care claims, including overturning denials for ALS and PTSD-related claims. It also approved a policy change allowing pensioners to add dependents outside of eligible change-in-status events starting January 1, 2026. All actions were taken as recommended, with some votes split.

Tue Aug 6, 2024

Metropolitan Council

Council committee to review library grant and Parthenon cultural services contract

The Arts, Parks, Libraries & Entertainment Committee is meeting to consider two resolutions: accepting a state library grant for the Nashville Public Library and approving a grant contract with the Conservancy for the Parthenon and Centennial Park for cultural event management. The committee will also hear a presentation on Metro Parks maintenance requests. Public comment is limited to eight minutes total, with two minutes per speaker.

librariesparksgrantscultural-eventsmaintenance
Tue Aug 6, 2024

Arts Commission

Arts Commission committee reviews FY24 closeout and FY25 budget report

The Budget and Administrative Oversight Committee will discuss the FY24 closeout, receive an FY25 budget report, and review HR and administrative processes. Public comment is accepted in person or via an online form. The meeting includes approval of July 16 minutes and scheduling the next meeting for October 1, 2024.

arts-commissionbudgetpublic-commentadministrative
✓ Decided: Arts Commission committee reviews FY25 budget, audit, grants

The Budget & Administrative Oversight Committee met and approved minutes from three prior meetings. They discussed the unfinished FY24 budget closeout, reviewed the FY25 budget, and addressed grant management issues with Metro and the State of Tennessee, including missing contracts. The committee also reviewed audit findings and corrective actions, and discussed a proposed disparity study and MHRC conciliation agreement.

Tue Aug 6, 2024

Parks and Recreation Board

Finance Committee to vote on salary increases for Parks Director

The Parks and Recreation Board's Finance Committee will consider approving an open range salary increase and cost-of-living adjustment for the Director of Parks, consistent with the 2024-25 Metro Government Pay Plan. The meeting includes a call to order and a public comment period.

parkssalarybudgetpersonnel
Tue Aug 6, 2024

Equalization Board

Board hears 40+ commercial property tax appeals

The Metropolitan Board of Equalization holds formal appeal hearings on commercial property assessments. The agenda lists 40+ parcels across Nashville, Hermitage, Madison, and other areas, all designated as commercial (COM). The board will hear appeals from property owner Caitlyn Smagh, with no audio conference or supporting documentation noted for any item.

property-taxcommercial-propertyappealsboard-of-equalizationnashville
Tue Aug 6, 2024

Metropolitan Council

Public Health & Safety Committee to hear police violence intervention program and accept multiple federal grants

The committee will receive a presentation from MNPD on the Group Violence Intervention Program and vote on several resolutions to accept federal and regional grants for infant mortality reduction, HIV/AIDS services, nutrition/transportation for older adults, homeless management software, coordinated entry for homeless services, and a forensic science improvement grant for police.

public-safetypolicegrantshealthhomeless-serviceshiv-aidssenior-services
Tue Aug 6, 2024

Metropolitan Council

Beer permit exemption for Butterlamp Bread & Beverage

The committee will consider a resolution to exempt Butterlamp Bread & Beverage at 1101 Chapel Ave from minimum distance requirements for a beer permit. Also on the agenda are a cybersecurity grant application, and amendments to code sections on algae/moss and the no-solicitation list.

alcoholbeer-permitcybersecurityhousing-codepublic-hearingsolicitation
Tue Aug 6, 2024

Parks and Recreation Board

Board to vote on renaming Cumberland Park to Wasioto Park and other park items

The Nashville Parks and Recreation Board is meeting to consider a range of items, including a proposal to rename Cumberland Park to Wasioto Park, the original Shawnee name of the Cumberland River. The board will also vote on several donations, easements, and a lease extension for the Metro Mounted Patrol. Public comment is limited to 20 minutes total, with 2 minutes per speaker.

parksrenamingeasementsdonationseventspolicemural
Tue Aug 6, 2024

Equalization Board

Board hears 30+ commercial property tax appeals

The Metropolitan Board of Equalization holds formal appeal hearings on commercial property assessments. The agenda lists 30+ commercial parcels across Nashville, Hermitage, Madison, Antioch, and Brentwood, all appealed by the same representative, Caitlyn Smagh. No supporting documentation or audio conference is noted for any appeal.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
Tue Aug 6, 2024

Metropolitan Council

Council committee to consider resolutions, appointments, rule changes

The Rules, Confirmations, and Public Elections Committee will consider several resolutions, including condemning the attempted assassination of former President Trump and a Nazi hate group's verbal assault on children, plus multiple honorary recognitions. The committee will also review mayoral appointments to various boards and consider proposed changes to council rules regarding filing deadlines and public comment procedures.

resolutionsappointmentsrulespublic-commenthonorary
Mon Aug 5, 2024

Metropolitan Council

Council to consider 320-unit apartment plan at 4214 Central Pike

The Planning and Zoning Committee will review a public hearing on purchasing properties for a new Antioch elementary school, several affordable housing grant amendments, and multiple utility easement and sewer changes. The most consequential item is a third-reading ordinance to amend a Specific Plan at 4214 Central Pike to allow 320 multi-family residential units, with a companion bill restricting building materials.

zoninghousingschoolsutilitiesaffordable-housingpublic-hearing
Mon Aug 5, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization holds formal appeal hearings on 30 commercial property assessments. The board, an independent body appointed by the mayor and confirmed by the council, will decide on each appeal. Decisions may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationnashville
Mon Aug 5, 2024

Metropolitan Council

Council to approve Antioch elementary school land purchase options

The Budget and Finance Committee is reviewing a mix of consent items, resolutions, and ordinances, including a public hearing on purchasing land for a new elementary school in Antioch. Most items are routine approvals of grants, contracts, and legal settlements, with several affordable housing contract amendments and infrastructure grant applications also on the agenda.

budgetfinanceschoolsgrantssettlementsaffordable-housinginfrastructure
Mon Aug 5, 2024

Metropolitan Council

Committee to hear Metro Water landfill presentation, vote on grants

The Transportation and Infrastructure Committee will hear presentations on Metro Water Services' illegal landfill operations and a TDOT toll lane project. The committee will vote on several resolutions, including accepting a $100,000 donation for a pocket park and approving grant applications for fleet electrification, pedestrian safety, and bikeway projects.

transportationinfrastructuregrantspedestrian-safetywater-servicesdonationssewer
Mon Aug 5, 2024

Historical Commission

Marker Committee to review three proposed historical markers

The Marker Committee will meet to select language for three proposed historical markers: Pearl Creswell/Creswell House, Kossie Gardner Sr., and Burton-Compton House. No public comment will be taken at this meeting; the full Metro Historical Commission will consider adoption on August 19, 2024.

historical-markershistorical-commissionpublic-artnashville
Mon Aug 5, 2024

Human Relations Commission

Human Relations Commission to discuss anti-hate campaign and officer nominations

The Metro Human Relations Commission is holding its regular monthly meeting. The agenda includes routine items such as approving minutes and a financial update, as well as new business like executive officer nominations, a Bylaws and Rules committee chair appointment, an update on the Procurement Standards board, and an anti-hate campaign. Public comments are also scheduled.

human-relationscommissionanti-hateprocurementbylawscommunity-engagement
Mon Aug 5, 2024

Auditorium Commission

Auditorium Commission meets for regular business

The Metropolitan Auditorium Commission is holding a regular meeting. The agenda includes only procedural items such as public comment and standard administrative matters. No specific decisions or discussions are listed.

auditoriumcommissionmeetingnashville
Mon Aug 5, 2024

Equalization Board

Board hears 30 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings on August 5, 2024, for 30 commercial properties across Nashville and Davidson County. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals from property owner Caitlyn Smagh. Decisions may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationpublic-hearing
Mon Aug 5, 2024

Community Review Board

Public forum on MNPD zero-tolerance sexual misconduct policy

The Nashville Community Review Board is holding a public forum to present and gather feedback on a proposed zero-tolerance sexual misconduct policy for the Metropolitan Nashville Police Department. The meeting includes a policy presentation, Q&A, breakout groups, and public comment.

policesexual-misconductpolicypublic-forumcommunity-review-board
Thu Aug 1, 2024

Election Commission

Election Commission to call transit referendum for Nov. 5

The Davidson County Election Commission will select optical scanners for audit from five precincts and one early voting location, schedule the audit for August 9, and call a Transit Improvement Program Referendum Election for November 5, 2024. Public comments are limited to 10 speakers for two minutes each.

election-commissionelectionsaudittransit-referendumpublic-comment
✓ Decided: Election Commission calls transit referendum for Nov. 5 ballot

The Davidson County Election Commission unanimously voted to place the Transit Improvement Program referendum on the November 5, 2024 ballot, after receiving legal opinions confirming the ordinance met statutory requirements. The commission also selected six optical scanners for a post-election audit and scheduled the audit for August 9, 2024.

Thu Aug 1, 2024

Stormwater Management Commission

Stormwater Commission to hear three variance cases including Parkwood Baseball

The Stormwater Management Commission will consider three cases: a final review for Parkwood Baseball at 3017 Aldrich Lane involving stream buffer disturbances and impervious surfaces; a request at 3702 B Estes Road for floodway buffer disturbances to build a home and pool; and a preliminary appeal and variance for Nashville Gun Club at 1100 County Hospital Road regarding floodway construction. The meeting also includes approval of prior minutes and decision letters.

stormwaterfloodwaybuffervariancepublic-hearingnashville
Thu Aug 1, 2024

Continuum of Care Homelessness Planning Council

Youth Advisory Board to discuss needs assessment and YHDP plan

The Youth Advisory Board of the Continuum of Care Homelessness Planning Council is meeting to discuss a needs assessment and provide input on the YHDP Consolidated Community Plan. The agenda includes a white board activity and next steps. This is a working meeting focused on youth homelessness planning.

homelessnessyouthplanningneeds-assessmentyhdp
Thu Aug 1, 2024

Equalization Board

Property tax appeal hearings for 11 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for 11 commercial parcels. The board will also take public comment, review minutes, and discuss old and new business.

property-taxappealsequalization-boardcommercial-propertynashville
✓ Decided: Board approves 13 property tax appeals lowering assessed values

The Metropolitan Board of Equalization unanimously approved all 13 property tax appeals heard on August 1, 2024, reducing the total assessed values for each property based on a sale ratio of 0.7143. The board also approved the minutes from the July 30 and July 31 meetings. No other substantive decisions were made.

🏢 Building at this address: 9 m tall
Thu Aug 1, 2024

Zoning Appeals Board

Board to hear 6 zoning appeals including batting cage, church addition, and housing projects

The Board of Zoning Appeals will consider six cases, including a deferred request for an indoor batting facility on Highway 70, variances for a single-family home on Porter Road, a special exception for a church addition on Foster Avenue, a new golf range with food service on Old Hickory Boulevard, a multi-use development on 8th Avenue South, and a front setback variance for a home on Clifton Avenue.

zoningvariancesspecial-exceptionshousingcommercialreligious-institutionrecreation
Thu Aug 1, 2024

Behavioral Health and Wellness Advisory Council

Council to review Mayor O’Connell’s new executive order

The Behavioral Health and Wellness Advisory Council will discuss Mayor O’Connell’s new executive order and approve minutes from the June meeting. The meeting is procedural with one substantive item.

behavioral-healthexecutive-ordermayor-oconnellcouncil-minutes
Wed Jul 31, 2024

Equalization Board

Board hears property tax appeals for 8 parcels and 2 personalty accounts

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for eight commercial and residential parcels and two personal property accounts. The board is an independent body that hears taxpayer challenges to the Assessor's valuations; its decisions can be appealed to the State Board of Equalization.

property-taxappealsboard-of-equalizationcommercial-propertyresidential-propertypersonal-property
✓ Decided: Board approves Google Fiber property value, adjusts Skylight Land assessment

The Metropolitan Board of Equalization approved the minutes from July 29, 2024, and heard four appeals. It unanimously approved no change to Google Fiber's personal property value of $152,734,398, and unanimously approved reducing Skylight Land's total value to $8,500,170. Three other appeals were withdrawn at the appellant's request.

Wed Jul 31, 2024

Continuum of Care Homelessness Planning Council

CoC council discusses sustainability assessment and strategic planning

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board will meet to discuss a sustainability assessment and strategic planning for the board. The agenda includes welcome remarks, a discussion on the sustainability assessment, and next steps.

homelessnessplanningsustainabilitystrategic-planning
Wed Jul 31, 2024

Nashville Entertainment Commission

Ad Hoc Committee to review Executive Director job description

The Nashville Entertainment Commission's Ad Hoc Job Description Committee will meet to review and discuss the Executive Director job description, which is an action item. The meeting includes public comment and approval of prior minutes.

entertainment-commissionjob-descriptionexecutive-directorpublic-commentmeeting-minutes
Wed Jul 31, 2024

Human Relations Commission

Nominating committee to discuss executive committee slate

The Metro Human Relations Commission's Nominating Committee will meet to discuss nominations for the Executive Committee and establish a slate. The meeting includes public comments and old business, but the primary action is selecting leadership candidates.

human-relationsnominating-committeeexecutive-committeeleadership
Tue Jul 30, 2024

CATV Special Committee

CATV committee to vote on Comcast franchise reports and extension

The CATV Special Committee will vote on approving audit, needs analysis, and compliance reports for the Comcast franchise agreement, and on recommending a one-year extension of the agreement to Metro Council. The committee will also vote on PEG capital fund allocation requests and elect officers.

cable-tvcomcastfranchise-agreementpeg-fundspublic-commentcommittee
✓ Decided: Committee approves $206,629 in PEG capital fund purchases

The CATV Special Committee approved a $206,629 allocation from the PEG Capital Fund for new cameras, studio equipment, emergency maintenance, and head-end relocation. The committee also elected Jackie Shrago as Chair and Tim Garrett as Vice Chair, and approved the August 17, 2023 minutes. An audit revealed Comcast owes Metro $1.493M in fees plus interest, and Comcast notified Metro it will seek a state franchise instead of a local one.

Tue Jul 30, 2024

Equalization Board

Board hears 30 property tax appeals from Nashville property owners

The Metropolitan Board of Equalization will hold formal appeal hearings on July 30, 2024, for 30 residential and commercial properties. Property owners are appealing their assessed values. The board's decisions can be appealed to the State Board of Equalization.

property-taxtax-appealsboard-of-equalizationpublic-hearing
✓ Decided: Board hears 30 property tax appeals, adjusts values on 20 parcels

The Metropolitan Board of Equalization heard 30 property tax appeals on July 30, 2024, in morning and afternoon sessions. The board approved value changes on 20 parcels, often applying a sale ratio of 0.7143, and denied changes on 10 parcels, keeping their assessed values unchanged. All decisions were unanimous.

Tue Jul 30, 2024

Equalization Board

Board hears property tax assessment appeals for 40+ Nashville parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on July 30, 2024, for property owners contesting their property tax assessments. The agenda lists dozens of residential and commercial parcels across Nashville, with hearings at 8:30 AM and 1:00 PM. The board will also handle routine items like call to order, roll call, and minutes approval.

property-taxappealsequalization-boardpublic-hearingnashville
✓ Decided: Board hears 30 property tax appeals, adjusts values on 19 parcels

The Metropolitan Board of Equalization heard 30 property tax appeals on July 30, 2024, with most represented by Property Tax Consultants. The board approved value changes on 19 parcels, often applying a sale ratio of 0.7143, and denied changes on 11 parcels, keeping their assessed values. All decisions were unanimous.

Tue Jul 30, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission executive committee meets; agenda is procedural only

The Nashville Music, Film, and Entertainment Commission Executive Committee is holding a regular meeting with a standard agenda: call to order, public comment, contacts and disclosures, old business, new business, and adjournment. No specific decisions, proposals, or discussion items are listed on the agenda, so the meeting appears to be procedural in nature.

entertainmentcommissionmeetingpublic-commentnashville
✓ Decided: Executive Committee adopts July 10 minutes, discusses council appointments

The Nashville Music, Film, and Entertainment Commission Executive Committee met on July 30, 2024, and unanimously approved the minutes from the July 10 meeting. The committee discussed scheduling future meetings, the selection of council members, and potential by-law changes, but took no formal action on these items.

Tue Jul 30, 2024

Work Release Commission

Work Release Board approves 2 inmates, continues 2 others

The Work Release Commission reviewed applications for work release candidates. Two inmates were approved, two were continued for further review. The board discussed current charges, past history, institutional behavior, and treatment programs.

work-releaseinmatescorrectionsnashville
Mon Jul 29, 2024

Equalization Board

Board hears 19 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings on 19 commercial properties, including parcels on West End Ave, 21st Ave S, and Bell Rd. The board, which is independent from the Office of Assessments, will hear appeals from property owner Jay Catignani in two sessions (8:30 AM and 1:00 PM). A public comment period is scheduled at the start of the meeting for up to 10 speakers on germane agenda items.

property-taxtax-appealsboard-of-equalizationcommercial-propertypublic-hearing
Mon Jul 29, 2024

Metro Action

Executive Committee to evaluate Executive Director

The Executive Committee of the Metropolitan Action Commission Board of Commissioners is meeting to conduct an evaluation of the Executive Director. The agenda includes only a call to order, the evaluation item, and adjournment, with no other business listed.

evaluationexecutive-committeemetro-action-commission
Mon Jul 29, 2024

Equalization Board

Board hears 16 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 16 commercial properties. The board, which is independent from the Office of Assessments, will hear appeals from property owners and may be appealed to the State Board of Equalization.

property-taxtax-appealscommercial-propertyboard-of-equalizationpublic-hearing
Thu Jul 25, 2024

Planning Commission

Planning Commission to consider 40+ items including rezonings, plan amendments, and subdivisions

The Nashville Planning Commission will hold a regular meeting on July 25, 2024, to consider a lengthy agenda of zoning changes, community plan amendments, specific plan modifications, and subdivision plats. Many items are on the consent agenda or are recommended for deferral to future meetings. The Commission makes final decisions on site plans and subdivisions, while recommending actions on zone changes and plan amendments to the Metro Council.

zoningplanningrezoningcommunity-plansubdivisionspecific-planhousing
✓ Decided: Planning Commission approves Global Mall area master plan and rezoning

The Planning Commission approved the Global Mall Area Master Plan as supplemental policy for the Antioch-Priest Lake Community Plan, and approved a related Specific Plan rezoning for 57.22 acres of Metro-owned property at the former Hickory Hollow Mall to permit mixed-use development. The commission also approved several other rezoning and development requests, including a 233-unit multifamily project at The Village at Autumn View and a 171-unit multifamily project at 3124 Murfreesboro Pike. Multiple items were deferred to future meetings.

Thu Jul 25, 2024

Continuum of Care Homelessness Planning Council

Youth Advisory Board discusses roles, grant, and community plan

The Youth Advisory Board of the Continuum of Care Homelessness Planning Council is meeting to discuss roles and responsibilities, the Youth Homelessness Demonstration Grant, and the Consolidated Community Plan. They will also plan future meetings, including frequency, location, and expectations.

homelessnessyouthgrantcommunity-planmeeting
Thu Jul 25, 2024

Wastewater Hearing Authority

Wastewater Hearing Authority reviews FOG policy and enforcement guide drafts

The Wastewater Hearing Authority is meeting to review and discuss a draft FOG (Fats, Oils, and Grease) policy and a new enforcement guide for grease waste haulers. The board will also review the semi-annual report on industrial user compliance and previous meeting updates. The meeting includes an update on Calypso Café and a member renewal reminder.

wastewaterfog-policyenforcementindustrial-compliancegrease-waste
Wed Jul 24, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses from May through July

The Sexually Oriented Business Licensing Board will hold a routine meeting to approve minutes, review new and renewal entertainer permits and business licenses across four periods from May 23 to July 24, 2024, and hear an inspector's report. The agenda consists entirely of procedural items with no substantive policy decisions or public hearings listed.

sexually-oriented-businesslicensingpermitsnashville
Wed Jul 24, 2024

Equalization Board

Board hears property tax appeals for 8 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for eight commercial parcels. The board is independent of the Assessor's Office and its decisions can be appealed to the State Board of Equalization.

property-taxboard-of-equalizationappealscommercial-propertynashville
Wed Jul 24, 2024

Short Term Rental Appeals Board

STR board grants 2 appeals, denies 2, dismisses 1

The Short Term Rental Appeals Board heard five appeals from property owners seeking to re-establish legal STR operation. Two were granted with conditions to re-apply on specific dates, two were denied, and one was dismissed for lack of prosecution.

short-term-rentalsappeals-boardnashvillezoningpublic-hearing
Wed Jul 24, 2024

Beer Permit Board

Beer Board to hear 11 new permit applications, 12 deferrals, 3 violations

The Metro Beer Permit Board will consider 11 new beer permit applications, including new locations, name changes, caterers, and special events. Twelve applications are recommended for deferral due to missing documents. Three administrative hearings involve alleged underage sales at United Market, 404 Bar & Grill, and Woodbine Fresh Market, with staff recommending civil penalties or suspensions.

beer-permitsalcohol-regulationpublic-hearingsviolationsspecial-eventsnashville
✓ Decided: Beer board approves 11 new permits, defers 12 for missing documents

The Metro Beer Permit Board approved 11 applications for new, expanded, or special-event beer permits, and deferred 12 applications indefinitely due to missing documents. In administrative hearings, the board reduced a civil penalty for United Market to $2,500 (or 7-day suspension plus 30 days probation) and accepted late civil penalty payments from two other establishments. No public comments were made.

Tue Jul 23, 2024

Equalization Board

Property tax appeal hearings for 13 parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for 13 properties, including one residential and 12 commercial parcels, listed under appellant Clint Carter. The board is an independent body whose decisions can be appealed to the State Board of Equalization.

property-taxappealsboard-of-equalizationcommercial-propertyresidential-propertynashville
Tue Jul 23, 2024

Employee Benefit Board

Employee Benefit Board hears 6 in-line-of-duty medical appeals

The In Line of Duty Committee will meet to consider six appeals for medical care related to line-of-duty injuries. The appeals involve employees and pensioners from the Fire and Police Departments. No other substantive business is on the agenda.

employee-benefitsfire-departmentpolice-departmentmedical-appealspublic-comment
Tue Jul 23, 2024

Housing Trust Fund Commission

HTF Commission to vote on grant contract amendments and templates

The Metropolitan Housing Trust Fund Commission will vote on contract extensions for two Round 10 grantees (Living Development Concepts and Woodbine Community Organization) and approve standard contract templates for homeowner, rental new construction, and rehab projects. The commission will also discuss the transition update, Round 14, FY25 budget and funding cycles, a commissioner survey, and a unified housing strategy roundtable.

housingaffordable-housinggrantscontractsbudgetpublic-comment
Mon Jul 22, 2024

Equalization Board

Board hears property tax appeals for 5 parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for five parcels. The board will also take public comment, review minutes, and discuss old and new business.

property-taxappealsequalization-boardnashville
✓ Decided: Board upholds property values on three Nashville-area parcels

The Metropolitan Board of Equalization approved minutes from three prior meetings and heard three property tax appeals, all resulting in no change to assessed values. Two appeals were withdrawn at the appellant's request. The board unanimously approved no-change motions for properties on Brentwood Trace and Grizzard Ave.

Mon Jul 22, 2024

Continuum of Care Homelessness Planning Council

Committee to vote on new HMIS agency for refugee services

The Data & HMIS Oversight Committee will vote on adding the Nashville International Center for Empowerment as a new HMIS participating agency. Members will also review proposed changes to the HMIS Policies and Procedures Manual and receive updates on recently approved agencies and gaps analysis planning.

homelessnesshmisdataoversightnashville
Mon Jul 22, 2024

Community Review Board

Community Review Board to discuss misconduct policy and complaint investigation

The Community Review Board is holding its monthly meeting to discuss several items, including a sexual misconduct policy report, the status of an investigation into a 61-page complaint, and expansion of investigation status. The board will also discuss MOU negotiations. Public comment is available.

community-review-boardpolice-oversightinvestigationpolicypublic-comment
✓ Decided: CRB delays legal action on MNPD body camera videos until Aug. 6

The Community Review Board unanimously approved the June 24 meeting minutes and the Executive Director's report. The board agreed by consensus to postpone any legal action against MNPD regarding overdue body-worn camera videos until after an Aug. 6 meeting with Metro Legal. No public comment was made, and no other formal votes were taken.

Fri Jul 19, 2024

Continuum of Care Homelessness Planning Council

CoC Executive Committee to discuss HUD TA, funding, and August agenda

The Executive Committee of the Continuum of Care Homelessness Planning Council will meet to review minutes, discuss HUD Technical Assistance with The Cloudburst Group, and prepare for the August Homeless Planning Council meeting. They will also receive updates on the FY2024 CoC funding application, Youth Homelessness Demonstration Project, and encampment closures. The meeting is largely administrative and planning-focused.

homelessnesscochudfundingyouthencampments
Fri Jul 19, 2024

Human Relations Commission

Human Relations Commission executive committee meets for nominations, campaign update

The Metro Human Relations Commission Executive Committee is meeting to discuss old business including new commissioner orientation scheduled for August 20, and new business including executive committee nominations and the 'No Hate on My Plate' campaign. The meeting is procedural with no votes or binding decisions listed.

human-relationscommissionexecutive-committeeorientationcampaign
Thu Jul 18, 2024

Zoning Appeals Board

Zoning board to decide on church, batting cage, day care, and housing projects

The Metropolitan Board of Zoning Appeals will hear 13 cases, including four deferred from June 20, 2024. Items include a church sanctuary, indoor batting facility, adult day care, fence height variance, triplex, accessory structure, home addition, single-family residence, screened porch, secondary residence, multi-family housing, new residence, and a second-story addition. The board will vote on special exceptions, variances, and appeals.

zoningvariancesspecial-exceptionsreligious-institutionhousingcommercialpublic-hearing
Thu Jul 18, 2024

Continuum of Care Homelessness Planning Council

CoC to elect facilitator, review FY2024 funding applications

The Continuum of Care general membership will vote on a meeting facilitator and receive updates on FY2024 Continuum of Care funding applications and the Youth Homelessness Demonstration Project NOFO. Committee and agency updates are also scheduled. The meeting includes a reading of the equity statement and HUD technical assistance.

homelessnesscontinuum-of-carefundingyouth-homelessnesshudnashville
Thu Jul 18, 2024

Equalization Board

Property owner Cody Anderson appeals commercial property assessments for 7 parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for property owner Cody Anderson regarding commercial property assessments on 7 parcels in Goodlettsville, Antioch, and Lavergne. The board will also take public comment, review minutes, and handle any old or new business.

equalization-boardproperty-assessmentcommercial-propertyappealsnashville
✓ Decided: Board approves property value appeals, some reduced via sale ratio

The Metropolitan Board of Equalization heard 21 property assessment appeals over two days, all presented by Cody Anderson of Ernst & Young. The board unanimously approved every motion, either confirming the assessed total value or reducing it based on a sale ratio of 0.7143. All decisions were made without dissent.

Thu Jul 18, 2024

Health Board

Health Board hears update on 128 suspected drug overdose deaths in Q2 2024

The Board of Health received the Director's Update for July 2024, which includes a quarterly drug overdose surveillance report showing 128 suspected fatal overdoses in Q2 2024 (272 YTD), with fentanyl detected in 70% of cases. The update also covers expanded Nashville Strong Babies services countywide, back-to-school vaccination clinics, and the upcoming end of the CDC's Bridge to Access Program for COVID-19 vaccines.

public-healthoverdosefentanylvaccinesmaternal-healthback-to-schoolparental-consentcovid-19
Thu Jul 18, 2024

Sports Authority Board

Sports Authority to review Titans stadium progress and elect FY25 officers

The Sports Authority Board of Directors will hold a public meeting to review the Titans' new enclosed Nissan Stadium monthly progress report, receive updates on the stadium project and the NVWT marker, and elect officers for fiscal year 2025. The board will also consider approving the June 20, 2024 meeting minutes and hear reports from the executive director and Bridgestone Arena host facility.

sports-authoritystadiumtitansnissan-stadiumbridgestone-arenaelections
✓ Decided: Sports Authority re-elects Bender, Duncan, McGee as FY25 officers

The Sports Authority Board held its annual meeting, unanimously approving the June 20, 2024 minutes and re-electing Cathy Bender as Chair, Jad Duncan as Vice Chair, and Aaron McGee as Secretary/Treasurer for FY 2025. The board received updates on the new Nissan Stadium construction, including a $131.8 million total spend, and on Bridgestone Arena operations, which hosted a record 180 events. No other formal decisions were made; the meeting was primarily informational.

Thu Jul 18, 2024

Sports Authority Board

Sports Authority Board holds public ethics training only

The Sports Authority Board of Directors is meeting solely for an ethics training session open to the public. No substantive decisions or discussions are on the agenda; the meeting consists of call to order, training, and adjournment.

ethics-trainingsports-authorityboard-meeting
Thu Jul 18, 2024

Transportation Licensing Commission

TLC proposes rule change for filing complaints

The Transportation Licensing Commission is considering a proposed amendment to Section 103 of its rules, which governs how complaints about taxicabs, wreckers, and other regulated functions are filed. The amendment would update the methods for filing complaints, including via HUB Nashville, letter, fax, or email, and clarify the 14-day and 30-day deadlines. The Commission will discuss and potentially vote on this rule change at its July 18 meeting.

transportationlicensingcomplaintsrules
✓ Decided: TLC defers Old Town Trolley complaint, reverts taxi fees to $75

The Transportation Licensing Commission deferred a disciplinary hearing against Old Town Trolley to August 15, 2024, to allow review of evidence, and dismissed a second complaint when the complainant did not appear. The Commission also reverted taxicab fees to pre-pandemic levels of $75 per vehicle and $45 quarterly, approved new OPVH applications, and denied two driver applications for incomplete disclosure.

Thu Jul 18, 2024

Arts Commission

Arts Commission to review FY25 budget and internal audit

The Metro Arts Commission will discuss and potentially act on the FY25 budget, an internal audit, and a conciliated agreement with the Metro Human Relations Commission. Committee updates on public art, grants, anti-racism, and equity are also on the agenda.

artsbudgetauditpublic-artgrantsequity
✓ Decided: Arts Commission approves conciliated MHRC settlement agreement

The Metro Arts Commission approved a conciliated agreement with MHRC, Metro Legal, and external complainants, resolving a Title VI complaint. The commission also discussed an internal audit report highlighting deficiencies in financial controls and documentation, and committed to working with staff to implement recommendations. No other formal votes were recorded.

Wed Jul 17, 2024

Historic Zoning Commission

Historic Zoning Commission to consider new construction, additions, and a new historic overlay designation

The Metro Historic Zoning Commission will vote on consent items, hear public testimony on 17 applications for new construction, additions, and partial demolitions in historic overlays, and consider a new historic preservation zoning overlay for Elliston Place Rock Block. The meeting also includes adoption of prior minutes and commissioner training.

historic-preservationzoningnew-constructionadditionsdemolitiondesignationpublic-hearing
✓ Decided: Commission recommends Rock Block historic overlay, approves multiple construction projects

The Metro Historic Zoning Commission recommended approval of the Elliston Place Rock Block Historic Preservation Zoning Overlay and adopted draft design guidelines. The commission also approved several construction projects, including infill at 1320 Rosa L Parks Blvd and an addition at 1505 Cedar Ln, each with conditions. A deferral was accepted for 201-205 Broadway, and the roof reconstruction at 1402 Ordway Pl was approved with conditions.

Wed Jul 17, 2024

Continuum of Care Homelessness Planning Council

CoC committee to set scoring rubric for FY2024 homeless funding applications

The Performance Evaluation Committee will determine the scoring rubric for FY2024 Continuum of Care grant applications, review a corrective action plan for Urban Housing Solutions, and discuss reallocation policy and system performance measures. The meeting includes updates on the Youth Homelessness Demonstration Project and collaborative applicant transfer progress.

homelessnessgrantsperformance-measureshousingyouthcorrective-action
Wed Jul 17, 2024

Continuum of Care Homelessness Planning Council

Homelessness council to review sustainability assessment with HUD TA

The Consumer Advisory Board of the Continuum of Care Homelessness Planning Council is meeting to discuss the results of a sustainability assessment and next steps, with participation from HUD Technical Assistance. The agenda includes a welcome, overview, introductions, and a discussion with HUD TA. This is a working meeting focused on planning and assessment, not on final decisions.

homelessnessplanningsustainabilityhudconsumer-advisory-board
Wed Jul 17, 2024

Equalization Board

Board hears property tax appeals for 14 commercial parcels

The Metropolitan Board of Equalization will hold formal appeal hearings for 14 commercial properties, including parcels on Gallatin Pike, Rosa L Parks Blvd, and Charlotte Pike. The board will also take public comment, review minutes, and address old and new business.

property-taxappealscommercial-propertyboard-of-equalizationnashville
✓ Decided: Board hears 21 property tax appeals, approves all motions unanimously

The Metropolitan Board of Equalization heard 21 property assessment appeals over two days, all presented by Cody Anderson of Ernst & Young on behalf of various property owners. The board unanimously approved every motion, either confirming the assessed value or adjusting it using a sale ratio of 0.7143. No appeals were denied or tabled.

Wed Jul 17, 2024

Community Review Board

Community Review Board executive committee to discuss vacancy, misconduct report

The Community Review Board's executive committee is meeting to discuss several internal matters, including a board seat vacancy, community engagement, an outside counsel/conflict check, an update on an independent investigation, a sexual misconduct report, and an NCRB employment update. The meeting includes a public comment period.

community-review-boardexecutive-committeeinvestigationsexual-misconductpublic-comment
Wed Jul 17, 2024

Nashville Education, Community and Arts Television Board

NECAT board to vote on FY2025 budget and elect officers

The Nashville Education, Community and Arts Television (NECAT) Board is meeting to vote on the FY 2024-2025 budget and approve minutes. They will also elect officers for 2023-2024 and discuss fundraising, video scheduling, and a memorandum of understanding with the Nashville Public Library.

budgetelectionsfundraisingpublic-librarytelevision
Tue Jul 16, 2024

Metropolitan Council

Committee to vote on algae/mold code change and Comcast telecom contract

The Government Operations and Regulations Committee will consider two bills on second reading: a code amendment regarding algae, moss, mold, mildew, lichen, and fungus, and a contract amendment with Comcast for telecommunications services. Public comment is allowed on these items.

code-amendmentcontractstelecommunicationspublic-comment
Tue Jul 16, 2024 · 6:30 PM

Metropolitan Council

Council to vote on $1.97M homeless services grant and multiple board appointments

The Metropolitan Council will hold elections for three Nashville Music, Film, and Entertainment Commission seats and consider appointments to six boards. It will also vote on a $1.97M grant to The Salvation Army for homeless services, multiple grants for sheriff’s office programs, and housing grants totaling over $7.76M.

affordable-housinghomeless-servicesboard-appointmentsgrantsentertainment-commission
Metropolitan Courthouse
Tue Jul 16, 2024

Employee Benefit Board

Board to discuss adding dependents to pensions and GLP-1 coverage

The Metropolitan Employee Benefit Board will hold a study session to discuss two items: allowing pensioners to add dependents outside of a qualifying change in status, and coverage of GLP-1 drugs for weight loss. No votes are scheduled; this is a discussion-only meeting.

benefitspensionshealth-insuranceglp-1employee-benefits
Tue Jul 16, 2024

Public Library Board

Library Board to discuss NPLF retail space and branch updates

The Nashville Public Library Board of Trustees is meeting to approve minutes, hear reports from the interim director and staff, and discuss new business including NPLF retail space. The agenda includes public comments and standard procedural items.

librarypublic-commentretail-spacebranch-updates
✓ Decided: Library board hears of $631,400 budget cut, new Donelson branch success

The Nashville Public Library Board heard that the library's budget was reduced by $631,400 through a Budget True-Up, though no final decisions on how to absorb the cut have been made. The board also received updates on the successful opening of the new Donelson branch, which raised $46,000 in unrestricted funds, and on new website translation services in six languages. The board approved the June 18 meeting minutes unanimously and discussed a potential lease with Oscar's Tacos for the old Jim Cooper Congressman space.

Tue Jul 16, 2024

Employee Benefit Board

Board to consider hearing aid benefit in medical plans

The Metropolitan Employee Benefit Board will hold a special called meeting to consider adding a hearing aid benefit to medical plans. The agenda includes a public comment period and a single substantive item for discussion and possible action.

employee-benefitshealth-insurancehearing-aidspublic-comment
Tue Jul 16, 2024

Arts Commission

Arts Commission committee to review FY24 closeout and FY25 budget

The Budget and Administrative Oversight Committee of the Nashville Arts Commission is meeting to discuss the FY24 budget closeout, the FY25 budget, and an audit. The meeting includes public comment and approval of prior meeting minutes.

arts-commissionbudgetauditpublic-commentnashville
✓ Decided: Arts Commission committee reviews FY25 budget, audit, grants

The Budget & Administrative Oversight Committee met and approved prior meeting minutes. They discussed the unfinished FY24 budget closeout, reviewed the FY25 budget, and addressed grant management issues with Metro and the state. The committee also reviewed audit findings and planned corrective actions, and discussed a proposed disparity study and MHRC conciliation agreement.

Tue Jul 16, 2024

Mechanical, Plumbing, and Electrical Examiners and Appeals Board

Board to hear appeal on drinking fountain requirement at River Road Pike facility

The Mechanical, Plumbing, and Electrical Examiners and Appeals Board will hold a public meeting to consider one appeal case, approve previous meeting minutes, and handle routine registration, examination, and property owner permit approvals. The agenda is mostly procedural with one substantive item.

appealsplumbingmechanicalelectricalpermitsnashville
Tue Jul 16, 2024

Equalization Board

Board hears property tax appeals for 16 commercial and residential parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for 16 parcels, including commercial properties on Rep John Lewis Way, President Ronald Reagan Way, and residential properties on Highway 100, 6th Ave N, and Trimble Rd. The board will also take public comment, review minutes, and discuss old and new business.

property-taxappealsequalization-boardnashvillecommercial-propertyresidential-property
✓ Decided: Board approves property value reductions for 12 Nashville parcels

The Metropolitan Board of Equalization approved property value reductions for 12 parcels owned by 614 John Lewis Way LLC, Rutledge Hill LLC, and W. E. Stephens Jr. Trustees, all based on a sale ratio of 0.7143. One appeal was withdrawn at the appellant's request. The board also approved the minutes from the July 15, 2024 meeting.

Tue Jul 16, 2024

Metropolitan Council

Council committee to consider grants and greenway easements for parks

The Arts, Parks, Libraries, & Entertainment Committee is meeting to discuss and vote on several items: accepting two in-kind grants for park improvements and arts programs, and approving two greenway conservation easements for trail improvements. These are routine actions that would allow the parks board to receive donations and formalize land agreements.

parksgrantsgreenwayeasementarts
Tue Jul 16, 2024

Farmers Market Board

Farmers Market Board to hear internal audit, consider director merit raise

The board will receive a Metro internal audit of the Nashville Farmers' Market and vote on a merit increase for the executive director. It will also approve minutes from May and June 2024 and hear staff reports on marketing, programs, facilities, and finance.

farmers-marketauditpersonnelpublic-commentsboard-meeting
✓ Decided: Board approves 6% merit increase for Executive Director Darrell Lane

The Farmers' Market Board approved a 6% merit increase for Executive Director Darrell Lane, retroactive to July 1, 2024, after initially considering 5%. The board also approved the May and June meeting minutes and discussed the Metro Internal Audit, sponsorship program, and various operational updates.

Tue Jul 16, 2024

Nashville Health and Well-being Leadership Council

Council to adopt bylaws and develop vision for health equity

The Nashville Health & Well-being Leadership Council will meet to approve June meeting minutes, discuss and adopt bylaws, and begin vision development. The meeting is largely procedural with no specific policy decisions or financial items on the agenda.

healthbylawsvisionmeeting
✓ Decided: Council approves agenda, minutes; drafts vision statement

The Nashville Health & Well-being Leadership Council approved the stated agenda and the June 11 meeting minutes. Members discussed and accepted edits to the draft by-laws, except for the Community Voice section and website address, with a final review planned for August. The council began developing a new vision statement, with the chair and vice chair to draft options for the August meeting. No other substantive decisions were made.

Tue Jul 16, 2024

Metropolitan Council

Public Health & Safety Committee considers 8 resolutions and violence prevention presentation

The Public Health and Safety Committee is meeting to discuss and vote on eight resolutions, including grants for the Sheriff's Office, interlocal agreements for workforce development and E-911 services, and a contract amendment. The committee will also hear a violence prevention presentation from Vanderbilt Professor Dr. Maury Nation. Public comment is allowed on legislative items.

public-healthsafetygrantssheriffworkforce-developmente911violence-preventioncontracts
Tue Jul 16, 2024

Metropolitan Council

Council committee to vote on Arts Commission membership changes and board appointments

The Rules, Confirmations, and Public Elections Committee will vote on two bills amending the Arts Commission and Music, Film, & Entertainment Commission membership rules, plus several board appointments and a proposed rule change. The agenda also includes resolutions honoring individuals and recognizing months, and elections for the Music, Film, and Entertainment Commission.

arts-commissionmusic-film-entertainment-commissionboard-appointmentsrules-of-procedureresolutionspublic-elections
Mon Jul 15, 2024

Historical Commission

Historical Commission to vote on marker for Primo Bartolini, hear transportation plan

The Metropolitan Historical Commission will vote on a historical marker for Primo Bartolini, an Italian-American scholar and poet, and hear a presentation on Mayor O'Connell's Choose How You Move transportation plan. The board will also vote on a 3% merit salary increase for the Executive Director, effective July 1, 2024.

historical-markerstransportationexecutive-directorsalaryzoningpublic-hearing
✓ Decided: Historical Commission approves 3% merit raise for Executive Director Tim Walker

The Metropolitan Historical Commission unanimously approved a 3% merit salary increase for Executive Director Tim Walker, retroactive to July 1, 2024. They also approved a historical marker for Primo Bartolini and the June 2024 meeting minutes. The commission heard public comment on renaming Cumberland Park to Wasioto Park and a presentation on Nashville's transportation plan, but took no action on these items.

Mon Jul 15, 2024

Equalization Board

Board hears 20 commercial property tax appeals

The Metropolitan Board of Equalization will hold formal appeal hearings for 20 commercial properties, all listed under the same assessor, Debbie Smith. The board will review and decide on these property tax appeals, with a public comment period at the start. No supporting documentation or audio conference is noted for these hearings.

property-taxappealscommercial-propertyequalization-boardpublic-hearing
Mon Jul 15, 2024

Metropolitan Council

Council considers legislation to create the East Bank Development Authority

The Metropolitan Council is reviewing a Private Act to establish the East Bank Development Authority. This new entity would manage development agreements, leases, and infrastructure installation for the East Bank area.

developmentgovernment-structureinfrastructureeast-bankzoning
Mon Jul 15, 2024

Continuum of Care Homelessness Planning Council

Council to discuss CAB processes and bylaws concerns

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is holding a special planning meeting to discuss concerns about CAB processes and bylaws, explore potential solutions, and plan for the June 17th meeting. The agenda includes a values and equity statement focused on antiracism. No votes or decisions are listed; the meeting is primarily a discussion session.

homelessnessplanningconsumer-advisory-boardbylawsequitynashville
Mon Jul 15, 2024

Bicycle and Pedestrian Advisory Commission

Vision Zero plan and Dickerson Pike safety upgrades discussed

The Bicycle and Pedestrian Advisory Commission will hear a presentation on the Vision Zero Action and Implementation Plan and receive an informational update on the Dickerson Pike Pedestrian Improvements MMAG Grant. The committee will also vote on proposed amendments to its bylaws, procedures, and meeting schedule.

bicyclepedestrianvision-zerosafetygrants
Mon Jul 15, 2024

Arts Commission

Arts Commission executive committee to discuss director search and bylaws changes

The Metro Arts Executive Committee is meeting to discuss the timeline for an interim director, the search for a permanent director, potential bylaws changes, and board interactions. The meeting includes a public comment period and approval of minutes from February 7, 2024.

artscommissionexecutive-committeedirector-searchbylaws
Mon Jul 15, 2024

Metropolitan Council

Council to consider $7M affordable housing grant and $545K settlement

The Budget and Finance Committee is reviewing a consent agenda of resolutions and bills, including grants for affordable housing, settlements, and various contracts. Notable items include a $7 million Barnes Fund grant for affordable housing, a $545,806.66 settlement for a fire department claim, and approval of an East Bank Development Authority. The committee will also consider amendments to the Arts Commission membership and several greenway easements.

budgetfinanceaffordable-housinggrantssettlementsdevelopment-authoritygreenwayschools
Mon Jul 15, 2024

Metropolitan Council

Council to vote on $7M affordable housing grant and 20+ zoning changes

The Planning and Zoning Committee will review resolutions authorizing over $7.7 million in affordable housing grants, including $7 million to William Franklin Buchanan Community Development Corporation, and will consider numerous zoning ordinance amendments on second and third reading, covering rezoning, specific plan districts, and building material restrictions.

zoningaffordable-housinggrantsrezoningpublic-hearing
Mon Jul 15, 2024

Metropolitan Council

Committee to vote on food truck permitting program and TDOT intersection funding

The Transportation and Infrastructure Committee will consider resolutions approving TDOT funding for intersection improvements and requesting prioritization of the Nolensville Pike All-Access Corridor. Bills on second reading include a new permitting program for food trucks in public rights-of-way, grading permit amendments, greenway conservation easements, and sewer easement abandonments. The committee will also discuss departmental updates.

transportationinfrastructurefood-trucksgreenwaysewerintersectionstransit
Fri Jul 12, 2024

Charter Revision Commission

Charter Revision Commission to deliberate proposed amendments from Resolution RS2024-559

The Charter Revision Commission will hold a public hearing and deliberate proposed charter amendments included in Council Resolution RS2024-559. The meeting includes a public comment period and approval of prior minutes.

charter-revisionpublic-hearingnashvillecouncil-resolution
Fri Jul 12, 2024

Arts Commission

Arts Commission anti-racism committee to confirm co-chair, define equity terms, and set FY25 goals.

The Arts Commission's Equity and Antiracism Committee will meet to confirm a co-chair appointment, discuss definitions of equity and antiracism, and prioritize goals for fiscal year 2025. The meeting includes public comment and approval of previous minutes.

artsequityanti-racismcommitteegoalspublic-comment
Thu Jul 11, 2024

Employee Benefit Board

Employee Benefit Board to consider Medicare Advantage rates and life insurance RFP

The Metropolitan Employee Benefit Board will meet July 11 to approve minutes, hear a disability appeal, and discuss several benefit items including 2025 Medicare Advantage plan rates, a life insurance request for proposals, and a hearing aid benefit in medical plans.

employee-benefitsmedicareinsurancepensionsdisabilitypublic-meeting
Thu Jul 11, 2024

Downtown Code Design Review Committee

Downtown Code Design Review for 955 Church St. creative office

The Downtown Code Design Review Committee is reviewing a proposal for a creative office project at 955 Church Street. The agenda includes floor plans for a social hub and terrace with seating counts and square footage details.

design-reviewdowntown-codeofficedevelopment
✓ Decided: Nashville Yards open space concept plan approved with conditions

The Downtown Code Design Review Committee approved the consent agenda and a new case for the Nashville Yards Open Space concept plan, all with unanimous 6-0 votes. The open space plan for 1.31 acres was approved with staff conditions. No public comments were made.

Thu Jul 11, 2024

Convention Center Authority

Convention Center Authority to elect officers, renew service contracts

The Convention Center Authority will elect FY 2024-2025 officers and consider renewing contracts for carpet cleaning, valet parking, and power clean/stone sealing services. An RFP for website and software services will also be discussed. The meeting includes a public comment period with limited slots.

convention-centercontractselectionsoperationspublic-comment
Thu Jul 11, 2024

Beer Permit Board

Metro Beer Permit Board reviews permit applications and potential civil penalties

The Board will review several new and expansion beer permit applications for various local businesses. Additionally, the meeting includes discussion of multiple complaints regarding alleged violations and recommended civil penalties.

beer permitslicensinglaw enforcementpublic safetygovernment administration
✓ Decided: Beer Board approves 11 permits, defers 7, issues fines

The Metro Beer Permit Board approved 11 beer permit applications, deferred 7 applications indefinitely due to missing documents, and withdrew 1 application. The board also issued civil penalties for 10 complaints, deferred 2 complaints for further investigation, and approved a 3% raise for Director McDonough.

Thu Jul 11, 2024

Arts Commission

Arts Commission to vote on temporary art proposals for two parks

The Public Art Committee will vote on two temporary art proposals for Metro property: one from the Nashville Tree Foundation for Frederick Douglass Park and one from NASA/MNPS for Napier Recreation Center. The committee will also discuss updates on the Temporary Art on Metro Property process, the Lending Library, and upcoming events including a reception and a mural dedication.

artspublic-artparkscommunity-engagementlending-librarymurals
Thu Jul 11, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals; voucher use and communications off track

The Shelter Committee of the Continuum of Care Homelessness Planning Council met to review progress on current goals. Most goals are on track, but increasing voucher utilization and establishing efficient communication with HPC/Comms/CoC are off track. The committee also discussed agency updates and prioritized addressing family shelter capacity and revising the camp engagement plan.

homelessnesssheltervouchersencampmentfamily-shelter
Wed Jul 10, 2024

Metropolitan Council

Council committee to discuss rule change and board legislation

The Rules, Confirmations, & Public Elections Committee will discuss a proposed amendment to Rule 13 of the Council Rules of Procedure and potential legislation regarding Metro boards and commissions. The meeting includes public comment and is scheduled for July 10, 2024.

council-rulesboards-and-commissionspublic-commentlegislation
Wed Jul 10, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission meets to discuss budget, committees, and legislation

The Nashville Music, Film, and Entertainment Commission is holding a regular meeting with public comment, approval of prior minutes, a guest speaker, and reports from the chair and vice chair. Unfinished business includes updates from the Budget Committee, Ad Hoc Job Description Committee, open seats and expiring terms, current legislation, possible amendments to original legislation, the Executive Committee, and the Data Committee. No new business items are listed.

entertainmentcommissionbudgetlegislationpublic-comment
✓ Decided: Commission approves Executive Director job description for HR review

The Nashville Music, Film, and Entertainment Commission approved the Executive Director Job Description, incorporating all recommendations, to submit to Metro HR for final review. The commission also approved prior meeting minutes, heard a presentation on the Nashville Independent Venues Study, and discussed budget, nominations, and legislative amendments.

Wed Jul 10, 2024

Nashville Entertainment Commission

Committee to review Executive Director job description

The Ad Hoc Job Description Committee of the Nashville Music, Film, and Entertainment Commission is meeting to review and discuss the Executive Director job description as an action item. The agenda includes public comment, approval of prior minutes, and unfinished business. No other substantive items are listed.

entertainmentcommissionjob-descriptionpublic-comment
✓ Decided: Committee revises executive director job description for Metro HR approval

The Ad Hoc Committee discussed incorporating public comments into the executive director job description, including adding organizational and budget skills, and plans to resubmit it to Metro HR before presenting to the commission. Approval of previous minutes was postponed. A potential candidate for the executive director position was discussed, with questions to counsel about timing and process. The main committee meeting minutes were approved.

Wed Jul 10, 2024

Stormwater Management Commission

Stormwater board to hear 8 floodway and stream buffer cases

The Stormwater Management Commission will consider eight cases involving floodway and stream buffer disturbances, including requests for waivers, stream crossings, and buffer maintenance. The board will also approve minutes and decision letters from its June 5 meeting. Public comments are due by July 8.

stormwaterfloodwaybufferpermitsnashville
Wed Jul 10, 2024

Community Review Board

Community Review Board rules committee to discuss bylaws

The Community Review Board's Rules and Bylaws Committee is meeting to discuss the CRB's rules and bylaws. The agenda includes a public comment period. This is a discussion-only meeting with no votes scheduled.

community-review-boardrulesbylawspublic-comment
Wed Jul 10, 2024

Sexually Oriented Business Licensing Board (Inactive)

Board to review entertainer and business license permits

The Sexually Oriented Business Licensing Board will hold a regular meeting to approve minutes, hear public comments, and review new and renewal entertainer permits and business licenses for three periods between May 23 and July 10, 2024. The agenda is largely procedural, with no major policy decisions listed.

licensingpermitssexually-oriented-businesspublic-hearingminutes
Wed Jul 10, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission meets July 10, 2024

This is a procedural meeting with no substantive items listed. The agenda includes only call to order, public comment, contacts and disclosures, new business, and adjournment.

entertainment-commissionprocedural
✓ Decided: Executive Committee established; future meetings scheduled

The Nashville Music, Film, and Entertainment Commission's Executive Committee met for the first time to establish itself and schedule future meetings. No substantive decisions were made; the meeting was procedural, covering introductions, scheduling, and adjournment.

Wed Jul 10, 2024

Equalization Board

Board hears property tax appeals for 10 commercial and residential parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for 10 parcels, including commercial and residential properties. The board is an independent body that hears appeals from property owners who dispute their assessed values. Decisions can be appealed to the State Board of Equalization.

property-taxtax-appealsboard-of-equalizationcommercial-propertyresidential-property
Tue Jul 9, 2024

Ending the HIV Epidemic Advisory Council

HIV Advisory Council to discuss officer training and community engagement

The Ending the HIV Epidemic Advisory Council is meeting to discuss officer training and using community engagement to eliminate HIV. The agenda is largely procedural with limited specific action items.

hivpublic-healthcommunity-engagementtraining
Tue Jul 9, 2024

Historical Commission

Historical Commission to evaluate executive director and discuss merit pay

The Human Resources and Budget Committee of the Metropolitan Historical Commission will meet to conduct the executive director's annual performance evaluation and consider merit pay. No other business is on the agenda.

historical-commissionpersonnelbudgetnashville
Tue Jul 9, 2024

Ending the HIV Epidemic Advisory Council

HIV Advisory Council membership committee meets July 9

The Ending the HIV Epidemic Advisory Council's Membership Committee is holding a meeting on July 9, 2024, at 1pm in the Lentz Public Health Department's Music City Room. The agenda contains only procedural boilerplate with no specific items listed for discussion or decision.

hivadvisory-councilmembership-committeemeeting
Tue Jul 9, 2024

Metropolitan Council

Minority Caucus holds leadership roundtable discussion

The Metropolitan Minority Caucus is meeting to discuss leadership topics and review board and commission appointments. The agenda includes a treasurer's report and member updates, but no binding votes or public hearings are scheduled.

councilminority-caucusleadershipboards-commissions
Tue Jul 9, 2024

Fire and Building Code Appeals Board

Board to hear appeal on egress lighting at 1207 Grundy Street

The Board of Fire and Building Code Appeals will hear one appeal case regarding the use of generator and battery back-up power for egress lighting instead of required photoluminescent markings at 1207 Grundy Street. The board will also vote on proposed changes to Section 10 of its Rules and Regulations concerning time limits on testimony. Public comment will be accepted on agenda items.

fire-codebuilding-codeappealsegress-lightingpublic-comment
✓ Decided: Board approves egress lighting appeal with battery backup stipulation

The board approved an appeal by Victoria Parker for 1207 Grundy Street, allowing generator and battery backup for egress lighting instead of photoluminescent paint, with a stipulation requiring 90-minute battery backup and water/moisture-resistant fixtures. The vote was 8-0. The board also approved an addition to Section 10 of its rules regarding time limits on testimony, 7-0. No other substantive decisions were made.

Tue Jul 9, 2024

Civil Service Commission

Civil Service Commission to review appointments, terminations, and eligibility registers

The Metropolitan Civil Service Commission is meeting to approve appointments, terminations/pensions, and eligibility register reports for various Metro departments. The agenda also includes human resource items such as a request to hire above base for a General Services position, extensions of injury-on-duty time for two fire department employees, and job description revisions for Metro Water Services. The meeting is largely procedural, with public comment limited to agenda items.

civil-serviceappointmentsterminationspensionseligibility-registerhuman-resourcespublic-comment
✓ Decided: Civil Service Commission approves appointments, terminations, and eligibility registers

The Nashville Civil Service Commission approved a list of appointments, terminations/pensions, and the eligibility register report without objection. It also approved a hire above base request for a General Services Assistant Director, extended injury-on-duty leave for two Fire Department employees, and accepted job description revisions for Metro Water Services positions.

Tue Jul 9, 2024

Metro Development and Housing Agency Board

MDHA board to vote on 2024 plan update, Randee Rogers financing, two PILOT deals

The Metro Development and Housing Agency Board will consider the 2024 Annual Update to the Consolidated Plan, a third omnibus amendment for Randee Rogers Apartments construction financing, and two PILOT agreements for properties at 4th and Shelby and for Inspiritus. The meeting also includes approval of prior minutes, public comments, and committee reports.

housingdevelopmentfinancepilot-agreementsconsolidated-plan
Tue Jul 9, 2024

Metro Development and Housing Agency Board

Housing committee to get updates on IT, affordable housing occupancy and waitlists

The Housing and Community Committee will receive presentations on agency-wide IT updates and on affordable housing occupancy, waiting lists, and tenant accounts receivable. No votes or decisions are scheduled; the meeting is informational.

housinginformation-technologyaffordable-housingpublic-housingcommittee-meeting
Tue Jul 9, 2024

Metro Development and Housing Agency Board

MDHA committee to approve financing amendment and multiple PILOT agreements

The Finance and Development Committee will consider approving a third omnibus amendment for Randee Rogers Apartments construction financing and several Payment in Lieu of Taxes (PILOT) agreements for affordable housing projects. The committee will also receive updates on other PILOT agreements. Public comments will be heard.

housingfinancepilotsaffordable-housingconstruction
Tue Jul 9, 2024

Equalization Board

Board hears property tax appeals for 10 parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property assessments for 10 parcels across Nashville and Davidson County. The board, an independent body appointed by the mayor and confirmed by the council, will hear appeals from property owners challenging their assessed values. Decisions can be appealed to the State Board of Equalization.

property-taxappealsboard-of-equalizationnashvilleassessments
Mon Jul 8, 2024

Ethical Conduct Board

Ethics Board to consider dismissal of complaint against Metro Arts Commissioner Carol McCoy

The Board of Ethical Conduct will consider a motion to dismiss a complaint against Metro Arts Commissioner Carol McCoy, who is accused of violating ethics rules by voting to fund Thrive awards. McCoy's affidavit argues her vote was based on her understanding of the Metro Code and that she was not improperly influenced. The agenda includes her motion to dismiss and supporting documents, including a recent audit of Metro Arts finances.

ethicsartsauditcomplaintdismissal
✓ Decided: Board dismisses Yousief complaint, finds Griswold violation

The Board dismissed the Yousief v. McCoy complaint after finding no ethical violation, and found a technical violation in Griswold v. Council Member Joy Styles but declined to sanction. The meeting also approved the June 5, 2024 minutes.

Mon Jul 8, 2024

Human Relations Commission

Human Relations Commission to consider conciliation agreement

The Metro Human Relations Commission will hold a special called meeting to review and potentially act on a conciliation agreement, receive a financial update, and discuss community engagement initiatives including the 'No Hate on My Plate' campaign and One City University. The agenda includes public comment periods and a new commissioner orientation scheduled for August 20, 2024.

human-relationsconciliation-agreementcommunity-engagementcommission-meetingnashville
Mon Jul 8, 2024

Continuum of Care Homelessness Planning Council

Equity committee to score CoC funding applications, review racial disparities research

The Equity & Diversity Committee of Nashville's Continuum of Care will discuss next steps for racial disparities research, update a racial equity resources webpage, review the updated CoC Priorities Report, and prepare to score the equity section of the CoC funding application. The meeting also includes a reading of the committee's anti-racism pledge and a discussion of racial equity training.

homelessnessracial-equityfundingcommittee-meetingnashville
Mon Jul 8, 2024

Equalization Board

Board hears property tax assessment appeals for 22 Nashville parcels

The Metropolitan Board of Equalization will hold formal appeal hearings on property tax assessments. The agenda lists appeals by property owners for 22 parcels, including residential and commercial properties across Nashville. The board will also take public comments, review minutes, and conduct routine business.

property-taxappealsboard-of-equalizationpublic-hearing
✓ Decided: Board approves property value changes for 13 Nashville parcels

The Metropolitan Board of Equalization heard 16 property assessment appeals and unanimously approved all motions. The board approved value changes for 13 parcels, mostly reducing total values by applying a sale ratio of 0.7143, and upheld the original values for 3 parcels. All decisions were unanimous.

Mon Jul 8, 2024

Traffic and Parking Commission

Speed limit reductions on Dickerson Pike and Hermitage Ave/Lebanon Pk up for vote

The commission will vote on reducing speed limits on Dickerson Pike and Hermitage Ave/Lebanon Pk as part of Vision Zero. It will also consider new traffic signals, truck restrictions, alley abandonments for Vanderbilt, valet and parking changes, and a sidewalk permit suspension appeal.

trafficspeed-limitsvision-zeroparkingsignalstruck-restrictionsalley-abandonment
✓ Decided: Commission approves Demonbreun Hill Bikeway improvements, removing 31 parking spaces

The Traffic and Parking Commission approved the Demonbreun Hill Bikeway improvements, including a speed limit reduction, a new pedestrian beacon, removal of 31 pay parking spaces, new loading zones, and replacement parking. It also approved a revised valet fee policy, new pay parking zones, and several truck restrictions and traffic control changes. The commission deferred a valet license application for Volunteer Valet LLC and approved a license for Giarratana Parking LLC with conditions.

Mon Jul 8, 2024

Agricultural Extension Board

Agricultural Extension Board to review budget and staff updates

The board will hold a quarterly meeting to discuss budget updates, staff changes, and future meeting plans. The agenda includes routine items such as approval of minutes and officer reports.

agriculturebudgetstaffingmeeting
✓ Decided: Ag Board approves Andy Lantz as County Director

The Agricultural Extension Board approved Andy Lantz's new position as County Director, with a unanimous vote. The board also approved the previous meeting's minutes and discussed upcoming events and programs, including the new office move to 1281 Murfreesboro Pike.

Mon Jul 8, 2024

Hospital Authority Board

Hospital Authority Board nominates FY25 officers

The Nominating Committee of the Hospital Authority Board of Trustees is meeting to nominate officers for fiscal year 2025. The agenda includes a call to order, conflict-of-interest disclosures, and public comment. The primary action item is approval of the officer nominations.

hospital-authoritynominationspublic-commentfiscal-year-2025
Fri Jul 5, 2024

Social Services Commission

Board to evaluate Executive Director Pratt's performance

The Metro Social Services Board of Commissioners will meet to discuss and evaluate the performance of Executive Director Renee Pratt. The agenda includes a call to order, a nomination/personnel committee item for the evaluation, and a question period before adjournment.

social-servicespersonnelperformance-evaluation
Tue Jul 2, 2024 · 6:30 PM

Metropolitan Council

Metropolitan Council reviews zoning changes and a short-term rental exemption

The Nashville Metropolitan Council is reviewing multiple zoning amendments, a resolution affecting short-term rental permits, and a proposed change to its own operating rules. These items would alter land-use regulations, permit requirements, and council procedures for the city.

zoningshort-term-rentalshousingdevelopmentcommissionsrule-amendmentsnashville-government
Metropolitan Courthouse
Tue Jul 2, 2024

Metropolitan Council

Council committee to vote on $1.97M homeless services contract and opioid settlement

The Public Health and Safety Committee is meeting to consider several resolutions and one bill, including grant applications, an opioid settlement agreement, and a $1.97 million appropriation for homeless services. The committee will also hear an overview of the Opioid Settlement Pilot Program and receive department updates. Public comment is limited to eight minutes total, with two minutes per speaker.

public-healthsafetygrantsopioid-settlementhomeless-servicescontractsemergency-management
Tue Jul 2, 2024

Metropolitan Council

Committee to vote on short-term rental exemption and floodplain fence restrictions

The Government Operations and Regulations Committee will consider a resolution to exempt 55 units at 160 2nd Ave. N. from short-term rental distance requirements, and a bill to restrict fences in floodways/floodplains and require fence permits citywide.

short-term-rentalsfloodplainfencespermitszoningpublic-hearing
Tue Jul 2, 2024

Parks and Recreation Board

Discussion of a greenway easement for a development at 304 Oldham Street

The Acquisition Committee is considering a request to accept a proposed dedicated Conservation Greenway Easement. This easement covers 0.1554 acres as part of a self-storage development project at 304 Oldham Street.

zoninggreenwayland acquisitiondevelopment
Tue Jul 2, 2024

Metropolitan Council

Council committee to vote on $2.7M for afterschool programs

The Arts, Parks, Libraries, & Entertainment Committee will consider three resolutions: appropriating $2,716,275 from the Nashville Public Library to nonprofits for afterschool and summer programs, approving a memorandum of understanding with Parks and Recreation for the same programs, and approving land use restrictions for a Shelby Park streambank restoration project. Public comment is limited to eight minutes total, with two minutes per speaker.

librariesparksafter-school-programsbudgetpublic-comment
Tue Jul 2, 2024

Metropolitan Council

Rules Committee to vote on new elementary school in Antioch

The Rules, Confirmations, and Public Elections Committee will consider late-filed ordinances for a new elementary school in Antioch and zoning definition changes, along with several board appointments and a proposed rule change on filing deadlines. The committee also votes on notary elections and ceremonial recognitions.

zoningschoolsartsmusicrulesappointmentsordinances
Tue Jul 2, 2024

Parks and Recreation Board

Board to vote on Riverfront Park pilot program and conservation easement

The Parks and Recreation Board will consider a two-year pilot program for expanded service delivery at Riverfront Park proposed by the Nashville Downtown Partnership, and a conservation greenway easement for a self-storage development at 304 Oldham Street. The board will also vote on a consent agenda with numerous event permits and a memorandum of understanding with the fire department for use of Cornelia Fort Airpark. Annual updates from the Greenways and Open Space Division and Friends of Mill Ridge Park are scheduled.

parksconservationeasementriverfrontfire-departmenteventspermits
Tue Jul 2, 2024

Arts Commission

Arts Commission committee reviews FY24 closeout, FY25 budget, audit

The Budget and Administrative Oversight Committee of the Nashville Arts Commission is meeting to discuss the FY24 budget closeout, the FY25 budget, and an audit. The agenda includes public comment, approval of minutes from prior meetings, and opening remarks from Dr. Paulette Coleman. No votes or decisions are listed on the agenda.

budgetartsauditpublic-commentcommittee-meeting
Tue Jul 2, 2024

Metropolitan Council

Charter Revision Committee considers ballot amendments to Metro Charter

The Charter Revision Committee is meeting to consider Resolution RS2024-559, which proposes amendments to the Metropolitan Government Charter and sets descriptions for the ballot. Two amendments have been filed: Amendment 1 by Weiner and Amendment 2 by Toombs. Public comment is allowed on legislative items.

charter-revisionballot-measurespublic-commentmetropolitan-council
Mon Jul 1, 2024

Metropolitan Council

Council committee to weigh transit surcharge referendum for Nov. 5 ballot

The Transportation and Infrastructure Committee will consider resolutions and bills on grants, donations, and infrastructure projects, including a transit improvement program with a proposed surcharge that would go to a county-wide referendum on November 5, 2024. They will also review a bill to restrict fences in floodways and require fence permits, and several items to accept or abandon water and sewer mains for specific properties.

transportationtransitreferendumzoninginfrastructuregrantsfloodplain
Mon Jul 1, 2024

Metropolitan Council

Committee to consider transit surcharge referendum and $1.97M homeless services contract

The Budget and Finance Committee will discuss a transit improvement program that would place a surcharge on certain taxes before voters in November 2024, and consider appropriating $1,971,656.19 to The Salvation Army for homeless services. Other items include grants for mental health court, substance use treatment, and disaster recovery, as well as a donation for a pocket park and funding for afterschool programs.

budgettransithomeless-servicespublic-safetyparkslibrariesgrants
Mon Jul 1, 2024

Metropolitan Council

Council committee to consider transit surcharge referendum for November ballot

The Planning and Zoning Committee will discuss a transit improvement program that would place a surcharge on certain taxes, subject to a county-wide referendum on November 5, 2024. Other items include surplus property disposition, street renaming, and multiple utility easement acceptances and abandonments.

transitreferendumsurchargezoningpublic-worksstreet-namingproperty
Mon Jul 1, 2024

Historical Commission

Marker Committee to review two proposed historical markers

The Marker Committee will review proposed language for two historical markers: the Burton-Compton House and Primo Bartolini (1889-1959). No public comment will be taken at this meeting; the full Metro Historical Commission will consider adoption on July 15, 2024, with public comment available then.

historical-markershistorical-commissionpublic-hearing
Mon Jul 1, 2024

Parks and Recreation Board

Parks board committee reviews sponsorship guidelines and policy

The Ad Hoc Sponsorship Committee of the Metropolitan Board of Parks and Recreation is meeting to review sponsorship guidelines, policy, and ordinance. The agenda includes a call to order, a public comment period, and the review item, followed by adjournment. No specific decisions or proposals are listed.

parkssponsorshippolicypublic-comment
Fri Jun 28, 2024

Continuum of Care Homelessness Planning Council

Nashville homelessness council meets to review advisory board sustainability

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board (CAB) will meet to discuss its sustainability and future operations. The agenda includes introductions, a CAB sustainability assessment, and other business items.

homelessnessconsumer-advisory-boardnashvillecontinuum-of-care
Thu Jun 27, 2024

Continuum of Care Homelessness Planning Council

Executive Committee to adopt Governance Charter revisions and discuss racial disparities

The Executive Committee of the Continuum of Care Homelessness Planning Council will review minutes, debrief recent meetings, and discuss adoption of Governance Charter revisions. They will also prepare for the August HPC meeting and a HUD technical assistance visit, receive updates on the FY2024 funding application and encampment closures, and discuss strategies for addressing racial disparities.

homelessnessgovernancefundingracial-disparitiesencampments
Thu Jun 27, 2024

Metro Action

Bylaws committee to review attendance rules

The Metro Action Commission's Bylaws Committee will meet to review bylaws and board attendance. No votes or decisions are scheduled; the meeting is procedural.

bylawscommissionmeetingnashville
Thu Jun 27, 2024

Planning Commission

Planning Commission to vote on Downtown Code bonus height changes and multiple rezonings

The Planning Commission will consider a Downtown Code Bonus Height Program amendment, several rezoning requests for mixed-use and multi-family developments, and various subdivision plats. Many items are recommended for deferral to future meetings, while others are on the consent agenda for a single vote.

zoningrezoningdowntown-codemulti-family-housinghistoric-preservationsubdivisionplanning-commission
✓ Decided: Planning Commission approves Rutledge Hill towers up to 37 stories

The Planning Commission approved a Downtown Code overall height modification for the Rutledge Hill mixed-use development, allowing three towers up to 37 stories with 150 residential units, 325 hotel rooms, and ground-floor retail. The commission also approved several other projects, including a 277-unit mixed-use building at Lion's Head Village, a 119-unit development on Burkitt Road, and a 56-unit townhome project on Ewing Drive. Multiple items were deferred to future meetings, and the commission approved a 4% COLA and 3% salary increase for the Executive Director.

🏢 Building at this address: 7 m tall
Thu Jun 27, 2024

Metro Action

Committee to discuss executive director evaluation

The Ad Hoc Committee of the Metropolitan Action Commission Board of Commissioners is meeting to discuss the evaluation of the executive director. The agenda includes only a call to order, discussion of the evaluation, and adjournment. No other business is scheduled.

commissionexecutive-directorevaluationpersonnel
Thu Jun 27, 2024

Hospital Authority Board

Hospital Authority Finance Committee to approve FY2025 budget and contracts

The Finance Committee of the Metropolitan Hospital Authority Board of Trustees is meeting to approve the FY2025 budget, April 2024 financial statements, and several service contracts, including environmental health and safety oversight, front desk security, and medical physics consultation. The agenda also includes routine items such as approval of prior meeting minutes, conflict of interest disclosures, and public comment.

budgetcontractsfinancehospitalpublic-health
Thu Jun 27, 2024

Metro Action

Metro Action Commission to vote on CSBG grant application and contracts

The Metropolitan Action Commission board will meet to approve the May 30 meeting minutes, receive committee and executive director reports, and take action on items including the use of a Community Needs Assessment for the CSBG grant application, grants/contracts/MOUs, and job description or organizational changes. The agenda is largely procedural, with no specific dollar amounts or project details listed.

grantscontractsorganizational-changemeeting-minutescommunity-needs-assessment
Thu Jun 27, 2024

Hospital Authority Board

Hospital board to vote on $1.1M in contracts for safety, security, radiology

The Metropolitan Hospital Authority Board of Trustees will vote on three contracts totaling over $1.1 million for environmental health and safety compliance, front desk security, and medical physics consultation. The board will also consider the CEO's performance review for FY24 goals, the FY25 budget, and the April finance report, along with routine approvals of minutes and credentials.

hospitalcontractsbudgetsecurityhealth-safetyradiology
Thu Jun 27, 2024

Metro Action

Nominating committee to propose officer slate

The Metropolitan Action Commission's Nominating Committee is meeting to consider a slate of officers. The agenda includes a call to order, discussion of the officer slate, and adjournment. No other business is listed.

commissionnominatingofficers
Wed Jun 26, 2024

Health and Educational Facilities Board

Nashville board to consider $42M bond for West Trinity Lane apartments, $375M for Vanderbilt

The Health and Educational Facilities Board will hold a public hearing and consider preliminary approval of up to $42 million in multifamily housing revenue bonds for West Trinity Apartments at 869 West Trinity Lane. The board will also consider final approval of up to $375 million in educational facilities revenue bonds for Vanderbilt University's main campus. Additionally, the board will discuss board administration and legal representation.

bondshousingeducationvanderbilt-universitypublic-hearing
✓ Decided: Board approves up to $375M in Vanderbilt University bonds

The board approved the issuance of up to $375 million in Educational Facilities Revenue Refunding and Improvement Bonds for Vanderbilt University, with proceeds to finance campus improvements, retire outstanding commercial paper notes, and pay issuance expenses. The board also granted preliminary approval for up to $42 million in multifamily housing revenue bonds for a 190-unit project at 869 West Trinity Lane. Both resolutions passed unanimously with all members present voting affirmatively.

Wed Jun 26, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses from May 23 to June 26

The Sexually Oriented Business Licensing Board will hold a routine meeting to approve minutes from May 22, 2024, and review new and renewal entertainer permits and business licenses submitted between May 23 and June 26, 2024. The agenda also includes an inspector's report and a public comment period. No substantive policy decisions or enforcement actions are listed.

licensingpermitspublic-commentsexually-oriented-business
Wed Jun 26, 2024

Short Term Rental Appeals Board

No meetings held for June 2024

The Short Term Rental Appeals Board did not hold any meetings in June 2024. The agenda contains only a cancellation notice and a list of board members.

short-term-rentalsappeals-boardcancelled-meeting
Wed Jun 26, 2024

Continuum of Care Homelessness Planning Council

CoC committee to review FY2024 application and scoring rubric

The Performance Evaluation Committee will review the draft FY2024 CoC competition application, determine the scoring rubric for applications, and review the updated CoC priorities report. They will also discuss strategies to improve the consolidated application and system performance measures, and receive an update from Urban Housing Solutions. The meeting includes a values and equity statement and a progress update on the Collaborative Applicant transfer.

homelessnesshousingcocgrant-applicationperformance-measuresnashville
Wed Jun 26, 2024

Social Services Commission

Metro Social Services board to review budget updates and April minutes

The Metro Social Services Board of Commissioners is meeting to approve the April meeting summary, hear the director's report, and receive budget updates. The agenda is largely procedural, with no specific policy decisions or public hearings listed.

social-servicesbudgetboard-meetingnashville
Wed Jun 26, 2024

Beer Permit Board

Beer Board to hear 3 underage-sale cases, new bar applications

The Metro Beer Permit Board will consider 16 beer permit applications, including new locations, ownership changes, and special event permits, plus three administrative hearings for alleged underage sales. The board will also vote on the June 13 minutes and hear public comment. Several applications are deferred for missing documents.

beer-permitsalcoholpublic-hearingspecial-eventsunderage-salesnashville
✓ Decided: Beer Board approves 9 permits, defers 6, fines 3 for underage sales

The Metro Beer Board granted final approval to nine beer permit applications, including new locations, special events, and a change of ownership. Six applications were deferred indefinitely due to missing documents, and two applications for Morgan Wallen's This Bar & Tennessee Kitchen were deferred to a future meeting. The board also issued civil penalties to three businesses for underage sales violations, with amounts ranging from $500 to $1,500, or the option of a 7-day suspension plus probation.

Tue Jun 25, 2024

Audit Committee

Audit Committee to review four Metro audits and external audit plan

The Metropolitan Nashville Audit Committee will discuss audits of Metro Arts, Criminal Justice Planning, Sidewalk Prioritization, and the Nashville Farmers' Market, along with the external audit plan for FY2024. The committee will also review the Metropolitan Auditor's performance and receive updates on internal audit projects and budgets.

auditfinancebudgetperformance-reviewpublic-comment
✓ Decided: Audit Committee approves 2.8% merit raise for Metro Auditor

The Audit Committee approved a 2.8% merit increase for the Metropolitan Auditor's salary. The committee also discussed audits of Metro Arts, Criminal Justice Planning, sidewalk prioritization, and the Farmers' Market, but took no formal action on those items. The minutes from the April 9, 2024 meeting were approved.

Tue Jun 25, 2024

Metropolitan Council

Immigrant Caucus to discuss budget and language access

The Metropolitan Immigrant Caucus is meeting to discuss budget matters, language access initiatives, and community events. The agenda includes approval of previous minutes and an open discussion period.

immigrant-caucusbudgetlanguage-accesscommunity-events
Tue Jun 25, 2024

Ending the HIV Epidemic Advisory Council

HIV advisory council meets to discuss standards of care

The Ending the HIV Epidemic Advisory Council is holding a Standards of Care Committee meeting. The agenda contains only meeting logistics and no listed discussion items or decisions.

hivhealthadvisory-councilmeeting
Tue Jun 25, 2024

Metropolitan Council

Women's Caucus reviews FY25 budget wins and new initiatives

This is a procedural meeting of the Metro Council Women's Caucus. Members will review budget wins for fiscal year 2025, discuss new initiatives and upcoming volunteer projects, and hold a celebration. No formal votes or public hearings are scheduled.

councilbudgetvolunteerwomen-caucus
Tue Jun 25, 2024

Housing Trust Fund Commission

Housing Trust Fund Commission to vote on Round 13 grant awards and contract amendments

The Metropolitan Housing Trust Fund Commission will vote on grant contract amendments for four organizations and on funding recommendations for Round 13 of the Barnes Housing Trust Fund. They will also review May financials and discuss the FY25 budget and transition updates. Public comment is allowed at the start of the meeting.

housinggrantsbudgetaffordable-housingpublic-meeting
Mon Jun 24, 2024

Continuum of Care Homelessness Planning Council

Homelessness council to vote on new HMIS agency and priorities report

The Data & HMIS Oversight Committee of the Nashville/Davidson County Continuum of Care will meet to consider two action items: approving DePaul USA as a new HMIS participating agency and adopting the Continuum of Care Priorities Report. The committee will also discuss a potential merger, finalize its timeline and project mapping, and review April meeting minutes.

homelessnesshmiscontinuum-of-caredataoversightnashville
Mon Jun 24, 2024

Community Review Board

Board to discuss whistleblower policy, executive director pay, and sexual misconduct report

The Community Review Board will hold its monthly meeting, including discussion of a whistleblower protection policy, a memorandum of understanding, rules and bylaws, a merit pay increase for the executive director, a sexual misconduct report, and a board retreat.

community-review-boardwhistleblowerexecutive-directorsexual-misconductbylawspublic-comment
✓ Decided: CRB recommends 12% merit increase for Executive Director

The Community Review Board approved the Executive Director's report and recommended a 12% merit increase for Executive Director Jill Fitcheard, effective July 1, 2024, with one abstention. The board also discussed the MOU negotiation process, a whistleblower policy, and a police sexual misconduct report, but no other formal decisions were made.

Fri Jun 21, 2024

Human Relations Commission

Human Relations Commission executive committee to review budget and conciliation planning

The Metro Human Relations Commission's executive committee is meeting to discuss budget updates, finance review, and conciliation planning. The agenda is mostly procedural, with no specific decisions or proposals listed.

budgetfinanceconciliationhuman-relations
Thu Jun 20, 2024

Wastewater Hearing Authority

Wastewater Hearing Authority to review pH variance request and FOG policy draft

The Wastewater Hearing Authority is meeting to discuss a tentative pH variance request from Onsite Environmental, review the Semi-Annual Report 77 on industrial user compliance, and examine drafts of the FOG policy and a new grease waste hauler enforcement guide. The meeting will also include an update on Calypso Café and member renewal reminders.

wastewaterindustrial-compliancefog-policyenforcementpublic-hearing
Thu Jun 20, 2024

Sports Authority Board

Sports Authority committees to consider June 2023 meeting minutes

The Joint Executive & Personnel Committees of the Nashville Sports Authority will hold a public meeting to consider approval of the June 13, 2023 meeting minutes. No other substantive business is listed on the agenda.

sports-authoritymeeting-minutespublic-meeting
Thu Jun 20, 2024

Sports Authority Board

Sports Authority to consider FY2025 salary updates and storm water spending

The Sports Authority Board will meet publicly to consider approving meeting minutes, salary updates and staff parking expenses for FY2025, and expenditures for storm water control measures at First Horizon Park. The agenda also includes presentations on Nashville Mayor Freddie O'Connell's transit plan, the Titans new stadium progress, and the East Bank development.

sports-authoritybudgetsalariesstorm-waterstadiumtransiteast-bank
Thu Jun 20, 2024

Transportation Licensing Commission

TLC to vote on new taxi, tour, and towing permits; elect chair

The Transportation Licensing Commission will hold a special election for Chair and consider several permit applications, including new taxicab company Regal Taxi LLC (22 permits) and low-speed vehicle tour company Vintage Nashville Tour (20 permits), both deferred pending the Connect Downtown study. The commission will also review a Lime scooter fleet increase, emergency wrecker applications, and disciplinary complaints against Old Town Trolley.

taxicabstowingscooterslow-speed-vehicleslicensingpublic-hearing
✓ Decided: TLC approves 22 new taxicab permits for Regal Taxi LLC

The Transportation Licensing Commission approved 22 new taxicab permits for Regal Taxi LLC, finding a public convenience and necessity. It also approved 10 low-speed vehicle permits for Vintage Nashville Tour, rescinded the liquor liability insurance requirement for entertainment transportation companies, and approved Lime's 50-scooter fleet increase with conditions. The commission deferred several items, including a booting application and additional entertainment vehicle permits.

Thu Jun 20, 2024

Sports Authority Board

Sports Authority Finance Committee to vote on FY2025 salary updates and storm water costs

The Sports Authority Finance Committee will consider approving salary and parking expense updates for FY2025 and a resolution to fund ongoing storm water control measures at First Horizon Park. The meeting is open to the public with a public comment period.

sports-authorityfinancebudgetstorm-waterparkingpublic-meeting
✓ Decided: Finance Committee approves FY2025 salary updates and stormwater maintenance funding

The Finance Committee unanimously approved the February 27, 2024 meeting minutes, a resolution authorizing salary updates and staff parking expenses for FY2025, and a resolution approving up to $7,500 for stormwater control measures at First Horizon Park. All three items were recommended to the full board for final approval.

Thu Jun 20, 2024

Zoning Appeals Board

Board to hear 12 zoning appeals including church, day care, drive-thru, and signs

The Metropolitan Board of Zoning Appeals will hold a public hearing on 12 cases involving requests for variances, special exceptions, and an appeal of a zoning administrator's classification. Items include a church sanctuary, an adult day care, a drive-thru, a monument sign, an indoor batting facility, and several residential fence and structure variances.

zoningvariancesspecial-exceptionsreligious-institutionday-caredrive-thrusignsrecreation
Thu Jun 20, 2024

Continuum of Care Homelessness Planning Council

Homelessness Planning Council to consider 7 nominees for membership

The Continuum of Care Homelessness Planning Council is reviewing candidate profiles for 2024 nominees to fill council seats. The agenda consists solely of nominee biographies and statements of interest; no votes or decisions are recorded in this document.

homelessnesscontinuum-of-carecouncil-nominationsnashvillepublic-health
Thu Jun 20, 2024

Emergency Communication District (E-911) Board

E-911 Board to adopt FY2025 budget and contracts

The Davidson County Emergency Communication District Board will hold a public hearing and vote on the FY2025 budget, approve an amended FY2024 budget, and approve contracts for legal, public relations, and accounting services. The board will also consider renaming several street segments and an alley, and elect officers for the next fiscal year.

budgetcontractspublic-safetystreet-namese-911
Tue Jun 18, 2024 · 6:30 PM

Metropolitan Council

Metro Council reviews pay plans, short-term rental exemptions, and downtown development

The Nashville Metropolitan Council will review proposed pay plan updates for general city employees, police and fire personnel, and Board of Health staff, which would adjust municipal compensation effective July 1, 2024. A public hearing will address a resolution to exempt addresses at 488–496 W. Trinity Ln from minimum distance requirements for non-owner-occupied short-term rental permits, altering local rental regulations. The agenda also includes resolutions supporting downtown development that would replace a parking lot with a new fire and emergency operations center, alongside grant approvals for violence intervention programs and disaster relief.

budgetcompensationzoningshort-term-rentalsfire-servicesgrantsboard-appointments
Metropolitan Courthouse
Tue Jun 18, 2024

Urban Council

Urban Council to establish property tax rate for Fiscal Year 2024-2025

The Urban Council will meet to consider a resolution regarding the Urban Services District. The meeting focuses on levying a property tax and establishing the tax rate for the upcoming fiscal year.

taxationbudgetproperty-taxurban-services-district
David Scobey Council Chamber
Tue Jun 18, 2024

Metropolitan Council

Committee to vote on no-confidence resolution for finance and law directors

The Rules, Confirmations, and Public Elections Committee will consider a resolution expressing lack of confidence in the Director of Finance Kevin Crumbo and Director of Law Wally Dietz. The committee will also vote on several honorary resolutions and board/commission appointments.

council-committeeno-confidencefinancelawappointmentsresolutionspublic-comment
Tue Jun 18, 2024

Historic Zoning Commission

Historic Zoning Commission reviews 30+ permits, design guidelines, and violations

The Metro Historic Zoning Commission will consider over 30 items, including new construction, additions, demolitions, and violations in historic overlays across Nashville. Key actions include adopting design guidelines for the Richland-West End NCZO, a historic landmark overlay for 1109 1st Avenue S, and officer elections. Several items are requested for deferral or revised to administrative permits.

historic-preservationzoningpermitsdesign-guidelinesviolationslandmark-overlay
✓ Decided: Commission approves Richland-West End design guidelines, recommends Hubbard House landmark

The Metro Historic Zoning Commission approved updated design guidelines for the Richland-West End overlay and recommended the Hubbard House at 1109 1st Avenue South for Historic Landmark status. The commission also approved numerous construction permits with conditions, denied several proposals, and handled two violation cases. Officers were re-elected.

Tue Jun 18, 2024

Metropolitan Council

Council committee to review grants for library puppeteers and Warner Parks staffing

The Arts, Parks, Libraries, & Entertainment Committee is meeting to consider three resolutions: one approving an amendment to a grant for the Nashville Public Library's Wishing Chair Productions puppeteer program, and two accepting grants from Friends of Warner Parks for the Metropolitan Board of Parks and Recreation—one for staff positions and copier rental, and one for seasonal staffing for the S.W.E.A.T. program. These are routine grant acceptances and amendments, with no major policy changes or public hearings on substantive issues.

parkslibrariesgrantsartseducation
Tue Jun 18, 2024

Mechanical, Plumbing, and Electrical Examiners and Appeals Board

Board to hear two appeals on plumbing fixture requirements for new buildings

The Plumbing Board will consider two variance appeals: one from Nathan Johnson seeking to waive drinking fountain requirements at a new I-1 Rehabilitative Services residence hall, and another from Alejandro Fuentes requesting relocation of bathrooms at a self-storage facility. The board will also handle routine items including minutes approval, registrations, and an election for chairman/vice chairman.

plumbingappealsbuilding-codespublic-hearingnashville
✓ Decided: Board approves bathroom relocation variance for Oldham Street

The board approved a variance allowing relocation of bathrooms to the first floor at 304 Oldham Street, and deferred an appeal about drinking fountains at 8283 River Road Pike to the July meeting. It also approved the May minutes and re-elected Brian Yunker as Chairman and Weston Iler as Vice Chairman, all by 6-0 votes.

Tue Jun 18, 2024

Farmers Market Board

Board to vote on alcohol and beer sales policy at Farmers' Market

The Nashville Farmers' Market Board will discuss and vote on a policy regarding alcohol and beer sales at the Market House, and consider a request from A & M Marketplace to sell beer for consumption at the market. The meeting also includes public comments and approval of prior minutes.

alcoholbeer-salesfarmers-marketpublic-commentvoting
✓ Decided: Farmers Market Board meeting yields no decisions due to lack of quorum

The Nashville Farmers' Market Board of Commissioners met on June 18, 2024, but could not take any official actions because a quorum was not present. The board could not approve the May 21 meeting minutes, discuss or vote on a policy for alcohol and beer sales at the Market House, or consider A & M Marketplace's request to sell beer for consumption. The NFM management team will work with Metro Legal on a lease amendment to allow the beer request, and the meeting adjourned after an executive director's report.

Tue Jun 18, 2024

Community Review Board

Executive Committee to discuss MOU, bylaws, and executive director evaluation

The Community Review Board Executive Committee is meeting to discuss several operational items, including a press conference, a memorandum of understanding (MOU), rules and bylaws, the executive director's performance evaluation, a sexual misconduct report, and a board retreat. No votes or decisions are listed on the agenda; the items are listed under 'Discussion' and 'New Business/Announcements.'

community-review-boardexecutive-committeebylawspersonnelsexual-misconductmou
Tue Jun 18, 2024

Public Library Board

Library board to vote on interim director salary increase

The Nashville Public Library Board of Trustees will consider two resolutions: one approving a salary increase for the interim library director and another adopting a policy for special collections book donations. The board will also hear reports on nature kits and a passport pilot program, and take public comments on actionable agenda items.

librarysalarypolicypublic-commentsstaff-reports
Tue Jun 18, 2024

Work Release Commission

Work Release Commission approves two inmates for work release, denies three

The Work Release Commission reviewed applications for work release candidates. Two inmates were approved, three were denied, and the board discussed candidates' charges, history, behavior, and treatment programs.

work-releaseinmatesapprovaldenialcorrections
Tue Jun 18, 2024

Metropolitan Council

New pay plans for police, fire, and health employees; $464K for homeless housing

The Public Health and Safety Committee is considering new pay plans for police, fire, and health department employees, along with contracts and grants for emergency rental assistance, air quality monitoring, and homeless services. A bill would require the Office of Homeless Services to maintain a provider inventory.

policefirehealthhomelessnesshousinggrantspublic-safety
Tue Jun 18, 2024

Metropolitan Council

Committee to vote on new pay plans for Metro employees and STR exemption

The Government Operations and Regulations Committee will consider resolutions adopting new pay plans for general employees, police/fire, and Board of Health staff, effective July 1, 2024. They will also vote on a resolution to exempt six properties on W. Trinity Lane from minimum distance requirements for a short-term rental permit. A bill creating 23 new positions across multiple departments is on third reading.

pay-plansshort-term-rentalspersonnelpolicefirepublic-healthzoning
Mon Jun 17, 2024

Historical Commission

Historical Commission to vote on two new historical markers

The Metropolitan Historical Commission will vote on approving two historical markers: one for the Neuhoff House in Germantown and one for John Wesley Frierson, an early African American millionaire. The meeting also includes a presentation on the Isaac Project from Christ Church Cathedral and reports on historic zoning.

historical-markershistoric-preservationgermantownafrican-american-historypublic-hearing
✓ Decided: Commission approves two historical markers, tables none

The Metropolitan Historical Commission unanimously approved two historical markers: one for the Neuhoff House and one for John Wesley Frierson. The commission also approved the May 2024 meeting minutes. No other substantive decisions were made; the meeting included guest presentations and staff reports.

Mon Jun 17, 2024

Metropolitan Council

Committee to vote on water service deals for Split Rock, airport, and Music Row projects

The Transportation and Infrastructure Committee will consider 14 items, including participation agreements for water service improvements for Split Rock Development and the Metro Nashville Airport Authority, easement acquisitions for the West End Place stormwater project, and utility abandonments for Albion Music Row and Titans Town. A bill on second reading would authorize NDOT to regulate food truck vending in public rights-of-way.

transportationinfrastructurewater-sewerdevelopmentvendingeasementsstormwater
Mon Jun 17, 2024

Metropolitan Council

Committee considers new pay plans for general employees, police, fire, and health board

The Budget and Finance Committee is considering resolutions adopting new pay plans for general employees, police, fire, and health board staff, effective July 1, 2024. It will also vote on multiple grants, contracts, and appropriations, including $464,000 for homeless services and a property purchase for a new fire station. The committee will review bills on second and third reading, including the FY2025 budget ordinance and tax levy.

budgetpay-planspolicefirehomeless-servicesgrantshousing
Mon Jun 17, 2024

Bicycle and Pedestrian Advisory Commission

BPAC to vote on vice chair, bylaws; hear bike share RFP update

The Bicycle and Pedestrian Advisory Committee will vote on a new vice chair and on amendments to its bylaws, procedures, and meeting schedule. Members will also receive informational updates on the Gallatin Pike and Main Street project community meetings, the bike share RFP, pedestrian bridge closures, and the 2nd Avenue Tourism Improvement Zone. A presentation on the Demonbreun Street Bikeway and a discussion on the Bike Friendly Community application are also scheduled.

bicyclepedestrianbike-sharebikewaybylawspublic-commenttransportation
✓ Decided: BPAC approves Matt Hertz as Vice-Chair, discusses projects

The Bicycle and Pedestrian Advisory Commission approved Matt Hertz as Vice-Chair and unanimously approved the May minutes. Staff provided updates on several projects, including the Gallatin Pike and Main Street Project, Bikeshare RFP, Pedestrian Bridge Closures, and the 2nd Ave Tourism Zone. The commission discussed the Bike Friendly Community application and proposed holding future meetings on the third Monday of each month, pending venue confirmation.

Mon Jun 17, 2024

Auditorium Commission

Auditorium Commission meets June 17; agenda items not listed

The Metropolitan Auditorium Commission is holding a regular public meeting on June 17, 2024, at 10:30 AM in Room A-31 of the Nashville Municipal Auditorium. The agenda contains only standard procedural elements—public comment period, non-discrimination statement, and ADA accommodation notice—with no specific items listed for discussion or decision.

auditoriumpublic-meetingprocedural
Mon Jun 17, 2024

Metropolitan Council

Council to vote on land purchase for new fire station near Youngs Lane

The Planning and Zoning Committee will consider 16 resolutions and bills, including a land purchase for a new fire station, water service agreements for developments, and easement abandonments. A housing and infrastructure study update will also be presented.

zoningfire-stationwater-infrastructurehousingredevelopmenteasementspublic-works
Fri Jun 14, 2024

Human Relations Commission

Human Relations Commission to review budget

The Metro Human Relations Commission is holding an executive committee meeting to review its budget. The agenda includes a call to order, quorum confirmation, public comments, and new business focused on budget review. No other substantive items are listed.

budgethuman-relationscommission-meeting
Thu Jun 13, 2024

Convention Center Authority

June 13 meeting canceled due to lack of quorum

The Convention Center Authority meeting scheduled for June 13, 2024, has been canceled because a quorum could not be reached. No business will be conducted.

cancellationconvention-centernashville
Thu Jun 13, 2024

Health Board

Health Board reviews $23M opioid settlement spending and next steps

The board is reviewing the Metropolitan Public Health Department's opioid response, including $23 million in settlement funds received over 18 years and current projects funded by state, federal, and local sources. Key contracts include $2.4 million for Mental Health Co-op and $1.6 million for Samaritan Recovery Services. The board also discussed next steps such as awaiting Metro Council vendor contract approval for an opioid care process project and expanding the REACH program.

opioidspublic-healthmental-healthfundingoverdose-preventioncontracts
Thu Jun 13, 2024

Metropolitan Council

Committee to finalize charter amendment resolution for July council vote

The Metro Council Charter Revision Committee will meet to review and finalize a Charter Amendment Resolution. The next step is to file the resolution with the Metro Clerk by June 25, 2024, for consideration at the July 2, 2024 Council Meeting. The filing date allows time for deferral and a 30-day review by the Charter Revision Commission.

charter-amendmentcouncil-meetinggovernment-procedurenashville
Thu Jun 13, 2024

Planning Commission

Planning Commission to confirm Downtown Code Design Review Committee member

The Metro Planning Commission is considering the confirmation of William Hastings to continue serving on the Downtown Code Design Review Committee (DTC DRC). This appointment is required as one member's term is expiring. The DTC DRC reviews applications within the Downtown Code zoning district.

planning-commissiondowntown-codedesign-review-committeeappointment
✓ Decided: Planning Commission approves East Bank rezoning to Downtown Code

The Planning Commission approved a rezoning of 30 acres of Metro-owned property on the East Bank from MUI to DTC (Downtown Code) zoning, contingent on the approval of a related text amendment establishing an East Bank subdistrict with new development standards. The Commission also approved a 92-lot single-family subdivision at 6103 Mt. View Road with conditions, and approved several other rezoning and subdivision requests. Multiple items were deferred to future meetings.

🏢 Building at this address: All Seasons Gardening & Brewing Supply Co. · 5 m tall
Thu Jun 13, 2024

Hospital Authority Board

Hospital Authority Board to review CEO performance goals

The Hospital Authority Board of Trustees is meeting to discuss and approve the CEO's performance goals for fiscal years 2024 and 2025. The agenda includes routine items such as approval of minutes and public comment, but the main action is the approval of these performance goals.

hospitalceo-performancegovernancepublic-comment
Thu Jun 13, 2024

Beer Permit Board

Beer Board to vote on 26 new permits, 14 missing-doc deferrals, and 10 fines

The Metro Beer Board will consider 26 applications for new, expanded, or transferred beer permits, including for Casa Chuy, Cyanide Cider, Puttshack Nashville, and Chief's on Broadway. Fourteen applications are listed for deferral due to missing documents. The board will also decide on civil penalties for 10 businesses, including United Market ($5,000) and Honky Tonk Central ($2,000), for alleged underage sales, overcrowding, and other violations.

beer-permitsalcohol-regulationpublic-safetypermitsfinesnashville
✓ Decided: Beer Board approves 24 permits, defers Alex's Tacos and Wings application

The Metro Beer Board approved all beer permit applications except #1 (Mar and Tierra Mexican Grill) and #20 (Layer Cake), which were deferred. It also deferred 14 applications due to missing documents, and deferred the Alex's Tacos and Wings application to August 8. The board accepted staff recommendations for civil penalties on 10 complaints, totaling $18,500.

Thu Jun 13, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews metrics, goals, and encampment plan revision

The Shelter Committee of the Nashville-Davidson County Continuum of Care meets to review homeless metrics, current goals, and agency announcements. Key discussion items include addressing shelter capacity, adopting a revised encampment plan, and increasing affordable housing capacity and voucher utilization. The agenda is largely a working session with no formal votes or public hearings scheduled.

homelessnessshelterencampment-planaffordable-housingvoucher-utilizationmetricscontinuum-of-care
Wed Jun 12, 2024

Sustainability Advisory Committee

Sustainability Committee to hear transportation plan and climate updates

The Sustainability Advisory Committee is meeting to receive presentations on the Choose How You Move transportation plan and Metro's climate planning efforts. The committee will also review its roles and responsibilities and discuss topics for future meetings. Public comments are invited.

sustainabilitytransportationclimatepublic-comment
Wed Jun 12, 2024

Greenways and Open Space Commission

Greenways Commission to discuss design process and project updates

The Greenways and Open Space Commission will meet to discuss the process for design and construction of greenways, receive updates on greenway projects and open space acquisitions, and review the Greenways for Nashville report. The meeting includes a public comment period limited to 20 minutes total.

greenwaysopen-spaceparkspublic-commentnashville
Wed Jun 12, 2024

Sports Authority Board

Sports Authority Personnel Committee to evaluate executive director

The Sports Authority Personnel Committee will meet to consider approval of past meeting minutes and conduct the executive director's annual performance evaluation. The meeting is open to the public with a public comment period.

sports-authoritypersonnelexecutive-evaluationpublic-meeting
Wed Jun 12, 2024

Continuum of Care Homelessness Planning Council

Homelessness council reviews data showing racial disparities in housing exits

The Homelessness Planning Council reviewed system performance measures and a data report showing that only 22% of single adults exit homelessness to permanent housing compared to 74% of families, and that Black people make up 53% of those experiencing homelessness despite being 27% of the population. The Office of Homeless Services reported it is seeking additional funding during Metro budget season and working on four focus areas including permanent housing, family homelessness, veteran homelessness, and encampment engagement. The council also discussed the transfer of Continuum of Care grant administration from MDHA to OHS and the upcoming nomination process for council members.

homelessnesshousingracial-disparitiesdatabudgetcontinuum-of-carenashville
✓ Decided: Council hears reports on homelessness data, funding, and charter changes

The Homelessness Planning Council meeting was largely informational, with no formal votes or action items. Members heard reports on OHS budget needs, MDHA's plan to transfer CoC funds to OHS, 2023 HUD System Performance Measures showing mixed results, and a Data Committee report highlighting racial disparities and low permanent housing exits for single adults. The CoC Governance Charter is open for public comment until April 26.

Wed Jun 12, 2024

Industrial Development Board

Industrial Development Board hears affordable housing presentation

The Industrial Development Board's Ad Hoc Committee will hold a public comment period, approve prior meeting minutes, and receive a presentation from Matt Wiltshire of Pathway Lending on affordable housing. No votes on projects or financial incentives are scheduled.

industrial-development-boardaffordable-housingpublic-commentnashville
Wed Jun 12, 2024

Industrial Development Board

Board to vote on bond resolution for 900 at Cleveland Park housing project

The Industrial Development Board will consider a final authorizing bond resolution for Nashville Leased Housing Associates III, LP (Dominium) for the 900 at Cleveland Park project. The meeting also includes public comment, approval of prior minutes, and committee reports.

industrial-development-boardbondshousingpublic-commentnashville
Tue Jun 11, 2024 · 6:00 PM

Metropolitan Council

Council considers capital budget and utility infrastructure ordinances

The Metropolitan Council is meeting to consider the 2024-2025 through 2029-2030 Capital Improvements Budget. Additionally, several ordinances are up for third reading regarding the acceptance or abandonment of water and sewer infrastructure across various properties.

budgetinfrastructurewatersewerzoning
Metropolitan Courthouse
Tue Jun 11, 2024

Civil Service Commission

Civil Service Commission to approve appointments, terminations, and eligibility registers

The Metropolitan Civil Service Commission will meet to approve routine personnel actions, including appointments, terminations/pensions, and eligibility register reports. The agenda is largely procedural, with no major policy decisions or public hearings listed.

civil-servicepersonnelappointmentsterminationspensionseligibility-register
Tue Jun 11, 2024

Metro Development and Housing Agency Board

MDHA board to vote on HOME grants and Rutledge Hill plan amendment

The Metro Development and Housing Agency Board will consider HOME Investment Partnership Program awards and an amendment to the Rutledge Hill Redevelopment Plan. The board will also review the Public Housing Authority's annual and five-year plan.

housingdevelopmentpublic-housinggrantsredevelopment
Tue Jun 11, 2024

Metro Development and Housing Agency Board

MDHA board holds public hearing on 5-year housing voucher plan

The Metro Development and Housing Agency board is conducting a public hearing on its Five-Year and Annual Plan for Housing Choice Vouchers (Section 8) for the period starting Oct. 1, 2024. The plan focuses on voucher use and is available for public review online. Written and oral comments will be considered before final submission to HUD.

housingpublic-hearingsection-8vouchersmdhahud
Tue Jun 11, 2024

Metro Development and Housing Agency Board

Board to discuss PHA annual and 5-year plan

The Housing and Community Committee will discuss the Public Housing Authority's annual and 5-year plan, with a board decision requested in June. The meeting also includes approval of prior minutes and public comments.

housingpublic-housingplanningcommittee-meeting
Tue Jun 11, 2024

Metro Development and Housing Agency Board

Committee to review budget, Consolidated Plan update, and Rutledge Hill redevelopment

The Finance and Development Committee will hear a presentation on the 2nd quarter budget and financial position, and consider approving the 2024 Annual Update to the Consolidated Plan and an amendment to the Rutledge Hill Redevelopment Plan. Three PILOT agreements (North River, Inspiritus, Trinity Flats) are presented for information only.

budgetconsolidated-planhousingpilot-agreementsredevelopmentrutledge-hill
Tue Jun 11, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup to review data, Built for Zero updates, and VA aging initiative

The Continuum of Care Veterans Workgroup will review minutes from April, discuss data from OHS and MDHA, and receive Built for Zero updates including applying for a System Lead for Nashville. A presentation from a VA geriatric specialist on the Aging and Disabled Initiative is also scheduled.

homelessnessveteransdata-reviewaging-servicescontinuum-of-carenashville
Tue Jun 11, 2024

Metropolitan Council

Council committees to review Nashville's 2024-2025 capital improvements budget

The joint Budget and Finance and Planning and Zoning committees are meeting to consider BL2024-389, an ordinance adopting the Capital Improvements Budget for fiscal years 2024-2025 through 2029-2030. The bill has been approved by both committees and re-referred for further action. Public comment is limited to two minutes per speaker, with a total of eight minutes.

budgetcapital-improvementsfinancezoningpublic-comment
Tue Jun 11, 2024

Fair Commissioners Board

Fairgrounds board sees $585,600 loss through May 2024

The Board of Fair Commissioners is reviewing the Nashville Expo Center at the Fairgrounds financial report for the fiscal year ending June 30, 2024, as of May 31, 2024. The report shows a year-to-date loss of $585,600, with revenues of $3,289,050 and expenses of $3,874,650. This is an improvement over the prior year's loss of $738,442 for the same period. The board is discussing the preliminary financial status, which is not final.

fairgroundsbudgetfinancenashville
Tue Jun 11, 2024

Fire and Building Code Appeals Board

Board to hear three fire code appeals, one withdrawn

The Fire and Building Code Appeals Board will consider three appeals from property owners seeking variances from fire and building code requirements, including a food truck setback and fire alarm exemptions. One appeal regarding a sprinkler system at 1030 18th Avenue South has been withdrawn by the applicant.

fire-codebuilding-codeappealspublic-safetyfood-truckshistoric-preservationnashville
Mon Jun 10, 2024

Traffic and Parking Commission

Commission discusses truck restrictions, bikeway improvements, and valet removals

The Commission will consider several truck size restrictions on Pettus, Preston, and Blue Hole roads. Other items include pedestrian safety enhancements near Dickerson Pike and Demonbreun Hill, as well as the removal of specific valet lanes.

truck-restrictionspedestrian-safetybikewaysvalet-parkingtraffic-safetyzoning
✓ Decided: Commission approves Demonbreun Hill Bikeway improvements and new pay parking zones

The Traffic and Parking Commission approved the Demonbreun Hill Bikeway improvements, including a speed limit reduction, a new pedestrian hybrid beacon, removal of 31 pay parking spaces, and creation of new loading zones and replacement parking. It also approved new pay parking co-located with existing loading or permit zones at several downtown locations, and approved a revised valet fee policy with edits. The commission deferred the Volunteer Valet LLC license application and approved the Giarratana Parking LLC license subject to a fine for operating without a license.

Mon Jun 10, 2024

Continuum of Care Homelessness Planning Council

Committee to review candidates and slate for Homelessness Planning Council elections

The Nominating Committee of the Nashville/Davidson County Continuum of Care will meet to review candidate profile submissions and vote on a candidate slate for the Homelessness Planning Council elections. The meeting includes a public comment period for agenda action items and discussion of next steps.

homelessnesscontinuum-of-careelectionspublic-commentnominating-committee
Mon Jun 10, 2024

Election Commission

Election Commission to approve candidates, compensation, and audit schedule

The Davidson County Election Commission will vote on candidates for Democratic State Executive Committeewoman for Senate District 17, approve compensation for the Administrator of Elections and machine technicians, and schedule meetings to select precincts for audit and plan for the November 5, 2024 general and municipal elections. The agenda also includes public comments, approval of prior minutes, and an Administrator of Elections report.

election-commissionelectionsvotingauditcompensationcandidatesmunicipal-elections
✓ Decided: Commission approves Democratic State Executive Committeewoman candidates

The Davidson County Election Commission unanimously approved Sherry Jones and Brittany Orpurt-Hilton as Democratic State Executive Committeewoman candidates for Senate District 17. They also approved compensation for the Administrator of Elections and machine technicians, subject to Metro Council budget approval. Several meeting dates were set for election-related activities, including an August 1 audit selection meeting and a September 3 meeting for the November 5 general election. No public comments were made.

Thu Jun 6, 2024

Downtown Code Design Review Committee

Nashville DRC reviews 11-story residential and 10-story hotel project on James Robertson Parkway

The Downtown Code Design Review Committee is reviewing a concept plan and major modifications for a mixed-use development at 450-460 James Robertson Parkway. The project includes an 11-story residential building with 261 units and a 10-story hotel with commercial and restaurant space. The committee will consider requests to modify step-back and frontage requirements, and staff recommends approval with conditions.

zoningdesign-reviewmixed-useresidentialhoteldowntown-codenashville
Thu Jun 6, 2024

Zoning Appeals Board

Board to hear 10 zoning appeals including church, parking lot, triplex, and mixed-use projects

The Metropolitan Board of Zoning Appeals will hear 10 cases on June 6, 2024, including requests for special exceptions and variances for a church sanctuary, an offsite parking lot for a religious institution, a triplex, a monument sign, a mixed-use development, a dog kennel, a single-family home, an additional church structure, a day care, and an appeal of a permit. Items were deferred from earlier meetings. The public may attend or submit comments by 4:00 p.m. on March 28, 2024.

zoningvariancesspecial-exceptionsreligious-institutionsmixed-usehousingpublic-hearing
Thu Jun 6, 2024

Human Relations Commission

Human Relations Commission pre-hearing conference on witness list and issues

The Metro Human Relations Commission is holding a pre-hearing conference to review the witness list and simplify issues and interview questions for an upcoming hearing. The agenda is largely procedural, with no substantive decisions or public hearings scheduled.

human-relationshearingprocedural
Thu Jun 6, 2024

Continuum of Care Homelessness Planning Council

Data & HMIS Oversight Committees to vote on adding two new participating agencies

The Nashville/Davidson County Continuum of Care Data & HMIS Oversight Committees will consider approving The Family Center and Empower TN as new HMIS participating agencies. The meeting also includes a Point In Time Count update and committee timeline review.

homelessnessdatahmisoversightpoint-in-time-count
Thu Jun 6, 2024

Behavioral Health and Wellness Advisory Council

Nashville behavioral health council to review mayor's five priority areas and opioid RFP update

The Behavioral Health and Wellness Advisory Council will meet to approve minutes from April, discuss the mayor's five priority areas for behavioral health, and receive an update on the Opioid Care Process RFP. The meeting is scheduled for June 6, 2024, at the Lentz Public Health Center.

behavioral-healthopioidpublic-healthyouthpreventionharm-reduction
Wed Jun 5, 2024

Ethical Conduct Board

Ethics Board hearing postponed over overlap with Title VI case

The Board of Ethical Conduct is considering a motion to continue the June 5, 2024 hearing in the ethics complaint against Metro Arts Commission member Carol L. McCoy. The motion argues the hearing should be delayed until a related Title VI complaint and potential civil litigation are resolved, to avoid prejudicing the respondent and witnesses. The board will decide whether to grant the continuance.

ethicscontinuancearts-commissiontitle-vilegal
✓ Decided: Board denies continuance, schedules two ethics hearings for July 8

The Board denied a motion to continue the hearing in the case of Yousief v. Carol McCoy (Arts Commission), scheduling it for July 8, 2024. It also adopted the Department of Law's recommendation to dismiss three allegations against Council Member Joy Styles but hold a hearing on a fourth allegation regarding disclosure compliance. Both hearings are set for July 8, 2024 at 9:00 a.m.

Wed Jun 5, 2024

Stormwater Management Commission

Stormwater Commission to hear 1400 Gould Blvd buffer disturbance case

The Stormwater Management Commission will consider a case at 1400 Gould Blvd involving disturbance of a Zone 2 stream buffer, stream encapsulation of about 104 feet, and 161 cubic yards of uncompensated fill in the floodplain. The board will also discuss proposed changes to checklist and regulations.

stormwaterzoningfloodplainenvironmentnashville
Wed Jun 5, 2024

Metropolitan Council

Caucus to vote on budget wish list after presentations

The Metropolitan Minority Caucus is meeting to hear presentations from the Rafah Institute and Southern Movement Committee, then discuss and vote on the Caucus' Budget Wish List. The meeting also includes member updates and announcements.

budgetpresentationscaucus
Tue Jun 4, 2024

Metropolitan Council

Committee to vote on Axon contract amendment, Buena Vista Pike zoning, and Arts Commission changes

The Rules, Confirmations, and Public Elections Committee will consider several items including a late-filed resolution approving an amendment to Metro's contract with Axon Enterprise, Inc., a late-filed substitute ordinance imposing building material restrictions on a proposed 46-unit multi-family development at 2840-2842 Buena Vista Pike, and ordinances amending the Arts Commission membership and the Music, Film, & Entertainment Commission selection process. The committee will also vote on numerous board and commission appointments and a proposed change to Council Rule 13 regarding filing deadlines for legislation.

zoningpolicehousingartscontractscommitteesrules
Tue Jun 4, 2024 · 6:30 PM

Metropolitan Council

Council considers FY25 budget, capital improvements, and various appointments

The Metropolitan Council is reviewing the Fiscal Year 2025 Budget Ordinance and a Capital Improvements Budget. The agenda also includes several elections for commission vacancies and various appointments to city authorities.

budgetgovernmentelectionshousinginfrastructureeducation
Metropolitan Courthouse
Tue Jun 4, 2024

Employee Benefit Board

Employee Benefit Board to consider cost-of-living adjustments and MDLive urgent care

The board will vote on minutes from May 7, hear appeals, and review disability and service pensions. They will also discuss cost-of-living adjustments for closed plans and a proposal for MDLIVE urgent care services, along with reports from Blue Cross Blue Shield and CIGNA.

employee-benefitspensionshealth-insurancecost-of-living-adjustmentsnashville
✓ Decided: Board overturns Cigna denial for GLP-1 medication for State Trial Courts employee

The Board approved several disability pension requests, reexaminations, and a return-to-work request, and deferred one new request. It also overturned two Cigna denials for medical treatments, including a GLP-1 medication for a State Trial Courts employee (4-3 vote) and a Gammaplex medication for a Fire Department dependent. Additionally, the Board approved MDLIVE for Urgent Care as a $0 cost share and a 3.5% cost of living adjustment for closed pension plans.

Tue Jun 4, 2024

Parks and Recreation Board

Board to vote on greenway easement amendment for Germantown development

The Parks Board will consider amending a greenway easement for a multi-family development at 2nd Ave N and Van Buren St, approving a consent agenda of park event permits, and accepting grants including up to $1,098,000 from Friends of Warner Parks for park improvements. The board will also vote on salary increases for the Parks Director and a pilot program for expanded service at Riverfront Park.

parksgreenwayeasementgrantseventsdevelopmentnashville
Tue Jun 4, 2024

Metropolitan Council

Committee to vote on new pay plans for Metro employees and a short-term rental exemption

The Government Operations and Regulations Committee is meeting to discuss and vote on several resolutions and one bill. Key items include new pay plans for general Metro employees, police and fire departments, and the Board of Health, all effective July 1, 2024. The committee will also consider a resolution to exempt 62 units at 160 2nd Ave. N. from minimum distance requirements for a short-term rental permit, and a bill to create 23 new city positions across multiple departments.

short-term-rentalspay-planspolicefireboard-of-healthcity-positionsgovernment-operations
Tue Jun 4, 2024

Metropolitan Council

Council committee to vote on Bass Street property deal, library grants, golf course renovation

The Arts, Parks, Libraries & Entertainment Committee will consider four resolutions: approving amendments to agreements for a property at 607 Bass Street, appropriating $20,840 and $64,265 for youth summer programs through the Nashville After Zone Alliance, and approving an amendment to a participation agreement with the Tennessee Golf Foundation for renovating two golf courses in Shelby Park. Public comment is limited to eight minutes total, with two minutes per speaker.

parkslibrariesyouth-programsgolfproperty-acquisitiongrants
Tue Jun 4, 2024

Parks and Recreation Board

Parks Board to vote on greenway easement amendment for Germantown development

The Acquisition Committee will consider a staff request to amend a Greenway Easement Agreement with developers of a multi-family project at 2nd Avenue North and Van Buren Street. The amendment would realign the existing greenway trail and include design, construction, lighting, landscaping, and perpetual maintenance, subject to Metro Parks' approval.

parksgreenwayeasementdevelopmentgermantownnashville
Tue Jun 4, 2024

Metropolitan Council

New pay plans for police, fire, and health department employees

The Public Health and Safety Committee is considering new pay plans for Metro Police, Fire, and Board of Health employees effective July 1, 2024. It will also vote on several contracts and grants, including $140,000 for group violence intervention, a grant for gun violence reduction overtime, and a contract for fire training materials. Other items include a sole-source contract for educational assessment software and multiple health-related grants.

policefirehealthgrantsviolence-preventionpay-planscontracts
Mon Jun 3, 2024

Human Relations Commission

Human Relations Commission to discuss Metro Arts complaint and FY25 budget

The Metro Human Relations Commission will review a complaint against Metro Arts, including a conciliation and public hearing update, and receive a FY25 budget update. The meeting also covers new commissioner orientation, community engagement, and the Community Covenant partnership for the Juneteenth Music City Freedom Festival.

human-relationsbudgetcomplaintscommunity-engagementjuneteenth
✓ Decided: Commission approves prior minutes; sets Metro Arts hearing for 07/17/2024

The Metro Human Relations Commission approved the previous meeting's minutes with one edit. A public hearing date for a Metro Arts complaint was set for 07/17/2024, with a witness list meeting scheduled for 06/06/2024. No official complaint has been received regarding MNPD/OPA. The meeting was otherwise procedural, with no substantive decisions on budget or new business.

Mon Jun 3, 2024

Equalization Board

Nashville Equalization Board to organize, set 2024 appeal schedule

The Metropolitan Board of Equalization is meeting to handle routine organizational matters, including approving minutes, electing a chair and vice chair, and scheduling 2024 property tax appeals. The board will also review its policies and procedures and receive training from Metro Legal. This is primarily a procedural meeting with no specific property appeals or decisions listed on the agenda.

property-taxboard-of-equalizationappealsadministrationnashville
Mon Jun 3, 2024

Bicycle and Pedestrian Advisory Commission

BPAC to discuss officer elections, Bike Friendly Community status, and meeting procedures.

The Bicycle and Pedestrian Advisory Committee (BPAC) will hold a regular meeting on June 3, 2024, to elect a Chair, Vice Chair, and Secretary; discuss the city's Bike Friendly Community status and application; and review bylaws, procedures, and meeting scheduling. Public comments are invited.

bicyclepedestrianadvisory-committeebike-friendly-communitybylawspublic-comment
✓ Decided: BPAC holds unofficial meeting, discusses Bike Friendly Community application

The Bicycle and Pedestrian Advisory Commission met unofficially on June 3, 2024, with only three members present. They discussed the Bike Friendly Community application, which must be reviewed by the next meeting on June 17, 2024, and began discussions on bylaws and meeting schedules. No formal decisions were made.

Mon Jun 3, 2024

Continuum of Care Homelessness Planning Council

Equity committee plans racial disparities research and funding application scoring

The Equity & Diversity Committee of Nashville's Continuum of Care will discuss next steps for racial disparities research, update a racial equity resources webpage, and prepare to score the equity section of the CoC funding application. They will also plan a racial equity training and identify a new meeting location and chair by August.

homelessnessracial-equityfundingtrainingnashville
✓ Decided: Committee approves updated racial equity resources page

The Equity & Diversity Committee approved updated content for the Racial Equity Resources Page, with an amendment removing a specific phrase. They also discussed potential research topics on racial disparities in homelessness, including domestic violence, LGBTQ+ status, foster youth, and incarceration, and agreed to explore data collection changes. The committee will begin scoring equity questions in CoC funding applications this year.

Mon Jun 3, 2024

Metropolitan Council

Council considers FY2025 budget and new employee pay plans

The Budget and Finance Committee will hold a public hearing on the FY2025 operating budget and the 2024-2030 Capital Improvements Budget. It will also consider new pay plans for general employees, police/fire, and health department staff, effective July 1, 2024. The agenda includes numerous consent items for grants, settlements, and contracts.

budgetpay-planspolicefiregrants
Mon Jun 3, 2024

Metropolitan Council

Council committee to review contracts, grants, and sewer/water agreements

The Transportation and Infrastructure Committee is meeting to discuss and vote on several resolutions and ordinances, including contracts for traffic control devices and parts, an intergovernmental agreement with TDOT, a grant application for pedestrian safety improvements, and multiple agreements for water meter reading and sewer infrastructure. The agenda also includes ordinances to create a stormwater district and to accept or abandon public utility infrastructure for various developments.

transportationinfrastructurecontractsgrantsstormwatersewerwater
Mon Jun 3, 2024

Metropolitan Council

Planning & Zoning Committee to review capital budget, airport lease, and housing fund reallocations

The Planning and Zoning Committee will hold a public hearing on the 2024-2030 Capital Improvements Budget and consider resolutions and ordinances on second reading. Items include a lease amendment for John C. Tune Airport hangar development, reallocation of housing funds to the Strobel Center and Barnes Fund, and acceptance of new sewer and water infrastructure for several subdivisions.

planning-and-zoningcapital-budgetairporthousinginfrastructuretraffic-safetylease
Mon Jun 3, 2024

Historical Commission

Historical Commission marker committee to review three proposed historical markers

The Marker Committee will discuss language for three proposed historical markers: John Wesley Frierson, LSI Studios, and Neuhoff House. The committee selects wording only; no public comment is allowed at this meeting. The full Historical Commission will vote on the markers on June 17.

historical-markerspublic-commemorationcommittee-meeting
Thu May 30, 2024

Arts Commission

Arts Commission to discuss FY25 Thrive program changes and grant rebranding

The Metro Arts Commission's Grants and Funding Committee will meet to discuss updates on FY24 grant payments, a rebranding of the FY25 operating grant, and changes to the Thrive program, including removing it from delegated procurement and restructuring its application. The meeting is open to public comment, with a 20-minute total limit and 2 minutes per speaker.

artsgrantsfundingthrive-programrebranding
Thu May 30, 2024

Hospital Authority Board

Nashville hospital board to vote on $679K Oracle contract, $411K equipment upgrade

The Metropolitan Hospital Authority Board will vote on several contracts and capital expenditures, including a $679,558.68 Oracle health consulting extension, a $411,270.52 telemetry system upgrade, and a $25,000 settlement of a claim against an estate. The board will also discuss hospital utilization and marketing, and receive reports from the NGH Foundation and medical staff.

hospitalcontractscapital expendituresettlementbudget
Thu May 30, 2024

Hospital Authority Board

Hospital Authority Finance Committee reviews budget and capital expenditure requests

The Finance Committee is reviewing the FY2025 budget update, the FY2023 audit, and March 2024 financial statements. The board will also consider several contract and capital expenditure requests for facility services, pharmacy projects, telemetry upgrades, and health consulting.

hospitalbudgetcontractshealthcarefinance
Thu May 30, 2024

Metro Action

Metro Action Commission to review FY23 audit and grants

The Metropolitan Action Commission is holding a special called meeting to approve the March 28, 2024 minutes, receive the executive director's report, and take action on the FY23 single audit, grants/contracts/MOUs, and job description changes. Program reports will be presented. The agenda is largely routine, with no major policy decisions listed.

auditgrantscontractspersonnelmeeting-minutes
Wed May 29, 2024

Hospital Authority Board

Hospital board to set CEO performance goals for FY24 and FY25

The CEO Performance Evaluation Committee of the Metropolitan Hospital Authority Board will meet to approve CEO performance goals for the current fiscal year (FY24) and the upcoming fiscal year (FY25). The meeting also includes public comment, approval of prior minutes, and conflict-of-interest disclosures.

hospital-authorityceo-performancegovernancepublic-comment
Wed May 29, 2024

Employee Benefit Board

Employee Benefit Board to hear four health plan appeals

The Medical and Life Committee of the Metropolitan Employee Benefit Board will meet to consider four appeals related to self-insured Cigna health plans. The appeals involve dependents or employees from the Fire Department, State Trial Courts, MNPD, and the Sheriff's Office. The meeting also includes a public comment period.

employee-benefitshealth-insuranceappealspublic-comment
✓ Decided: Committee deadlocks on PANDAS treatment appeal; sends to board without recommendation

The Medical & Life Committee heard five insurance appeals. It upheld denials for two GLP-1 medication appeals and one neurostimulator procedure, overturned one GLP-1 denial, and deadlocked on a PANDAS treatment appeal, which will go to the full board without a recommendation.

Wed May 29, 2024

Convention Center Authority

Convention Center Authority to discuss CEO evaluation and 2024 goals

The Music City Center Authority will meet to approve minutes and discuss the President & CEO's 2023 evaluation and 2024 goals. A public comment period is scheduled.

convention-centerboard-meetingpersonnelpublic-comment
Tue May 28, 2024

Community Review Board

Community Review Board discusses OPA complaint and MOU

The Community Review Board is holding a special called meeting to discuss an OPA complaint and a Memorandum of Understanding (MOU). The agenda includes board discussion on these items and a period for public comment.

community-review-boardopa-complaintmoupublic-comment
✓ Decided: CRB asks mayor to reassign OPA complaint investigation

The Community Review Board voted unanimously to ask Mayor O'Connell to review a complaint against MNPD officers and assign someone outside OPA to investigate it. The board also unanimously adopted the latest MOU draft and will proceed with negotiations with MNPD. No other substantive decisions were made.

Tue May 28, 2024

Housing Trust Fund Commission

HTF Commission to vote on FY24 surplus, grant amendments, Round 14 materials

The Metropolitan Housing Trust Fund Commission will vote on appropriating FY24 surplus funds, approving grant contract amendments for several projects, and adopting materials for Funding Round 14. They will also discuss updates on ARPA funds, the FY25 budget, and a transition. Public comment is allowed at the start of the meeting.

housingaffordable-housingbarnes-fundgrantsbudgetarpa
✓ Decided: Commission approves $300K for Clark UMC and Round 13 awards

The commission voted unanimously to allocate $300,000 to Clark UMC CDC and the remaining FY24 surplus funds to Round 13 grant awards. It also approved three grant contract amendments (Project Return, Urban Housing Solutions, Affordable Housing Solutions) and declined a request from Urban Housing Solutions to change its Round 8 project. The commission approved the Round 14 grant policy and timeline, which targets housing for homeless and deeply affordable units.

Fri May 24, 2024

Arts Commission

Arts Commission CARE Committee reviews antiracism guidelines and goals

The Committee for Antiracism and Equity (CARE) is meeting to review its guidelines and scope, revisit goals, discuss onboarding, and plan future meetings. The meeting includes public comment, approval of prior minutes, and staff updates. No binding votes or financial decisions are on the agenda.

artsantiracismequitycommission-meetingnashville
Fri May 24, 2024

Arts Commission

Arts Commission to discuss director's employment status at special meeting

The Metro Arts Board of Commissioners is holding a special called meeting to discuss the employment status of Director Singh and receive an update from the Interim Executive Director. The agenda includes public comment, staff updates, and a quorum update, but no specific votes or proposals are listed.

artscommissionemploymentpublic-comment
Thu May 23, 2024

Nashville Entertainment Commission

Budget Committee to review and discuss budget proposals

The Nashville Entertainment Commission Budget Committee is meeting to review and discuss budget proposals as action items. The agenda includes public comment, approval of prior minutes, and unfinished business, with the main focus on the budget proposals.

budgetentertainmentcommissionnashville
✓ Decided: Entertainment Commission approves amended lean budget with new admin position

The MFEC Budget Committee approved an amended lean budget that adds an Administrative Coordinator position at $67,000 and adjusts other expense lines. The amended budget will be presented to the full commission for ratification.

Thu May 23, 2024

Nashville Entertainment Commission

Commission to review public comment policy and discuss budget

The Nashville Music, Film, and Entertainment Commission is meeting to review and discuss its public comment policy, approve prior meeting minutes, and hear reports from committees including the Budget Committee and Ad Hoc Job Description Committee. The agenda includes action items on the budget and job description, as well as updates on open seats and possible amendments to original legislation. The meeting is largely procedural, with no major funding or zoning decisions listed.

entertainment-commissionpublic-commentbudgetcommittee-reportsmeeting-minutes
✓ Decided: Commission ratifies $250K budget, creates executive committee

The Nashville Music, Film, and Entertainment Commission ratified a proposed $250,000 budget to present to the city council, approved a draft executive director job description pending HR review, and created an executive committee. The next meeting was moved to July 10, 2024.

Thu May 23, 2024

Planning Commission

Planning Commission to vote on 90-home subdivision at McCrory Lane

The Planning Commission will consider a community plan amendment and rezoning for a 90-home subdivision on McCrory Lane in Bellevue, along with several other rezoning and subdivision requests. Most items are recommended for deferral to future meetings, while a few are on the tentative consent agenda for approval.

zoningsubdivisionhousingcommunity-plan-amendmentbellevuemurfreesboro-pikemccrory-lane
✓ Decided: Planning Commission approves 90-home development at McCrory Lane

The commission approved a rezoning and specific plan for 90 single-family homes at 7848 McCrory Lane, along with a related community plan amendment, and approved several other rezoning and subdivision requests. It also approved a final plat for 86 lots at Percy Cove and a rezoning for multi-family housing on Maxwell Road. Numerous items were deferred to future meetings.

Thu May 23, 2024

Continuum of Care Homelessness Planning Council

CoC Executive Committee discusses charter revisions, nominations, and strategic plan

The Executive Committee of the Continuum of Care Homelessness Planning Council will review April minutes, discuss updates to the CoC Charter, nominations for the Homeless Planning Council (including quorum concerns and transition timeline), set a July meeting date for officer elections, and outline next steps for the strategic plan, including committee updates and strategies for addressing racial disparities. They will also receive updates on FY2024 funding applications, HUD technical assistance, and encampment closures.

homelessnesscontinuum-of-careexecutive-committeestrategic-planracial-equityfundingencampments
Thu May 23, 2024

Investment Committee

Investment Committee to review Q1 2024 pension performance and consider recommendations

The Investment Committee of the Metropolitan Employee Benefit System will meet to review first-quarter 2024 pension performance, consider investment recommendations, and receive a litigation update on Credit Suisse contingent convertible bonds. The agenda also includes a treasurer's update, approval of prior meeting minutes, and distribution of 457b reports.

pensioninvestmentsemployee-benefitslitigationquarterly-review
✓ Decided: Investment Committee approves $85M in new commitments

The Investment Committee approved three new investment commitments totaling up to $85 million: an additional $25 million to Arcmont European Lending SMA, up to $30 million to Anchorage Credit Opportunities Fund IX, and up to $30 million to AGC Sound Mark RECIF (contingent on Sound Mark raising $70 million by 12/31/2024). The committee also approved amendments to the PIMCO PREO Limited Partnership Agreement and PPM, including term extension, concentration limits, and a hard leverage cap. Minutes from the March 20 meeting were approved unanimously.

Thu May 23, 2024

Metro Action

Metro Action Commission meeting cancelled

This meeting of the Metropolitan Action Commission Board of Commissioners was cancelled. No decisions or discussions took place.

cancelledmetropolitan-action-commissionnashville
Wed May 22, 2024

Short Term Rental Appeals Board

STR board denies 3 appeals, grants 2 for re-establishing rental permits

The Short Term Rental Appeal Board heard five appeals from property owners seeking to re-establish their ability to legally operate short-term rental properties. The board denied appeals for properties at 1116 11th Ave N, 314 Hancock St, and 914 28th Ave N, and granted appeals for properties at 2104 Buchanan St and 3200 Knobview Dr.

short-term-rentalsappealszoningpublic-hearingnashville
Wed May 22, 2024

Beer Permit Board

Metro Beer Board reviews permit applications and administrative violations

The Board will review several beer permit applications for approval or indefinite deferral due to missing documents. Additionally, the meeting includes administrative hearings regarding alleged violations of sale laws and privilege tax requirements.

beer permitsalcohol regulationbusiness licensingadministrative hearings
Wed May 22, 2024

Hospital Authority Board

Bylaws committee to review and edit hospital authority bylaws

The Hospital Authority Board's Bylaws Ad Hoc Committee will meet to review and propose edits to the current MNHA Bylaws. The meeting includes public comment and disclosure of conflicts of interest. No other substantive business is scheduled.

hospital-authoritybylawsnashville
Wed May 22, 2024

Continuum of Care Homelessness Planning Council

Homelessness Planning Council Consumer Advisory Board meets for introductions and self-care discussion

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is holding a draft-agenda meeting on May 22, 2024, from 9:30 to 11:00 AM at The Contributor (154 Rep. John Lewis Way N, Nashville). The agenda includes a welcome, a CAB overview, introductions, a session on 'The Art of Self Care and Healing,' and next steps before adjournment. No votes, dollar amounts, or specific policy decisions are listed; the meeting appears focused on onboarding and member support.

homelessnessconsumer-advisory-boardcontinuum-of-carenashvillemeeting
Wed May 22, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review permits and licenses for three periods

The board will hold a public comment period, approve April minutes, and review new and renewal entertainer permits and business licenses for three date ranges from April 11 to May 22, 2024. An inspector's report is also on the agenda.

sexually-oriented-businesslicensingpermitspublic-commentminutes-approval
Tue May 21, 2024

Metropolitan Council

Council committee to vote on resolution opposing guns for school staff

The Rules, Confirmations, and Public Elections Committee will consider several resolutions, including one supporting MNPS's decision to prohibit teachers and staff from carrying firearms on campus. The committee will also vote on appointments to various boards and commissions, and review amendments to two contracts for water and sewerage services.

school-safetyfirearmscommissionsappointmentscontractsartswater
Tue May 21, 2024

Metropolitan Council

Council committee reviews downtown Cumberland River safety and housing study request

The Arts, Parks, Library & Entertainment Committee is meeting to discuss several resolutions and bills, including a request for a comprehensive analysis of safety, security, housing, and cleanliness around the Cumberland River downtown, grant contracts for cultural events and park improvements, and changes to arts and entertainment commission membership. The agenda also includes a presentation from the Nashville Music, Film, and Entertainment Commission. Public comment is limited to eight minutes total, with two minutes per speaker.

artsparkslibrariesentertainmenthousingpublic-safetygrantsspecial-events
Tue May 21, 2024

Bicycle and Pedestrian Advisory Commission

Transit referendum briefing and BPAC officer appointments on agenda

The Nashville Bicycle and Pedestrian Advisory Committee will hold a regular meeting including a briefing on the upcoming transit referendum, review of the BPAC ordinance, and discussion of Bike Friendly Community status. The committee will also appoint its chair, co-chair, and secretary, and discuss bylaws and meeting scheduling.

bicyclepedestriantransitbike-friendly-communityordinanceappointments
✓ Decided: BPAC defers appointments, hears transit referendum briefing

The Bicycle and Pedestrian Advisory Commission met on May 21, 2024, and deferred BPAC position appointments until all members are confirmed. The commission received a briefing on the Choose How You Move transit referendum, which includes sidewalk upgrades, traffic signal updates, and transit improvements. No formal decisions were made; the Bike Friendly Community application presentation was deferred, and members will review bylaws and meeting schedules for the next meeting.

Tue May 21, 2024

Nashville Health and Well-being Leadership Council

Council to elect officers, review health assessment and CHIP progress

The Nashville Health & Well-being Leadership Council is meeting to conduct routine organizational business, including officer elections, setting the 2024 meeting schedule, and reviewing guiding documents. They will also receive updates on the 2024 Community Health Needs Assessment, progress on the 2023-2025 Community Health Improvement Plan, and the TDH CARES grant. The agenda is largely procedural, with no specific policy decisions or public hearings listed.

healthcommunity-healthcouncil-meetingelectionsgrants
✓ Decided: Council approves vice chair election, new meeting schedule, June retreat

The Nashville Health & Well-being Leadership Council held its inaugural meeting and approved several organizational decisions. Members voted to elect a vice chair, with the nomination process to be developed by staff. They also approved a new meeting schedule: virtual meetings on the third Tuesday of each month from 1-2pm, with quarterly in-person meetings extended to 1-3pm. The June meeting was repurposed as a retreat, moved to June 11, to focus on by-laws, mission, and vision. No substantive policy decisions were made; actions were procedural and organizational.

Tue May 21, 2024

Mechanical, Plumbing, and Electrical Examiners and Appeals Board

Board hears appeal for unisex toilets at 913 Dickerson Pike

The Mechanical, Plumbing, and Electrical Examiners and Appeals Board will hold a public meeting to consider an appeal case, approve minutes, and handle routine registrations, examinations, and permits. The main item is an appeal by James Carroll for a property at 913 Dickerson Pike, requesting a variance to allow unisex toilet rooms with shared lavatories, contrary to code requirements for separate sex facilities. The board will also receive annual ethics training from Metro Legal.

appealsplumbingbuilding-codesethics-trainingpermits
Tue May 21, 2024

Human Relations Commission

Human Relations Commission holds pre-hearing preparation meeting

The Commission is conducting a pre-hearing conference and preparation with staff. An executive session is scheduled to follow the main meeting.

government-administrationpublic-hearings
Tue May 21, 2024

Employee Benefit Board

Employee Benefit Board discusses PPO transition to Cigna and health plan changes

The Metropolitan Employee Benefit Board is holding a study session to discuss several health plan topics, including the transition of the PPO plan to Cigna, hearing aid coverage, MDLive for urgent care, and GLP-1 receptor agonists for pre-diabetes. No votes or decisions are scheduled; the agenda is limited to discussion items.

employee-benefitshealth-insurancecignahearing-aidsurgent-careglp-1pre-diabetes
Tue May 21, 2024

Farmers Market Board

Farmers Market Board to consider new Market House tenant

The Nashville Farmers' Market Board will meet to discuss and possibly recommend a new tenant for the Market House. The agenda also includes public comments, approval of previous meeting minutes, and reports from the executive director and market staff on programs, marketing, facilities, and finance.

farmers marketpublic meetingtenant selectionmarket housenashville
✓ Decided: Farmers Market Board approves Lustful Bath sublease for market house vacancy

The Nashville Farmers' Market Board approved a sublease agreement for Lustful Bath to occupy the current vacancy in the market house. The board also approved the April 16, 2024 meeting minutes. No other formal votes were taken; the meeting included reports from staff on operations, finances, and marketing.

Tue May 21, 2024

Metropolitan Council

Committee to vote on $500K for homeless housing, security study, grants

The Public Health and Safety Committee is discussing and voting on several resolutions and one bill. Key items include a $500,000 appropriation to DePaul USA for supportive housing services, a resolution requesting a safety and housing analysis for the Cumberland River area, and acceptance of grants for emergency management and family safety services. A bill to designate a downtown special event zone for July 4th is also on the agenda.

public-health-and-safetyhomeless-serviceshousinggrantsemergency-managementdomestic-violencespecial-event
Tue May 21, 2024

Public Library Board

Library Board to vote on Special Collections book donation form

The Nashville Public Library Board will consider a resolution to adopt a Special Collections Book Donation Form. The agenda also includes routine items: call to order, public comments, approval of April minutes, and reports from the interim director, foundation, and staff on facilities and courtyard updates.

libraryboard-meetingdonationspublic-commentminutes
Tue May 21, 2024

Metropolitan Council

Council committee weighs STR exemptions and middle housing fire code changes

The Government Operations and Regulations Committee is meeting to consider five resolutions exempting specific properties from distance requirements for short-term rental and beer permits, and one bill on second reading that would streamline fireproofing rules for middle housing. The committee will take action on these items, which were referred to it.

short-term-rentalszoninghousingfire-codepermits
Mon May 20, 2024

Historical Commission

Historical Commission to vote on three new historical markers

The Metro Historical Commission will vote on proposed historical markers for John Wesley Frierson, the Grassmere property, and the US Colored Troops at Peach Orchard Hill. The meeting also includes approval of April minutes, a presentation on the Jefferson Street Historical Society, and reports from the director and historic zoning staff.

historical-commissionhistorical-markersnashvillepublic-hearingzoning
✓ Decided: Commission approves two historical markers, tables Frierson marker

The Metropolitan Historical Commission approved revised text for the Grassmere and US Colored Troops at Peach Orchard Hill historical markers, and tabled the John Wesley Frierson marker for further revision. The commission also heard a presentation from the Jefferson Street Historical Society and received updates on zoning and preservation efforts.

Mon May 20, 2024

Metropolitan Council

Committee to vote on downtown congestion relief grant and Cumberland River safety study

The Transportation and Infrastructure Committee will consider a resolution requesting a comprehensive analysis of safety, security, housing, and cleanliness improvements along the Cumberland River within the downtown interstate loop. They will also vote on applying for a federal Congestion Relief Program grant to fund adaptive signals and transportation demand management in downtown Nashville. Other items include interlocal agreements for traffic signals, sole-source contracts, and numerous water/sewer infrastructure approvals.

transportationinfrastructurepublic-safetyhousingflood-insurancewater-sewercontractsdowntown-nashville
Mon May 20, 2024

Community Review Board

Community Review Board to discuss MNPD misconduct report and lawsuit

The Community Review Board will hold its monthly meeting, including discussion of an update on the Policy Advisory Report regarding MNPD sexual misconduct and trauma-informed victim services, as well as updates on a lawsuit involving the Board of Commissioners (COB), bylaws, and a memorandum of understanding (MOU). Public comment is permitted on agenda items.

community-review-boardpolice-oversightsexual-misconductpolicy-reportlawsuitbylawsmemorandum-of-understanding
✓ Decided: CRB moves forward with MOU despite mayor, chief unavailability

The Community Review Board approved the April 22, 2024 minutes and received updates on the MOU, budget, complaints, and community outreach. The board decided to proceed with finalizing the MOU agreement while awaiting a meeting with Mayor O'Connell and Chief Drake. No substantive policy decisions were made; the meeting was largely informational and procedural.

Mon May 20, 2024

Metropolitan Council

Council committee to vote on $149M tax anticipation notes, $31.8M reserve fund spending

The Budget and Finance Committee is considering resolutions authorizing up to $149 million in tax anticipation notes and appropriating $31.8 million from the General Fund Reserve for equipment and building repairs. Other items include funding for a new Antioch elementary school, homeless services, and various grants and contracts. The committee will also hear a presentation on a tax incentive and abatement study.

budgetfinancetax-anticipation-notesreserve-fundschoolshomeless-servicestransportationgrants
Mon May 20, 2024

Metropolitan Council

Committee to vote on new Antioch elementary school land purchase

The Planning and Zoning Committee is considering resolutions to authorize property purchases for a new elementary school in Antioch and to amend a lease for office space at 350 Deaderick Street. Several bills on second and third reading involve zoning changes, street renaming, and infrastructure improvements for stormwater, sewer, and water systems across Nashville.

zoningschoolsflood-insuranceinfrastructureleasesstormwatersewer
Fri May 17, 2024

Continuum of Care Homelessness Planning Council

Homelessness council reviews national frameworks, plans May 22 meeting

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is holding a special planning meeting. The agenda includes reviewing NAEH frameworks and materials, and planning for the May 22nd meeting. No votes or decisions are listed; the meeting appears to be procedural and preparatory.

homelessnessplanningconsumer-advisory-boardcontinuum-of-carenashville
Fri May 17, 2024

Community Review Board

MOU Committee to discuss MNPD agreement

The Community Review Board's MOU Committee is meeting to discuss the Memorandum of Understanding with the Metropolitan Nashville Police Department. The agenda includes a call to order, quorum establishment, discussion of the MNPD MOU, public comment, and adjournment.

community-review-boardpolice-oversightmounashville
Thu May 16, 2024

Arts Commission

Arts Commission to discuss FY2025 budget and director's status

The Metro Arts Board of Commissioners will review the Fiscal Year 2024 overview and the Fiscal Year 2025 budget request, along with updates on Director Singh's employment status and an interim director. The meeting also includes public comment, approval of minutes, and committee reports on grants, anti-racism, and equity.

artsbudgetfy2025director-statusequitygrantspublic-comment
Thu May 16, 2024

District Energy System Advisory Board

District Energy Board to review FY24 budget, contractor performance, and capital projects

The Metro Nashville District Energy System Advisory Board will meet to discuss customer sales, contractor performance, natural gas purchasing, and FY24 costs to date. The board will also review capital projects and receive a system operator update.

district-energybudgetcontractor-performancecapital-projectsnatural-gas
Thu May 16, 2024

Transportation Licensing Commission

TLC proposes rule changes for scooter and bike permits, parking, and age verification

The Transportation Licensing Commission is considering amendments to shared urban mobility device (SUMD) regulations, including changes to the permit application process, parking restrictions, age verification requirements, and fleet composition rules. The proposed rules would require an RFP process for new permits, prohibit sidewalk parking in certain downtown zones, mandate age verification for riders, and set fleet ratios for e-bikes to scooters.

transportationscootersbikespermitsparkingage-verificationequitable-access
✓ Decided: TLC approves new SUMD rules, renews contracts, and grants permits

The Transportation Licensing Commission approved multiple rule changes for shared urban mobility devices (SUMDs), including requiring a competitive RFP process for new permits, prohibiting sidewalk parking in certain zones, and mandating age verification. They renewed SUMD contracts for one year. The commission also approved additional permits for horse-drawn carriages, pedicabs, and taxicabs, and set the optimal number of entertainment transportation permits at 35-70.

Thu May 16, 2024

Continuum of Care Homelessness Planning Council

CoC Governance Charter Committee meets to review public comment and plan next steps

The Continuum of Care Governance Charter Committee is meeting to review public comment submissions and discuss next steps for the committee's work. The agenda includes welcome, introductions, and planning for future meetings. No specific decisions or proposals are listed for this session.

homelessnessgovernancepublic-commentcommittee-meeting
Thu May 16, 2024

Zoning Appeals Board

Board to decide on 13 variance and special exception requests

The Metropolitan Board of Zoning Appeals will hear 13 cases, including requests for variances in setback, height, and buffer requirements, as well as special exceptions for uses like an adult daycare and an indoor batting facility. Several items were deferred from previous meetings. The board will vote on each application after public comment.

zoningvariancesspecial-exceptionsnashvilleboard-of-zoning-appealsland-usepublic-hearing
Wed May 15, 2024

COVID-19 Financial Oversight Committee

COVID-19 oversight committee to review contract amendments and fund reallocations

The COVID-19 Financial Oversight Committee is meeting to discuss contract amendments with several organizations, including Fisk University and the Urban League of Middle Tennessee, and a reallocation of existing funds for the Planning Department. The agenda also includes reporting updates. Public comment is limited to eight minutes total, with each speaker allowed up to two minutes.

covid-19oversightcontractsfundingpublic-comment
Wed May 15, 2024

Continuum of Care Homelessness Planning Council

CoC committee to review FY2024 renewal applications and scoring equity

The Performance Evaluation Committee will discuss the FY2024 CoC competition, including a draft renewal application and trainings for applicants. They will also review monitoring visits for funded programs and strategies to improve system performance measures.

homelessnesscocfundingperformanceequity
✓ Decided: CoC committee updates application process, adds Housing First rubric

The Performance Evaluation Committee discussed the FY 2024 CoC competition, agreeing to use an adapted Equity Scoring Rubric and requesting a new Housing First Rubric. The committee also reviewed agency spotlights from Oasis Center and MDHA, and noted the collaborative applicant transfer to OHS is pending HUD approval. No formal votes were taken; decisions were procedural and preparatory.

Wed May 15, 2024

Historic Zoning Commission

Historic Zoning Commission reviews 20+ permits for additions, outbuildings, and infill

The Metro Historic Zoning Commission will consider over 20 applications for new construction, additions, outbuildings, and alterations in historic overlays across Nashville. Items include a partial demolition at 2223 30th Ave S, a new addition at 429 Broadway, and several consent-agenda permits. The meeting also includes adoption of April minutes and a leadership recognition presentation.

historic-zoningpermitsadditionsdemolitionbroadwayneighborhood-conservationpublic-hearing
✓ Decided: Commission approves 14 consent items, denies two Broadway proposals

The Metro Historic Zoning Commission approved all consent agenda projects with conditions, denied signage at 107 4th Ave N and infill at 201-205 Broadway, and approved several individual projects with conditions. The meeting also included a leadership recognition presentation and agenda revisions.

Wed May 15, 2024

Community Review Board

Community Review Board executive committee to discuss rules, MOU, lawsuit

The Community Review Board's Executive Committee is meeting to discuss several administrative and oversight topics, including its rules and bylaws, a memorandum of understanding, a board retreat, a lawsuit involving the Community Oversight Board, a sexual misconduct report, and the executive director's performance evaluation. The meeting includes a public comment period.

community-review-boardexecutive-committeebylawsmoulawsuitsexual-misconductperformance-evaluation
Tue May 14, 2024 · 10:00 AM

Metropolitan Council

Mayor Freddie O'Connell to deliver the State of Metro Address

The Metropolitan Council meeting includes a presentation of the State of Metro Address by Mayor Freddie O'Connell. The agenda also features various ceremonial presentations and invocations.

governmentstate-of-the-citynashville
The Fairgrounds Nashville
Tue May 14, 2024

Metro Development and Housing Agency Board

MDHA board to vote on raising PILOT cap, Park Point East financing

The Metro Development and Housing Agency Board will consider increasing the Payment in Lieu of Taxes (PILOT) cap and approving debt and equity closing for Park Point East. The board will also review an agency safety and health plan and approve prior meeting minutes.

housingdevelopmentfinancepilotssafety
Tue May 14, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup to discuss continuing as CoC committee, review data, and set inflow/outflow goals

The Continuum of Care Veterans Workgroup will meet to review April minutes, discuss remaining a CoC committee, review data from OHS and MDHA, and receive Built for Zero updates including goals to increase housing placements from 13 to 24 per month and decrease inflow from 46 to 23 per month. Sub-strategies include addressing racial disparities, using housing first principles, improving communication, and implementing BNL improvements. The group will also consider applying for a System Lead for Nashville and hold a VASH Process Mapping Exercise on June 4th.

homelessnessveteranshousingdataracial-equitycontinuum-of-care
Tue May 14, 2024

Civil Service Commission

Civil Service Commission to approve dozens of appointments, terminations, and pensions

The Civil Service Commission will vote on a large batch of personnel actions including appointments, terminations, and pensions across multiple Metro departments. The agenda also includes approval of previous meeting minutes, acknowledgment of union representatives, and public comment on pending hearings.

civil-servicepersonnelappointmentsterminationspensionspublic-hearing
Tue May 14, 2024

Fire and Building Code Appeals Board

Board hears appeals on sprinkler, facade, and accessibility code variances

The Fire and Building Code Appeals Board will hear six appeal cases seeking relief from various building code requirements, including sprinkler systems, front-facade orientation, and accessible routes. One case (sprinkler at 1030 18th Ave S) has been deferred to June. The meeting also includes a public comment period and approval of prior minutes.

building-codefire-codeappealsaccessibilityzoningsprinklersnashville
✓ Decided: Board denies three appeals, defers two, approves temp chairman

The Fire and Building Code Appeals Board denied three appeals regarding sprinkler requirements, accessible route exceptions, and building area limits, and deferred two appeals about single-family home front facade orientation. The board also approved Christopher Dunn as temporary chairman. All decisions were made with recorded votes.

Tue May 14, 2024

Civil Service Commission

Public hearing on proposed revisions to Civil Service Rule 4.21

The Civil Service Commission will hold a public hearing on proposed revisions to Civil Service Rule 4.21, which concerns the Election Day Poll Worker Volunteer Program. The hearing will follow the commission's regular meeting at 8:30 a.m. on May 14, 2024. Interested persons may address the commission in person at the Sonny West Conference Room, 700 Second Ave S., Nashville, TN.

civil-serviceelectionspublic-hearingrules
Mon May 13, 2024

Historical Commission

Historical Commission marker committee to review three proposed historical markers

The Marker Committee of the Metro Nashville Historical Commission will meet to select language for three proposed historical markers. No public comment will be taken at this meeting; the full commission will decide on adoption on May 20, 2024, with public comment available then.

historical-markershistorical-commissionpublic-hearingnashville
Mon May 13, 2024

Metropolitan Council

Metropolitan Minority Caucus to discuss budget wish list and presentations

The Metropolitan Minority Caucus is holding a regular meeting to approve minutes, hear the treasurer's report, and discuss old and new business. Key items include a budget wish list and presentations from the General Sessions Court/Community Court, Rafah Institute, and Southern Movement Committee/Black Nashville Assembly. The meeting is open to public comment.

minority-caucusbudgetcourtscommunity-organizationsboards-and-commissions
Mon May 13, 2024

Traffic and Parking Commission

Traffic & Parking Commission to vote on new signals, stops, and parking changes

The Metro Traffic & Parking Commission will consider several traffic safety and parking items, including new traffic signals at Ellington Parkway & Douglas Avenue, all-way stops at Anderson Road & Kinwood Drive and Clay Street & 9th Avenue North, and a speed limit reduction on Preston Road. The commission will also vote on parking changes, such as new pay parking zones, a valet fee policy, and a mobile food truck vending ordinance. A Vision Zero update will be presented for information only.

traffic-signalsall-way-stopsspeed-limitsparkingfood-trucksvision-zerovalet-policy
✓ Decided: Commission approves consent agenda with traffic, parking changes

The Traffic and Parking Commission approved the consent agenda and several regular agenda items, including new traffic signals, all-way stops, speed limit reductions, and parking changes. The Valet Fee Policy was deferred for one month for clarification. The meeting was procedural with no major controversies.

Thu May 9, 2024

Metro Development and Housing Agency Board

Board to vote on Park Point East financing and HOME awards

The Finance and Development Committee will hear a presentation on 2nd Avenue updates and consider approving debt and equity closing for Park Point East, with a board decision requested in May. The committee will also vote on HOME Investment Partnership Program awards, with a board decision requested in June. A PILOT for 4th & Shelby is presented for information only.

housingfinancedevelopmentaffordable-housingpublic-housing
Thu May 9, 2024

Tourism and Convention Commission

Tourism commission meets; agenda is procedural only

The Metro Tourism and Convention Commission is meeting on May 9, 2024, but the agenda contains only parking and location details with no listed business items. This appears to be a procedural meeting with no decisions or discussions specified.

tourismcommissionprocedural
Thu May 9, 2024

Planning Commission

Planning Commission to vote on 22 items, most deferred to later meetings

The Planning Commission will consider 22 items, including community plan amendments, rezonings, and specific plan approvals. Most items are recommended for deferral to future meetings, with only a few set for tentative consent or direct action. Key decisions include a community plan amendment for Bordeaux-Whites Creek-Haynes Trinity and several rezoning requests for multi-family and mixed-use developments.

planning-commissionzoningrezoningmulti-family-housingcommunity-plan-amendmentspecific-plannashville
✓ Decided: Planning Commission approves Fern Ave short-term rental rezoning

The Planning Commission approved a rezoning to allow two short-term rental properties at 15 A-C Fern Avenue, despite policy conflicts, citing the area's existing STRP prevalence. It also approved several other items, including a PUD revision for a warehouse on Hickory Hills Boulevard and a Music Row hotel height modification. Many other applications were deferred to future meetings.

🏢 Building at this address: 16 m tall
Thu May 9, 2024

Transportation Licensing Commission

TLC proposes rule changes for ETV alcohol service and rush-hour routes

The Transportation Licensing Commission is discussing proposed amendments to Entertainment Transportation Vehicle (ETV) rules at a special-called meeting. Changes include updating alcohol service rules to reference state and local compliance, and maintaining rush-hour operating restrictions in downtown Nashville.

transportationlicensingalcoholetvrulesnashville
✓ Decided: TLC approves new rules for entertainment transportation vehicles

The Transportation Licensing Commission approved three rule changes for entertainment transportation vehicles (ETVs), all by 4-0 votes. The rules address alcohol service compliance, operating boundaries near sensitive locations, and rush-hour route restrictions. No other substantive decisions were made.

Thu May 9, 2024

Beer Permit Board

Beer Board to vote on 40+ permits and 10+ complaints

The Metro Beer Permit Board will consider 40 applications for new, transferred, or expanded beer permits, plus 10 complaints alleging underage sales and other violations. Staff recommends civil penalties ranging from $500 to $2,000 for the complaints. The board will also hear an administrative update on a new ID compliance check component.

beer-permitsalcohol-regulationpublic-hearingcomplaintsunderage-salesspecial-eventsnashville
Thu May 9, 2024

Metro Development and Housing Agency Board

MDHA board to discuss Housing Choice Voucher updates and 5-year plan

The Metro Development and Housing Agency Housing and Community Committee will receive a presentation on Housing Choice Voucher updates and discuss the PHA Annual and 5-year Plan, with a board decision requested in June. The meeting also includes approval of prior minutes and public comments.

housingpublic-housingvouchersplanning
Thu May 9, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals; most are off track

The Nashville-Davidson County Continuum of Care Shelter Committee meets to review metrics and current goals. Most goals, including revising the encampment plan, decreasing document barriers, increasing affordable housing capacity, and increasing voucher utilization, are reported as off track. The committee also hears agency announcements and discusses a family sheltering crisis.

homelessnessshelterhousingmetricsnashville
Thu May 9, 2024

Health Board

Health board reports to mayor on Nashville's public health status

The Board of Health is receiving a detailed report on the Metro Public Health Department's activities across five health priority areas. The report covers indicators such as infant mortality, low birth weight, tobacco use, drug overdoses, and immunization rates, along with accomplishments and opportunities for improvement.

public-healthinfant-mortalitydrug-overdosesanimal-controlimmunizationshealth-equityboard-of-health
Thu May 9, 2024

Metropolitan Council

Charter Revision Committee to review proposed charter amendment resolution

The Metro Council Charter Revision Committee is meeting to review a prepared Charter Amendment Resolution and discuss any edits. The committee plans to meet again on June 13, 2024, to review the final resolution. The agenda includes public comment and procedural items.

charter-revisionmetropolitan-councilpublic-commentcommittee-meeting
Wed May 8, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission to review public comment policy and budget

The Nashville Music, Film, and Entertainment Commission is meeting to discuss and potentially act on its public comment policy, approve prior meeting minutes, and receive reports from committees including the Budget Committee and Ad Hoc Job Description Committee. The agenda also includes welcoming a new commissioner and updates on open seats and possible amendments to original legislation.

entertainmentpublic-commentbudgetcommittee-reportscommission
Wed May 8, 2024

Sexually Oriented Business Licensing Board (Inactive)

Nashville sexually oriented business board to review permits and licenses

The Metropolitan Sexually Oriented Business Licensing Board is meeting to handle routine licensing matters, including public comment, approval of previous meeting minutes, and review of new and renewed entertainer permits and business licenses for two periods in April and May 2024. The agenda is procedural with no major policy decisions listed.

licensingpermitssexually-oriented-businessnashvilleboard-meeting
Wed May 8, 2024

Procurement Standards Board

Procurement Standards Board hears report from outgoing purchasing agent

The board will hear a report from the outgoing purchasing agent and be introduced to the new purchasing agent. The meeting also includes public comment and approval of previous minutes.

procurementpersonnelpublic-comment
✓ Decided: Procurement board approves prior minutes, welcomes new purchasing agent

The Procurement Standards Board approved the previous meeting's minutes unanimously. The board received reports on hiring, office relocation, and a protest hearing, and introduced Dennis Rowland as the new Purchasing Agent. No substantive policy decisions were made.

Wed May 8, 2024

Industrial Development Board

Industrial Development Board to hear Urban League housing presentation

The Industrial Development Board's Ad Hoc Committee will hold a public comment period, approve prior meeting minutes, and receive a presentation from the Urban League of Middle TN on housing and economic development. No binding votes or financial decisions are scheduled.

industrial-development-boardpublic-commenthousingeconomic-developmenturban-league
✓ Decided: Ad Hoc Committee approves prior meeting minutes

The Ad Hoc Committee of the Industrial Development Board met on May 8, 2024, and approved the minutes from the September 13, 2023 and March 13, 2024 meetings. No public comments were made, and no substantive decisions were taken beyond the approval of minutes. The next meeting was scheduled for June or July.

Wed May 8, 2024

Continuum of Care Homelessness Planning Council

Homelessness council reviews data showing racial disparities in housing exits

The Homelessness Planning Council reviewed system performance measures and a data report showing that only 22% of single adults exit to permanent housing compared to 74% of families, and that Black people make up 53% of those experiencing homelessness despite being 27% of the population. The council also heard updates on OHS budget priorities, encampment strategy, and the transfer of CoC grant administration from MDHA to OHS. No votes or formal decisions were taken at this meeting.

homelessnesshousingdataracial-disparitiesbudgetcontinuum-of-carenashville
Wed May 8, 2024

Metropolitan Council

Metro Arts Commission discussion and questionnaire edits on agenda

The Rules, Confirmations, & Public Elections Committee will discuss the Metro Arts Commission with Chair Leah D. Love and consider edits to the Metro Boards and Commissions Questionnaire. No votes on legislation or funding are scheduled.

artsboards-and-commissionscommittee-meetingnashville
Wed May 8, 2024

Industrial Development Board

Industrial Development Board to approve annual Metro incentive grant payouts

The Industrial Development Board will vote on annual Metro incentive grant payouts for Philips and Alliance Bernstein, and consider final authorizing bond resolutions for the Tennessee State University Student Housing Project. The board will also receive an update on previous revenue bonds for Cumberland Heights Foundation at 8283 River Road Pike.

industrial-development-boardincentive-grantsbondsstudent-housingnashville
✓ Decided: Industrial Development Board approves $806,500 in incentive grants

The Board approved annual Metro incentive grant payouts of $293,000 to Phillips Holding and $513,500 to Alliance Bernstein, both to be processed after July 1. It also approved a final authorizing bond resolution for the TSU student housing project (NDIC TSU Project 1 LLC) with a vote of 3 yes, 2 no, and 1 abstention. The meeting minutes from March 13, 2024, were amended and approved.

Wed May 8, 2024

Nashville Entertainment Commission

Budget Committee to review and discuss budget proposals

The Nashville Entertainment Commission Budget Committee will meet to review and discuss budget proposals, with possible action items. The agenda includes call to order, public comment, approval of prior minutes, unfinished business, and new business.

budgetentertainmentcommissionnashville
Tue May 7, 2024 · 6:30 PM

Metropolitan Council

Council discusses appointments, rule amendments, and zoning changes

The Metropolitan Council is considering various board appointments and several proposed amendments to its Rules of Procedure. Additionally, the body will hold public hearings on multiple short-term rental exemptions and a large multi-family residential and fire station project.

zoninggovernmentappointmentshousingrules
Metropolitan Courthouse
Tue May 7, 2024

Community Review Board

MOU Committee to discuss MNPD agreement

The Community Review Board's MOU Committee is meeting to discuss the Memorandum of Understanding with the Metropolitan Nashville Police Department. The agenda includes a call to order, quorum establishment, discussion of the MNPD MOU, public comment, and adjournment.

community-review-boardpolice-oversightmoupublic-comment
Tue May 7, 2024

Employee Benefit Board

Employee Benefit Board to consider injury-on-duty pension for Sheriff's Office employee

The board will vote on a reconsideration for an injury-on-duty pension from the Sheriff's Office, review clinic incentive programs for Metro Nashville Public Schools and the Hospital Authority, and discuss a healthcare flexible spending account. The meeting also includes approval of prior minutes and reports on benefit utilization.

employee-benefitspensionspublic-employeeshealthcarenashville
✓ Decided: Board approves disability pensions, raises FSA limit to $3,200

The Employee Benefit Board approved six new disability pension requests, continued two reexaminations, deferred three reexaminations, and approved one return to work. The Board also approved an amendment to increase the Healthcare Flexible Spending Account (FSA) annual maximum contribution to $3,200 for 2025, with automatic annual adjustments to match the IRS prior-year limit. A request to reconsider a previously denied injury-on-duty pension was voted on, but the denial was upheld.

Tue May 7, 2024

Work Release Commission

Work Release Commission approves six inmates for work release

The Work Release Commission Board reviewed and approved six inmates for work release. No applications were denied or continued. The meeting also included discussion of past approvals and continued employment.

work-releaseinmatescorrectionsboard-meeting
✓ Decided: Work Release Commission approves six inmate applications

The Work Release Commission met on May 7, 2024, and approved six work release applications. No applications were denied or continued. The board also reviewed candidate histories, institutional behavior, and treatment program participation.

Tue May 7, 2024

Metropolitan Council

Committee to vote on 10 beer/STR permit exemptions and floodplain fence rules

The Government Operations and Regulations Committee will consider 10 resolutions exempting specific properties from minimum-distance requirements for beer permits or short-term rental permits, plus a resolution requesting notice of any changes to the Colemere building at 1400 Murfreesboro Pike. A bill on second reading would restrict fences in floodways and floodplains and require a fence permit citywide.

zoningshort-term-rentalsbeer-permitsfloodplainfenceshistoric-preservationairport
Tue May 7, 2024

Metropolitan Council

Council committee to vote on notaries, board appointments, and rule changes

The Rules, Confirmations, and Public Elections Committee is meeting to consider several resolutions, including the approval of notaries public, a request for notice before altering the Colemere building at 1400 Murfreesboro Pike, and multiple honorary recognitions. The committee will also vote on a bill requiring board and commission members to submit annual disclosures, and consider appointments to various boards and commissions. Additionally, three proposed amendments to the Council's Rules of Procedure are on the agenda.

notarieshistoric-preservationboard-appointmentspublic-commentrules-of-proceduredisclosures
Tue May 7, 2024

Metropolitan Council

Library contracts, youth programming funds, and farmers' market sponsorship rules on committee agenda

The Arts, Parks, Library & Entertainment Committee will consider seven resolutions and one ordinance. Resolutions include sole-source contracts with OverDrive and Rosen Publishing for digital library services, cooperative purchasing agreements for promotional items and technology, and appropriations totaling $90,169.40 for youth summer programs. A second-reading bill would authorize the farmers' market board to adopt sponsorship rules.

librariesyouth-programscontractsfarmers-marketparkstechnologypublic-spending
Tue May 7, 2024

Metropolitan Council

Council committee to vote on juvenile detention contract and homeless funding

The Public Health and Safety Committee will hear a presentation on the REACH Pilot and vote on multiple resolutions, including a contract for juvenile detention facility management, several grant acceptances, and appropriations for homeless services. The agenda is mostly routine approvals, with notable funding for homelessness and a new police analytics contract.

public-healthpublic-safetyhomelessnesspolicejuvenile-detentiongrantscontracts
Tue May 7, 2024

Human Relations Commission

Human Relations Commission holds pre-hearing conference and executive session

The Metro Human Relations Commission is meeting for a pre-hearing conference to prepare for upcoming hearings with staff, followed by an executive session. The agenda is largely procedural, with no specific cases or decisions listed for public discussion.

human-relationscommissionpre-hearingexecutive-session
Tue May 7, 2024

Arts Commission

Arts Commission Budget Committee discusses FY25 budget and legal/finance update.

The Budget and Administrative Oversight Committee of the Nashville Arts Commission will meet to discuss the FY25 budget, including a legal and finance update. The meeting includes a public comment period for residents to speak on agenda items.

artsbudgetpublic-comment
Tue May 7, 2024

Parks and Recreation Board

Board to vote on $5M grant for inclusive playground at Cedar Hill Park

The Parks Board will consider a $5 million Blue Cross Blue Shield Healthy Places grant to build a Miracle League field and inclusive playground at Cedar Hill Park, with no matching funds required. Other items include accepting donations, approving grants for Warner Parks, and amending a greenway easement for a development near Germantown. The board will also affirm Shan Foster as a new member and hear annual updates from revenue facilities and park friends groups.

parksgrantsplaygroundgreenwaydonationsboard-appointments
Mon May 6, 2024

Metropolitan Council

Committee to vote on road repairs, BNA water main abandonment, and $75K donation

The Transportation and Infrastructure Committee will consider 24 items, including resolutions to approve intergovernmental agreements for resurfacing Tulip Grove Road, Coopertown Road, and Burkitt Road, accept a $75,000 donation for infrastructure at Whites Creek Pike and Briley Parkway, and authorize water main abandonment at BNA Concourse D Expansion. Bills on second reading include restricting fences in floodways, renaming a street to Donelson Station Boulevard, and approving utility easements. The meeting also includes public comment and a chair's report.

transportationinfrastructureroadsfloodplainpublic-works
Mon May 6, 2024

Human Relations Commission

Human Relations Commission to discuss executive director salary increase

The Metro Human Relations Commission is meeting to discuss several new business items, including an executive director salary increase, conciliation process updates, bylaws edits, and community engagement. The agenda also includes routine items such as call to order, public comments, approval of minutes, and a financial update.

human-relationscommissionsalarybylawscommunity-engagement
Mon May 6, 2024

Continuum of Care Homelessness Planning Council

Racial equity data review and training planning for homeless services

The Equity & Diversity Committee of Nashville's Continuum of Care will review racial disparities in homelessness data, discuss updating a racial equity resources webpage, and plan a racial equity training. The meeting includes the reading of the CoC's anti-racism pledge and administrative tasks such as finding a new meeting location and selecting a new chair or co-chair.

homelessnessracial-equitydata-reviewtrainingcommittee-meeting
Mon May 6, 2024

Metropolitan Council

Budget committee to vote on $1.5M for homeless services, juvenile detention contract

The Budget and Finance Committee will consider 41 items, including contracts for juvenile detention operations, $1.5 million for homeless services, and multiple road resurfacing projects. The committee also reviews settlements for personal injury claims totaling $213,000 and several library and public safety grants.

budgethomeless-servicesjuvenile-detentionroad-repairspublic-safetylibrarysettlements
Mon May 6, 2024

Metropolitan Council

Planning & Zoning Committee reviews road repairs, affordable housing, and encroachments

The Planning and Zoning Committee is considering 18 items, including resolutions for road resurfacing on Tulip Grove, Coopertown, and Burkitt roads, a public hearing for the Rutledge Hill Redevelopment Plan amendment, and an affordable housing grant contract amendment. Bills on second reading include street renaming, utility easements, and sewer infrastructure changes.

planning-and-zoningroadsaffordable-housingencroachmentssewerstreet-renamingpublic-hearing
Fri May 3, 2024

Election Commission

Election Commission to finalize ballot, poll workers, and early voting for Aug. 1 election

The Davidson County Election Commission will vote on the candidate list, poll officials, and early voting schedule for the August 1, 2024 election. They will also schedule procedures for counting provisional and absentee ballots and certifying the results.

election-commissionelectionsvotingearly-votingballotpoll-workers
✓ Decided: Election Commission approves August 1 ballot and early voting plan

The Davidson County Election Commission unanimously approved the candidate list, poll officials, and early voting schedule for the August 1, 2024 election. They also set dates for locking security bags, counting absentee and provisional ballots, and certifying the election. All motions passed unanimously.

Thu May 2, 2024

Election Commission

Election Commission to vote on two petition signature challenges

The Davidson County Election Commission will consider and vote on two petition signature challenges at its May 2 meeting. One challenge involves Laura Nelson vs. Justin Jones, and the other involves Bo Mitchell vs. Jennifer Frensley Webb. The meeting also includes public comments and approval of prior minutes.

electionspetition-challengespublic-commentdavidson-county
✓ Decided: Election commission upholds Justin Jones' petition signatures

The Davidson County Election Commission voted to accept 25 signatures validated by staff on Representative Justin Jones' nominating petition, dismissing a challenge by Laura Nelson. The commission also ruled on multiple signature challenges in the Bo Mitchell vs. Jennifer Frensley Webb contest, accepting some signatures and excluding others. All decisions were made with recorded vote tallies.

Thu May 2, 2024

Downtown Code Design Review Committee

Committee to review concept plan for 11-story residential and 10-story hotel on James Robertson Parkway

The Downtown Code Design Review Committee will hold a public hearing and consider a concept plan for a mixed-use development at 450 & 460 James Robertson Parkway, including an 11-story residential building and a 10-story hotel. The applicant requests modifications to stoop frontage and step-back requirements. The committee will also review adjustments to digital signage at Nashville Yards Parcel 9 and discuss design guidelines.

downtown-codedesign-reviewzoningdevelopmentsignagepublic-hearing
Thu May 2, 2024

Convention Center Authority

Convention Center Authority to vote on FY2025 budget, security and landscaping contracts

The board will consider the Music City Center's proposed $XX million operating and capital budget for fiscal year 2025, along with contract renewals for event security and operable walls, and a new landscaping services RFP. They will also vote on a public safety memorandum of understanding with Metro government.

budgetpublic-safetycontractslandscapingdowntown-partnershipconvention-center
Thu May 2, 2024

Zoning Appeals Board

Zoning board to hear 10 appeals including Islamic Center parking lot and Church St mixed-use project

The Metropolitan Board of Zoning Appeals will hold a public hearing on May 2, 2024, to decide on 10 requests for variances, special exceptions, and appeals. Notable cases include a special exception for an offsite parking lot for the Islamic Center of Nashville, a triplex construction appeal, a senior housing community with multiple variances, and a large mixed-use development near Church Street and Broadway. The board will also consider several residential variances for porches, roof decks, and additions.

zoningvariancesspecial-exceptionspublic-hearingmixed-usehousingreligious-institution
Thu May 2, 2024

Metropolitan Council

Charter Revision Committee to finalize charter amendment submissions

The Metro Council Charter Revision Committee is meeting to review and finalize charter amendment submissions. The committee may meet again on May 9 if there are additional amendments to review.

charter revisioncouncilnashvillegovernment
Thu May 2, 2024

Continuum of Care Homelessness Planning Council

CoC Executive Committee to review priorities, charter, and encampment updates

The Executive Committee of the Nashville Continuum of Care Homelessness Planning Council is meeting to review minutes, follow up on the CoC Priorities Report, discuss charter revisions, strategic plan next steps, nominations, HUD technical assistance updates, and encampment closures. The agenda is primarily administrative and planning-focused, with no specific votes or dollar amounts listed.

homelessnesscontinuum-of-careplanningequityencampmentscharter
Wed May 1, 2024

Human Relations Commission

Human Relations Commission holds pre-hearing conference

This meeting is procedural only. The commission will hold a pre-hearing conference to prepare for upcoming cases. No votes or decisions are scheduled.

human-relationspre-hearingprocedural
Wed May 1, 2024

Property Standards and Appeals Board

Board to decide on repair vs. demolition for Leland Ave property

The Board of Property Standards and Appeals will hold a public hearing and decide on a request to repair a structure at 1119 B Leland Ave that is currently under a demolition order. The agenda includes only this one substantive item along with routine procedural matters.

property-standardsappealsdemolitionrepairleland-avenashville
Wed May 1, 2024

Stormwater Management Commission

Stormwater Commission to hear four floodplain disturbance cases

The Stormwater Management Commission will hear four cases involving floodway and stream buffer disturbances for projects including Gay Street Park, Nashville Zoo bridge expansion, a pump station, and the Opry Mills Greenway Connector. The board will also discuss ethics training, meeting dates, and proposed regulatory changes.

stormwaterfloodplaingreenwayzooparkspublic-hearingnashville
Wed May 1, 2024

Metropolitan Council

FY2025 operating budget introduced and presented to Metro Council committee

The Budget & Finance Committee receives the Fiscal Year 2025 Operating Budget from Mayor Freddie O’Connell, followed by a presentation from Finance Director Kevin Crumbo and Budget Officer Aaron Pratt. A brief Q&A is scheduled, but no vote or decision is listed on this agenda.

budgetfinanceoperating-budgetfy2025metropolitan-council
Tue Apr 30, 2024

Continuum of Care Homelessness Planning Council

CoC Summer Kickoff to review 2023 metrics and 2024 HUD application

The Continuum of Care Homelessness Planning Council is holding a Summer Kickoff Event to review 2023 system performance metrics and HUD application scores, and to discuss the 2024 Collaborative Application. A special guest speaker from Houston's Coalition for the Homeless will present. Nashville's strategic plan for homelessness will also be discussed.

homelessnesscontinuum-of-carehudperformance-metricsstrategic-plancollaborative-application
Tue Apr 30, 2024

Metropolitan Council

Women's Caucus discusses preliminary budget wish list

The Metro Council Women's Caucus is meeting to discuss preliminary budget wish list items. Presentations will be given by Ericka Burnett of The Village and two school board members who chair and vice-chair the MNPS Budget Committee.

budgetschoolswomencouncil-caucus
Mon Apr 29, 2024

Ethical Conduct Board

Board to decide on ethics hearing for former arts commissioner Will Cheek

The Board of Ethical Conduct will consider a Department of Law report recommending a public hearing on one allegation against former Arts Commission member Will Cheek — that his outside relationships with arts organizations may have improperly influenced his votes on funding. The report recommends dismissing other claims, including alleged Open Meetings Act violations and conflicts of interest over pro bono legal work. The board is not bound by the recommendation and will decide whether to hold a hearing.

ethicsboard-of-ethical-conductarts-commissionconflict-of-interestnashville
✓ Decided: Board finds no ethics violation in Yousief v. Cheek complaint

The Board voted 4-1 to find no violation of Metro Code Section 2.222.020(o) in the complaint by Lydia Yousief against Will Cheek. It also adopted a Department of Law recommendation to dismiss allegations under Section 2.222.020(j) and hold a hearing on allegations under Section 2.222.020(k) in the amended complaint against Carol McCoy, scheduling that hearing for June 5, 2024.

Mon Apr 29, 2024

Health Board

Ad Hoc Committee finalizes recommendations to Mayor O’Connell

The Board of Health Ad Hoc Committee will continue reviewing and finalizing recommendations to Mayor Freddie O’Connell. The meeting includes time for public comment on agenda items. No specific recommendations or reports are detailed in the agenda.

board-of-healthpublic-healthmayorrecommendationspublic-comment
Thu Apr 25, 2024

Hospital Authority Board

Finance Committee to vote on $1M+ in contracts, including Space Labs telemetry upgrade

The Finance Committee will consider approving several contracts and capital expenditure requests, including a $1.05M Space Labs telemetry system upgrade and two Oracle America service contracts totaling over $537,000. They will also receive updates on the FY2025 budget and FY2023 audit, and vote on February 2024 financial statements.

hospital-authorityfinancecontractsbudgetaudittelemetryoracle
Thu Apr 25, 2024

Hospital Authority Board

Board to vote on $1.1M in contracts for water, telemetry, and Oracle consulting

The Hospital Authority Board will consider four contracts totaling over $1.1 million, including a $98,860 water management deal with NALCO, a $1.05 million telemetry system upgrade with Space Labs, and two Oracle consulting agreements worth $57,500 and $479,800. The board will also review the FY25 budget, an audit report, and medical staff credentials. Public comment is limited to agenda items scheduled for approval.

hospital-authoritycontractsbudgettelemetrywater-managementoracleaudit
Thu Apr 25, 2024

Convention Center Authority

Convention Center Authority reviews FY2025 budgets and public safety MOU

The Finance & Audit Committee will consider the Music City Center's operating and capital budgets for Fiscal Year 2025, along with a memorandum of understanding for public safety with the Metropolitan Government and an MOU with the Nashville Downtown Partnership. The meeting includes a public comment period with limited slots and advance registration required.

budgetpublic-safetyconvention-centerfinancenashville
Thu Apr 25, 2024

Metropolitan Council

Charter Revision Committee reviews amendment proposals

The Metro Council Charter Revision Committee is meeting to review submitted charter amendment proposals and begin narrowing them down. The committee will also decide whether to schedule a follow-up meeting on May 2, 2024. Public comment is included on the agenda.

chartercouncilmeetingpublic-comment
Thu Apr 25, 2024

Planning Commission

Nashville seeks $99,750 state grant for East Bank environmental study

The Planning Commission is reviewing a grant application to the Tennessee Department of Environment and Conservation (TDEC) for $99,750 to fund an environmental investigation of the East Bank Park and Greenway area. The study would assess contamination on parcels near Nissan Stadium and the Cumberland River, supporting the Imagine East Bank redevelopment plan adopted in October 2022.

planning-commissiongrantseast-bankenvironmental-cleanupparksbrownfieldscumberland-river
✓ Decided: Planning Commission approves FY2024-25 Capital Improvements Budget

The Planning Commission approved the FY2024-25 Capital Improvements Budget, which includes requests for 1,029 projects costing $21.8 billion, and will be submitted to the Mayor. The Commission also approved several rezoning requests, including a change to allow a mixed-use development at Rock Harbor Marina, and deferred a proposal that would have required mailed notice for certain zoning text amendments. Multiple subdivision plats and concept plans were approved or deferred as recommended by staff.

🏢 Building at this address: 5 m tall
Thu Apr 25, 2024

Arts Commission

Arts Commission to discuss executive director's leave and interim appointment

The Metro Arts Board of Commissioners is holding a special called meeting to discuss the status of the Executive Director's Family and Medical Leave Act (FMLA) and to consider appointing an interim director. The meeting includes public comment and routine procedural items.

artscommissionpersonnelpublic-comment
Wed Apr 24, 2024

Short Term Rental Appeals Board

STR Appeals Board hears 8 appeals of zoning administrator decisions

The Nashville Short-Term Rental Appeals Board will hear eight appeals from property owners seeking to re-establish their ability to legally operate short-term rental properties. Each appellant alleges the zoning administrator erred in decisions regarding primary residence, prior operation, or mandatory prohibitions. The board will decide whether to uphold or overturn the administrator's rulings.

short-term-rentalsappeals-boardzoningpermitsnashville
Wed Apr 24, 2024

Beer Permit Board

Beer Board reviews 17 permit applications, 11 deferred for missing documents

The Metro Beer Permit Board will consider 17 beer permit applications, including new locations, ownership changes, and special events, and will hold an administrative hearing for an alleged underage sale violation. Eleven applications are listed under 'Defer Indefinitely' due to missing documents, meaning they will not be acted on until paperwork is completed. The board will also approve minutes and hear public comment.

beer-permitsalcohollicensingadministrative-hearingpublic-safety
Wed Apr 24, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board to review permits and licenses

The Metropolitan Sexually Oriented Business Licensing Board is meeting to handle routine licensing matters, including new and renewal entertainer permits and business licenses, as well as an inspector's report. The agenda is largely procedural, with no major policy decisions or public hearings listed.

licensingpermitssexually-oriented-businesspublic-commentminutes
Wed Apr 24, 2024

Community Review Board

Community Review Board Rules & Bylaws Committee to discuss internal rules

The Community Review Board's Rules & Bylaws Committee is meeting to discuss the board's rules and bylaws. The agenda includes a call to order, establishing a quorum, discussion of the rules and bylaws, and a public comment period.

community-review-boardrules-and-bylawspublic-commentnashville
Wed Apr 24, 2024

Hospital Authority Board

Hospital board committee to review and edit bylaws

The Bylaws Ad Hoc Committee of the Hospital Authority Board of Trustees will meet to review and edit the current MNHA Bylaws. The meeting includes a call to order, conflict of interest disclosures, public comment, and approval of prior minutes.

hospitalbylawsgovernance
Wed Apr 24, 2024

Continuum of Care Homelessness Planning Council

Consumer Advisory Board to set bylaws and goals for homeless services

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board will discuss naming the board, a framework for engaging people with lived experience, bylaws and structure, and goal setting. The meeting includes an antiracism pledge and focuses on organizational setup.

homelessnessconsumer-advisory-boardbylawslived-experienceantiracismnashville
Tue Apr 23, 2024

Metropolitan Council

Council hears presentation on Choose How You Move transit plan

The Transportation & Infrastructure Committee is receiving a presentation from the Mayor's Office on the Choose How You Move initiative, which covers sidewalks, signals, service, and safety. The presentation includes an overview of the timeline, process, and major components, followed by feedback and questions. No votes or decisions are scheduled.

transportationinfrastructuresidewalkssignalssafetytransit
Tue Apr 23, 2024

Metropolitan Council

Metro Council Executive Committee meets for procedural updates only.

The agenda contains only a call to order, council office updates, and adjournment. No substantive legislation, votes, or public hearings are listed.

proceduralexecutive-committeenashville
Tue Apr 23, 2024

Solid Waste Region Board

Solid Waste Board to review 2023 annual report and 2024 master plan update

The Davidson County Solid Waste Region Board is meeting to review and take action on the 2023 Annual Progress Report required by the 1991 Solid Waste Management Act, and to review updates to the Zero Waste Master Plan for 2024. The agenda also includes approval of minutes from the March 20, 2023 meeting, new board member introductions, and a legal update. Public comment is scheduled for both major items.

solid-wastezero-wasteannual-reportmaster-planpublic-comment
✓ Decided: Board approves 2023 Annual Progress Report and Zero Waste Master Plan updates

The Davidson County Solid Waste Regional Board approved the 2023 Annual Progress Report and two of three Zero Waste Master Plan updates, deferring the environmental justice section for further discussion. The board also learned that a court ruled in its favor on WM's expansion litigation, closing the case.

Tue Apr 23, 2024

Housing Trust Fund Commission

Housing Trust Fund Commission to vote on grant extensions, surplus funds, and ARPA reallocation

The Metropolitan Housing Trust Fund Commission will review financial reports, vote on contract extensions for two grantees, discuss Round 14 grant policy, and decide on using FY24 surplus and reallocating ARPA funds for Round 13 projects. They will also vote on Round 12 contracts and consider amendments to existing grants.

housinggrantsaffordable-housingbudgetarpacontracts
Mon Apr 22, 2024

Health Board

Health Board committee to finalize recommendations for mayor's report

The Board of Health Ad Hoc Committee is meeting to elect a chair, take public comment, and review and finalize recommendations to the Board regarding a report to Mayor O'Connell. The agenda is otherwise procedural, with no specific policy items listed.

healthboard-of-healthcommitteepublic-commentmayor-report
Mon Apr 22, 2024

Civil Service Commission

Civil Service Commission to review FY2025 pay plan and job descriptions

The Metropolitan Civil Service Commission will hold a special called meeting to consider the Fiscal Year 2025 Pay Plan Review and job descriptions for the upcoming pay plan. The Human Resources Director is submitting these items for the Commission's consideration and appropriate action.

civil-servicepay-planhuman-resourcesbudget
Mon Apr 22, 2024

Election Commission

Election Commission to set rules for signature challenge hearing

The Davidson County Election Commission will consider a protocol for handling signature challenges and review a state guidance document on verifying petition signatures. The meeting also includes setting a timeline for evidence and witness submissions ahead of a challenge hearing scheduled for May 2.

election-commissionsignature-challengepetitionspublic-hearing
✓ Decided: Election Commission adopts rules for candidate signature challenges

The Davidson County Election Commission unanimously approved standard rules of order and an affidavit form for candidate signature challenges, and added a state guidance document on verifying petition signatures to the official record. The commission also scheduled a challenge hearing for May 2, 2024, at 6:00 p.m. No other substantive decisions were made.

Mon Apr 22, 2024

Continuum of Care Homelessness Planning Council

HMIS committee to vote on adding three new homeless service agencies

The Data & HMIS Oversight Committees of Nashville's Continuum of Care will meet to review minutes, hear public comment, and take action on adding three new HMIS participating agencies: Community House 33, Building Lives Foundation, and Dismas House. They will also discuss the CoC Funding Priorities Report and strategic plan priorities.

homelessnessHMISdataoversightfundingstrategic-planningnashville
Mon Apr 22, 2024

Community Review Board

Police oversight board to discuss misconduct policy and complaints

The Community Review Board will hear remarks from Mayor Freddie O'Connell, discuss an update on a policy report about MNPD sexual misconduct and trauma-informed victim services, and review citizen complaints. The board also plans to discuss a meeting update with the mayor and police chief, and a memorandum of understanding.

police-oversightsexual-misconductvictim-servicespublic-commentmemorandum-of-understanding
✓ Decided: CRB discusses MOU with MNPD, approves March minutes

The Community Review Board met on April 22, 2024, and approved the minutes from the March 25, 2024 meeting. The board discussed the ongoing Memorandum of Understanding (MOU) with the Metro Nashville Police Department, with Mayor O'Connell expressing support. The executive director reported on hiring for three vacancies, office relocation plans, and community engagement events. No formal votes were taken on substantive policy decisions.

Fri Apr 19, 2024

Metro Action

Executive Committee to review Head Start policies and service plans

The Metro Action Commission's Executive Committee is meeting to discuss and potentially approve multiple Head Start program policies and service plans covering human resources, facilities, nutrition, and transportation. No specific dollar amounts or action items are listed; the agenda consists entirely of procedural review items.

head-starthuman-resourcesfacilitiesnutritiontransportationexecutive-committeenashville
✓ Decided: Metro Action Commission executive committee meets, no decisions recorded

The executive committee of the Metropolitan Action Commission convened on April 19, 2024, but the minutes list only agenda items and no recorded votes or decisions. The meeting was procedural, covering Head Start policies and service plans.

Thu Apr 18, 2024

Sports Authority Board

Sports Authority to consider stadium construction rep and naming rights

The Sports Authority Board will vote on several resolutions, including hiring Cumming Management Group as construction representative for the new enclosed NFL stadium and approving a second amended agreement with the Nashville Downtown Partnership. They will also consider naming certain areas of the soccer stadium and receive progress reports on the new stadium and GEODIS Park.

sports-authoritystadiumconstructionnaming-rightscontractsnashville
Thu Apr 18, 2024

Transportation Licensing Commission

TLC to vote on towing, SUMD contracts, and disciplinary cases

The Transportation Licensing Commission will consider several items including a continued review of an ordinance on booting services, a request to approve contract assignments for Bird and Spin shared mobility devices, and Metro Legal guidance on entertainment vehicles. The agenda also includes disciplinary hearings on towing complaints and multiple consent items for new and updated passenger vehicle licenses.

transportationlicensingtowingride-hailingscootersentertainment-vehiclesdisciplinary-hearings
✓ Decided: Commission approves Bird/Spin contract assignments, defers booting ordinance

The Transportation Licensing Commission approved the assignment of shared urban mobility device contracts from Bird to Blue Jay Transit USFM LLC and from Spin to Pheenix USH LLC, and deferred a proposed booting ordinance amendment to June 2024. It also denied a request to reconsider sanctions against Nashville Booting, LLC, and approved disciplinary actions against Apex Parking Enforcement for operating without a license. Several applications for wrecker and passenger vehicle permits were approved, while some driver applications were denied.

Thu Apr 18, 2024

Continuum of Care Homelessness Planning Council

CoC to review governance charter revisions and $50M ARP funding

The Continuum of Care Homelessness Planning Council is meeting to discuss revisions to its governance charter, which is open for public comment until April 26th. The council will also receive updates on committees, system performance measures, and the Metro $50 million American Rescue Plan Act funding. Nominations for the Homelessness Planning Council are being considered.

homelessnessgovernancepublic-commentarp-fundingcommittee-updatesnashville
Thu Apr 18, 2024

Emergency Communication District (E-911) Board

E-911 Board to review FY 2025 budget and vote on street name change

The Davidson County Emergency Communication District Board will review the proposed FY 2025 budget and the March 2024 financial statement. They will also consider a street name change for J.B. Estille Drive to Donelson Station Boulevard under ordinance BL2024-307. Other items include approval of prior meeting minutes and a public awareness update.

e-911budgetstreet-name-changepublic-safetyfinancial-statement
Thu Apr 18, 2024

Behavioral Health and Wellness Advisory Council

Council to discuss opioid care RFP and membership recommendations

The Behavioral Health and Wellness Advisory Council is meeting to approve February minutes, receive updates on PIC and REACH programs, discuss recommendations for council membership, and review an opioid care process request for proposals (RFP). The meeting is a regular business session with no final votes scheduled.

behavioral-healthopioid-carerfpcouncil-membershippublic-health
Thu Apr 18, 2024

Arts Commission

Arts Commission to vote on public art projects and budgets

The Metro Arts Board of Commissioners is meeting to discuss and take action on several public art projects, including design concepts and artist budgets. The agenda includes public comment, approval of past minutes, and committee updates on grants, budget, and equity.

artspublic-artbudgetgrantsequitycommunity-centerslibraries
✓ Decided: Arts Commission votes to terminate Executive Director Daniel Singh

The Metro Arts Board of Commissioners voted to terminate Executive Director Daniel Singh and begin the process of appointing an interim director. The board also approved several public art project budget increases, including the Old Hickory Community Center artwork, the Bordeaux Gateway project, and the Donelson Library installation. No decisions were made on grant funding or the FY25 budget request.

Wed Apr 17, 2024

Community Review Board

Community Review Board executive committee to discuss MOU, misconduct complaints, MNPD records

The Community Review Board's executive committee is meeting to discuss several topics, including a memorandum of understanding (MOU), an update from the Mayor's office, misconduct complaints, MNPD records, a sexual misconduct report, and vacant CRB positions. The meeting is open to the public with a public comment period.

community-review-boardpolice-oversightmisconductmnpdpublic-comment
Wed Apr 17, 2024

Historic Zoning Commission

Historic Zoning Commission reviews 30+ construction permits in Nashville overlays

The Metro Historic Zoning Commission will review and vote on numerous applications for new construction, additions, and outbuildings within Nashville's historic overlay districts, along with a few signage and infill projects. The agenda includes consent items, administrative permits, violation cases, and new business, with several items revised or withdrawn. Public comments are invited for each case.

historic-zoningpermitsconstructionnashvilleoverlay-districtspublic-hearing
✓ Decided: Commission denies second rooftop addition at 215 Broadway, approves skylight

The Metro Historic Zoning Commission denied a proposed second rooftop addition to the contributing building at 215 Broadway, finding it did not meet design guidelines, but approved a skylight with conditions. The commission also approved several other construction projects, including additions and infill, with conditions, and deferred or removed several items from the agenda.

Wed Apr 17, 2024

Continuum of Care Homelessness Planning Council

CoC committee to review HUD scores, FY2024 competition, and monitoring plans

The Performance Evaluation Committee will discuss the Collaborative Applicant transfer progress, HUD FY2023 scores, and preparations for the FY2024 CoC competition, including renewal and new project applications, monitoring questions, and timeline. The committee will also hear agency spotlights from Park Center and Urban Housing Solutions, and review monitoring visits for CoC-funded programs.

homelessnesscontinuum-of-careperformance-evaluationhud-fundingnashville
Wed Apr 17, 2024

Arts Commission

Arts Commission committee to discuss aligning grant cycle with fiscal year

The Grants and Funding Committee will consider aligning the grant cycle with the fiscal year and discuss the FY25 Thrive program, including its removal from delegated procurement. Updates on FY24 second payments, ABC Grant designation, and payments to mural artists are also on the agenda.

artsgrantsfundingprocurementthrive-program
Tue Apr 16, 2024 · 6:30 PM

Metropolitan Council

Council discusses various appointments, resolutions, and property claims

The Metropolitan Council is considering numerous elections and appointments for several advisory boards and commissions. The agenda also includes resolutions regarding a performance space on East Bank and a property damage settlement.

governmentappointmentszoningdevelopmentlegal
Metropolitan Courthouse
Tue Apr 16, 2024

Metropolitan Council

Council committee to weigh beer permit exemption, housing code changes

The Government Operations and Regulations Committee will consider four items: a resolution to exempt Tacos y Mariscos Los Carnales from beer permit distance rules, and three bills amending the Metropolitan Code. These include clarifying website updates and removing washer/dryer hookup requirements, streamlining fireproofing for middle housing, and adding a storm shelter occupancy exception. Public comment is limited to eight minutes total.

zoninghousingalcoholbuilding-codespublic-safety
Tue Apr 16, 2024

Public Library Board

Library Board to review collection development policy and hear SEIU presentation

The Nashville Public Library Board of Trustees will meet to discuss a collection development policy update, consider board elections and a retreat, and hear a presentation from the SEIU. The meeting includes public comment on actionable items.

librarypolicypublic-commentboard-electionsretreatlabor
Tue Apr 16, 2024

Metropolitan Council

Council committee to review Cumberland River safety and housing study request

The Public Facilities, Arts, and Culture Committee will consider resolutions and ordinances, including a request for a comprehensive analysis of safety, security, housing, and cleanliness around the Cumberland River downtown, acceptance of several grants for libraries and parks, and amendments to fairgrounds and arts commission rules.

public-facilitiesartsculturegrantsparkslibrariesfairgroundshomelessness
Tue Apr 16, 2024

Metropolitan Council

Council committee to vote on lobbying rules, disclosure, and board appointments

The Rules, Confirmations, and Public Elections Committee will consider several resolutions, including setting the 2024 State of the Metropolitan Government Address, supporting a Special Olympics bid, and recognizing local events. It will also review bills amending lobbying rules and expanding annual disclosure requirements to board and commission members. The committee will vote on numerous appointments to boards and commissions, and consider a proposed rule change on deferrals.

lobbyingdisclosuresappointmentsresolutionsrules
Tue Apr 16, 2024

Metropolitan Council

Council discusses police updates, energy assistance, and river safety analysis

The Public Health and Safety Committee will review several resolutions and bills including MNPD updates and traffic safety grants. The meeting includes discussions on energy assistance funds and a proposed analysis of the Cumberland River area.

policehousingpublic-safetyenergy-assistancetransportation
Tue Apr 16, 2024

Employee Benefit Board

Employee Benefit Board to review clinic incentive program

The Metropolitan Employee Benefit Board is holding a study session to discuss a review of the clinic incentive program involving the Hospital Authority and Metropolitan Nashville Public Schools. No votes or decisions are scheduled; the agenda contains only this single discussion item.

employee-benefitshealth-clinicsincentive-programstudy-session
Tue Apr 16, 2024

Farmers Market Board

Nashville Farmers' Market Board to meet, hear reports, approve minutes

The Nashville Farmers' Market Board is holding its regular monthly meeting. The agenda includes public comments, approval of the March 2024 minutes, and reports from the executive director and market staff on programs, facilities, and finance. No major decisions or proposals are listed; the meeting appears to be routine oversight.

farmers-marketboard-meetingpublic-commentsreports
✓ Decided: Farmers Market Board approves March minutes, hears tenant issues

The Nashville Farmers' Market Board approved the March 2024 meeting minutes unanimously. The board discussed tenant concerns including a damage claim, beer permit, and marketing support, and requested a marketing report for the next two to three meetings. No major policy decisions were made; the meeting was largely informational and procedural.

Mon Apr 15, 2024

Metropolitan Council

Council committee to vote on $27,504 property damage settlement and multiple grants

The Budget and Finance Committee will consider 14 consent items, including settlements, grants, and contract amendments, plus five bills on second reading. Key items include a $27,504 property damage settlement, a $18,000 personal injury settlement, and several grants for library programs, park projects, and police traffic enforcement.

budgetfinancesettlementsgrantspoliceparksrecyclingtourism
Mon Apr 15, 2024

Historical Commission

Historical Commission votes on three National Register nominations

The Historical Commission will vote on nominations to the National Register of Historic Places, including a multiple property document on the Civil Rights Movement in Nashville (1942-1969) and two church complexes. The meeting also includes updates on a marker cleaning day and preservation efforts at Nashville City Cemetery.

historic-preservationnational-registercivil-rightschurchescemeterypublic-hearing
✓ Decided: Historical Commission approves three Civil Rights-era National Register nominations

The Metropolitan Historical Commission unanimously approved a countywide historic context document and two property nominations for the National Register of Historic Places, all tied to Nashville's Civil Rights Movement (1942-1969). The approved items include the multiple property documentation form, Clark Memorial Methodist Church Complex, and First Community Church. The State Review Board will review the nominations on May 22.

Fri Apr 12, 2024

Continuum of Care Homelessness Planning Council

Homelessness council committee plans 2024 nominations, weighs merger

The Nominating Committee of Nashville's Continuum of Care is meeting to reflect on the 2023 nomination process and prepare for the 2024 nominating season. They will also discuss a proposed merger of the Nominating and Membership Committees. The agenda is largely procedural, with no specific decisions or proposals detailed.

homelessnesscontinuum-of-carenominating-committeecommittee-mergernashville
Thu Apr 11, 2024

Health Board

Health Board reviews Mecklenburg County health department operations

The board is reviewing a presentation on the Mecklenburg County health department's organization, services, and strategic initiatives. The agenda includes discussion of clinical services, communicable disease control, behavioral health violence prevention, and workforce development. No votes or decisions are listed.

healthpublic-healthworkforceviolence-preventionclinical-servicescommunity-resources
✓ Decided: Board approves grants, contracts; postpones mayor's report to May 9

The Board of Health unanimously approved four grants and contracts, including a $60,000 Tennessee Justice Center appropriation and a $20,000 Virginia Bennett Memorial donation. It postponed discussion of the Report to Mayor O'Connell to the May 9 meeting, appointing an ad hoc committee to finalize a draft. The Civil Service Board approved a veterinarian position change at Metro Animal Care and Control and scheduled a public hearing on Mayor's Executive Order No. 48 for May 9, 2024.

Thu Apr 11, 2024

Metropolitan Council

Charter Revision Committee to discuss proposed charter amendments

The Metro Council Charter Revision Committee is meeting to discuss charter amendment submissions. No votes or decisions are scheduled; the agenda is procedural and focused on discussion only.

charter-revisioncouncil-committeeprocedural
Thu Apr 11, 2024

Planning Commission

Planning Commission to vote on 320-unit apartment plan at 4214 Central Pike

The Planning Commission will consider a request to amend a Specific Plan to allow 320 multi-family units at 4214 Central Pike, with a staff recommendation to approve with conditions. Several other items are recommended for deferral to the April 25 meeting, including a community plan amendment for Buena Vista Drive and multiple subdivision and rezoning requests. The meeting also includes consent items and reports from the Historic Zoning Commission and Board of Parks and Recreation.

planning-commissionzoninghousingsubdivisioncommunity-planrezoningnashville
✓ Decided: Planning Commission approves 320-unit apartment complex at 4214 Central Pike

The Planning Commission approved a Specific Plan amendment to allow 320 multi-family residential units at 4214 Central Pike, with conditions. The commission also approved a 45-lot subdivision phase at Parks at Cane Ridge, a plat amendment for a property on Pleasant View Drive, and two rezoning requests. Several other items were deferred to the April 25 meeting.

🏢 Building at this address: 5 m tall
Thu Apr 11, 2024

Arts Commission

Arts Commission Public Art Committee holds orientation session

This is a procedural orientation meeting for the Public Art Committee, covering the Metro Arts public art program, committee structure, existing collection, and upcoming projects. No votes or decisions are scheduled.

public-artcommittee-orientationarts-commissionnashville
Thu Apr 11, 2024

Beer Permit Board

Beer Board to review 33 applications, 32 deferred, and 10 complaints

The Metro Beer Permit Board is meeting to consider 33 beer permit applications, including new locations, changes of ownership, and special event permits. The board will also hear 10 complaints alleging underage sales, with staff recommending civil penalties ranging from $1,500 to $3,500. Additionally, 32 applications are listed under 'Defer Indefinitely' due to missing documents, and the board will approve minutes from previous meetings.

beer-permitsalcohollicensingcomplaintsspecial-eventspublic-hearing
Thu Apr 11, 2024

Human Relations Commission

Human Relations Commission holds pre-hearing conference

This is a procedural pre-hearing conference meeting. The commission will prepare for hearings with staff. No substantive decisions or public hearings are scheduled.

human-relationspre-hearingprocedural
Thu Apr 11, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals, family capacity, and encampment plan

The Shelter Committee of the Continuum of Care Homelessness Planning Council is meeting to review current goals, including shelter capacity, encampment plan revisions, and inflow/outflow issues. They will hear agency updates from NRM, RITI, MSS, Oasis, Launch Pad, Cold Patrol, OHS, and CCF. A key discussion item is family shelter capacity, with data and narrative to be presented by Alexis.

homelessnessshelterencampmentaffordable-housingmetricsfamily-shelter
Thu Apr 11, 2024

Arts Commission

Public Art Committee to vote on budgets for Bordeaux Gateway and Celestial Falls

The Public Art Committee will consider budget approvals for the Bordeaux Gateway and Celestial Falls projects. Updates will be given on nearly complete installations at the Fairgrounds and Donelson Library, and on contracts for Permanent Supportive Housing, Looby Community Center, and Arthur Avenue. The meeting also includes public comments and approval of previous minutes.

public-artbudgetcommunity-centerslibraryfairgroundshousing
✓ Decided: Arts Commission approves two public art budget increases

The Public Art Committee unanimously approved increasing the Bordeaux Gateway project artist budget from $185,000 to $300,000 and approved a $76,845.48 increase for Amber Lelli's Celestial Falls project at Donelson Library. The committee also postponed approval of the February 8, 2024 minutes to the May meeting and discussed updates on several public art projects.

Wed Apr 10, 2024

Nashville Entertainment Commission

Entertainment Commission to review public comment policy and committee reports

The Nashville Entertainment Commission is meeting to review and potentially update its public comment policy, hear committee reports, and discuss possible amendments to original legislation. The agenda includes action items on the public comment policy and budget committee report, along with updates from various subcommittees.

entertainment-commissionpublic-commentbudgetlegislationcommittee-reports
✓ Decided: Commission adopts public comment policy unanimously

The Nashville Music, Film, and Entertainment Commission voted unanimously to adopt a public comment policy recommended by Metro Legal. The meeting also included updates on the Tennessee Entertainment Commission meeting, the Elvis Act, a permitting issue, and the NDOT e-permit system. No other substantive decisions were made; quorum was lost at 6:53 PM.

Wed Apr 10, 2024

Tax Incentive and Abatement Study and Formulating Committee

Committee to review and approve final report to Council

The Tax Incentive and Abatement Study and Formulating Committee is meeting to review any last edits and approve its final report to the Nashville Council. This is the 15th meeting of the committee, and the agenda is focused on finalizing the report, with no other substantive items listed.

tax-incentivesabatementcommitteefinal-reportcouncil
Wed Apr 10, 2024

COVID-19 Financial Oversight Committee

Committee to review COVID relief fund allocations and contract extensions

The COVID-19 Financial Oversight Committee is meeting to discuss contract extensions for Raphah Institute and VOAD, review allocations and expenditures of CARES and ARP funds, receive an update on the US Treasury's definition of obligation, and consider future re-allocations. Public comment is allowed on agenda items.

covid-19financial-oversightcares-actarpcontractsallocations
Wed Apr 10, 2024

Continuum of Care Homelessness Planning Council

Homelessness Planning Council meets to discuss strategic planning and updates

The Council will receive reports from the Office of Homeless Services and the MDHA Collaborative Applicant. Discussion items include HUD system performance measures, strategic planning, and a public comment period for the Continuum of Care Charter.

homelessnesshousinggovernment-reportingstrategic-planning
Wed Apr 10, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board to review new VIP rooms at Déjà vu of Nashville

The Sexually Oriented Business Licensing Board will hold a public meeting to approve minutes, consider new and renewal permits for entertainers and businesses from January 25 to April 10, 2024, and review an inspector's report. The board will also examine Déjà vu of Nashville's floor plan showing newly built VIP rooms.

sexually-oriented-businesslicensingpermitspublic-hearingnashville
Wed Apr 10, 2024

Nashville Entertainment Commission

Budget Committee to review and discuss budget proposals

The Nashville Entertainment Commission Budget Committee will meet to review and discuss budget proposals, with an action item on the agenda. The meeting includes a public comment period and approval of prior meeting minutes.

budgetentertainmentcommissionnashville
Wed Apr 10, 2024

Nashville Entertainment Commission

Committee to review Executive Director job description for Nashville Entertainment Commission

The Ad Hoc Job Description Committee of the Nashville Music, Film, and Entertainment Commission will meet to review and discuss the Executive Director job description as an action item. The meeting includes public comment and approval of prior minutes. This is a working session focused on refining the job description for the commission's top staff role.

entertainment-commissionjob-descriptionexecutive-directorpublic-commentmeeting-minutes
Wed Apr 10, 2024

Social Services Commission

Metro Social Services Board to review community needs evaluation and budget updates at April 10 meeting.

The Metro Social Services Board will meet on Wednesday, April 10, 2024, at 11:30 a.m. at the Family Safety Center. The agenda includes approval of previous meeting summaries, a director's report, a strategic planning presentation on a community needs evaluation, and budget updates.

social-servicesboard-meetingbudgetstrategic-planning
Wed Apr 10, 2024

Arts Commission

Arts Commission committee to discuss finance and legal updates

The Budget and Administrative Oversight Committee of the Metro Arts Commission is meeting to receive updates on meetings with Finance and on legal/HR topics from Metro Legal. The agenda includes public comment and discussion of next steps, but no specific decisions or votes are listed.

arts-commissionbudgetfinancelegalpublic-comment
Tue Apr 9, 2024

Metro Development and Housing Agency Board

MDHA board to hear East Bank presentation, consider Park Point East construction price

The MDHA Board will receive a presentation from the Metro Chief Development Officer on the East Bank development. The board will also consider a guaranteed maximum price for vertical construction at Park Point East and discuss the executive director's performance and compensation.

developmenthousingeast-bankpark-point-eastexecutive-compensation
Tue Apr 9, 2024

Beautification and Environment Commission

Wildflower legislation, Vision Zero, and tree foundation presentations

The Beautification and Environment Commission will hear presentations on wildflower legislation from Council Member Jordan Huffman, Vision Zero from NDOT's Guneet Saini, and the Nashville Tree Foundation from Becca Morris. The agenda also includes reading of March minutes, updates on beautification projects and the Mayor's Spring Clean, and reports on flowers, trees, and waste.

beautificationenvironmentwildflower-legislationvision-zerotree-foundationspring-cleanwaste
Tue Apr 9, 2024

Fair Commissioners Board

Fairgrounds board reviews FY2024 finances showing $370K operating loss

The Board of Fair Commissioners reviewed a financial report for the fiscal year ending June 30, 2024, showing a year-to-date operating loss of $370,642. The report includes revenue and expense breakdowns for the Nashville Fairgrounds, with major revenue sources from the Divisional Fair and Corporate Sales events.

fairgroundsbudgetfinancial-reportnashville
Tue Apr 9, 2024

Civil Service Commission

Civil Service Commission to approve dozens of hires, terminations, and pension items

The Metropolitan Civil Service Commission will vote on a large batch of appointments, terminations/pensions, and eligibility register reports across multiple Metro departments. The agenda includes dozens of new hires, promotions, resignations, retirements, and dismissals for positions in Fire, Police, Parks, Water Services, and other agencies. The commission will also approve minutes from the March 12 meeting and hear communiques from the public on pending hearings.

civil-serviceappointmentsterminationspensionspolicefireparkswater-services
Tue Apr 9, 2024

Audit Committee

Audit Committee to review FY2023 federal spending and audit follow-ups

The Metropolitan Nashville Audit Committee will hear presentations on the FY2023 Schedule of Expenditures of Federal and State Awards and the Letter of Recommendations to Management, and discuss follow-ups on the Criminal Justice Center Construction Project audit. They will also tentatively discuss audits of MNPS ESSER spending and sidewalk prioritization, and review the Metropolitan Auditor's performance process. The meeting includes public comment and a possible executive session.

auditfinancefederal-awardsschoolssidewalksconstruction
Tue Apr 9, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup to review data and set goals for ending veteran homelessness

The Continuum of Care Veterans Workgroup is meeting to review minutes from March, discuss Built for Zero onsite work including data review and goal setting, and receive agency updates. The agenda includes an equity statement and introductions, but no specific decisions or proposals are listed.

homelessnessveteransdata-reviewgoal-settingcontinuum-of-care
Tue Apr 9, 2024

Fire and Building Code Appeals Board

Board hears appeal to skip sprinklers at 1030 18th Ave S

The Board of Fire and Building Code Appeals will hear one appeal case at this meeting. The appellant seeks a waiver from installing an automatic sprinkler system at 1030 18th Avenue South, arguing the building will become 100% commercial after a residential tenant leaves in 2-3 months. The board will vote to approve or deny the appeal.

fire-codebuilding-codeappealssprinklersnashville
Mon Apr 8, 2024

Metropolitan Council

Minority Caucus to vote on budget and bylaw changes

The Metropolitan Council Minority Caucus is meeting to vote on a proposed budget and changes to its bylaws. The treasurer's report includes a proposed budget for approval and a $25 dues payment. The meeting also covers old business items such as boards and commissions and an internship program.

budgetbylawsduesminority-caucusmetropolitan-council
Mon Apr 8, 2024

Traffic and Parking Commission

Commission to vote on closing 2nd Ave N to traffic for tourism zone

The Traffic and Parking Commission will consider several traffic and parking changes, including a proposal to close 2nd Ave N between Broadway and Union St to non-emergency vehicles and designate it a Tourism Improvement Zone. Other items include new stop signs, alley abandonments, parking restrictions, valet zones, and a bus loading zone.

trafficparkingtourism-improvement-zonevalet-zonesbus-loadingstop-signsalley-abandonment
✓ Decided: Commission approves speed reductions, parking zones, and fee policy

The Traffic and Parking Commission approved a consent agenda including 10 speed limit reductions under the Vision Zero initiative, two residential permit parking zones, and an on-street metered space rental fee policy. The commission deferred the valet fee policy revision indefinitely and deferred a bus-only parking zone request for one month.

Thu Apr 4, 2024

Ethical Conduct Board

Ethics Board to review complaints against two Metro Arts commissioners

The board is deciding whether to investigate complaints filed against Metro Arts Commissioners Will Cheek and Carol McCoy. The complaints allege violations of the Tennessee Open Meetings Act, conflicts of interest, and racist conduct. The complainants request outside counsel and sanctions including censure.

ethicsarts-commissioncomplaintracismopen-meetingsconflict-of-interest
✓ Decided: Board dismisses Yousief complaint against Carol McCoy, sets hearing for Will Cheek case

The Board dismissed Lydia Yousief's complaint against Arts Commission member Carol McCoy, with the open meeting violation dismissed with prejudice and other allegations without prejudice, allowing an amended complaint. For the complaint against Will Cheek, the Board adopted the Department of Law's recommendation to dismiss two allegations but sustain a potential conflict of interest violation, scheduling a hearing for April 29, 2024. The Board also approved minutes, elected officers, and discussed legislative updates.

Thu Apr 4, 2024

Metro Development and Housing Agency Board

Human Resources Committee to vote on Agency Safety and Health Plan

The Human Resources Committee of the Metro Development and Housing Agency will meet to approve minutes from January and consider a new Agency Safety and Health Plan, with a board decision requested in May. The meeting includes time for public comments.

housingsafetyhealthhuman-resourcesnashville
Thu Apr 4, 2024

Zoning Appeals Board

Zoning Appeals Board hears 10 variance and special exception requests

The Metropolitan Board of Zoning Appeals will hold a public hearing on 10 requests for variances and special exceptions, including drive-thru construction, townhomes, a digital billboard, and community education programs. Two cases are deferred to May 16, 2024. Public comments are due by March 28, 2024.

zoningvariancesspecial-exceptionspublic-hearingnashville
Thu Apr 4, 2024

Metro Development and Housing Agency Board

MDHA Housing Committee to review 2024 capital improvement priorities

The Housing and Community Committee will hear presentations on the 2024 Capital Improvement Priorities and a Resident Services Department update. The meeting also includes approval of prior minutes and public comments.

housingcapital-improvementsresident-servicespublic-comments
Thu Apr 4, 2024

Metro Development and Housing Agency Board

Committee to discuss raising PILOT cap for affordable housing

The Finance and Development Committee will hear a presentation on the December 2023 audit results of LIHTC entities and consider a proposal to increase the Payment in Lieu of Taxes (PILOT) cap, with a board decision expected in May. Public comments will be taken.

affordable-housingauditfinancehousinglihtcpilot
Wed Apr 3, 2024

Greenways and Open Space Commission

Commission to vote on greenway easement amendment for 2nd & Van Buren development

The Greenways and Open Space Commission will consider a request to amend a greenway easement for a multi-family development at 2nd and Van Buren. The commission will also elect a new chairperson and vice-chair, and receive a transit update from the Mayor's Office. Public comment is limited to 20 minutes total, with 2 minutes per speaker.

greenwaysparkszoningtransitdevelopmentpublic-comment
Wed Apr 3, 2024

Metropolitan Council

Council committee work group to set goals for non-profit funding process

This is a procedural first meeting of a work group to discuss the non-profit funding process. The agenda includes introductions, setting goals and a working schedule, and planning the next meeting. No decisions or funding allocations are on the table.

budgetfinancenon-profitcommitteeprocedural
Wed Apr 3, 2024

Property Standards and Appeals Board

Board defers demolition appeal for Eastside Ave property to allow probate

The Board of Property Standards and Appeals will hear a deferred case for 1622 Eastside Ave, where owners seek permission to repair a structure under a demolition order. The board previously voted to defer to this meeting to allow the appellants to contact heirs through probate to sell the property. The board will also consider minutes and public comment.

property-standardsdemolitionappealsprobateeastside-avenue
Wed Apr 3, 2024

Stormwater Management Commission

Stormwater Commission to decide on floodway violations at 3817 Trimble Road

The Stormwater Management Commission will hold a public meeting to consider a case involving unpermitted structures in the floodway of a Belle Meade Branch tributary, including violations of the floodway buffer. The commission will also approve previous meeting minutes and receive ethics training.

stormwaterfloodwayfloodplainBelle Meade BranchTrimble Roadethics trainingpublic hearing
Tue Apr 2, 2024

Metropolitan Council

Rules committee to vote on drag racing, TSU board, and lobbying changes

The Rules, Confirmations, and Public Elections Committee is meeting to vote on several resolutions, including one supporting state anti-drag-racing legislation and another opposing a bill that would vacate Tennessee State University's board. The committee will also consider a late-filed resolution authorizing counsel for a Title VI complaint against the Metropolitan Arts Commission, a bill on second reading to amend lobbying rules, and multiple mayoral appointments to boards and commissions. Additionally, several proposed amendments to the Council's Rules of Procedure are on the agenda.

rules-committeedrag-racingtennessee-state-universitylobbyingappointmentspublic-commentcouncil-rules
Tue Apr 2, 2024

Transportation Licensing Commission

TLC to discuss ET permit renewal process, no decisions expected

The Transportation Licensing Commission is holding a work session to continue discussing how to determine which extended-term (ET) permits will be renewed at the next annual meeting in May 2024. This follows amendments to chapter 6.77 by BL 2023-1869 and considers updated data from the Connect Downtown Study. No decisions or action items are on the agenda.

transportationpermitslicensingdowntownmeeting
Tue Apr 2, 2024

Metropolitan Council

Council committee to vote on homeless rent assistance, fire grants, and anti-crime funds

The Public Health and Safety Committee is considering 11 items, including a subrecipient agreement for one-time rent and deposit payments for homeless persons, amendments to a family safety grant contract, a firefighter equipment grant, and multiple intergovernmental agreements for internet crimes against children investigations. Also on the agenda is a resolution requesting a safety and housing analysis of the Cumberland River area and a late resolution authorizing counsel for a Title VI complaint.

homeless-servicesfire-departmentpolicegrantspublic-safetyhousinggun-violenceinternet-crimes
Tue Apr 2, 2024

Employee Benefit Board

Board to set 2025 medical plan rates and review investments

The Metropolitan Employee Benefit Board will consider 2025 medical plan rates, review investment policies, and approve its FY2025 budget. The agenda also includes disability pension requests, a medical pension reconsideration, and committee reports. Public comment is limited to 10 people for two minutes each.

benefitspensionsbudgetinsuranceinvestments
✓ Decided: Board approves 0% medical plan rate increases for 2025

The Board approved scenario 2 for 2025 medical plan rates, with 0% increases for both Cigna PPO and Cigna HRA, after scenario 1 (0% PPO, 1.3% HRA) failed. It also approved three new disability pension requests, denied one, deferred one, continued six reexaminations, and approved a reconsideration. The Board accepted the Hackett Group's final report on pension fund investment practices and approved the FY2025 budget.

Tue Apr 2, 2024

Parks and Recreation Board

Parks board to consider greenway easement, grants, and event permits

The Nashville Parks and Recreation Board will consider several items, including a donated conservation easement for a new Cumberland River Greenway segment, approval of numerous event permits, and acceptance of grants for park improvements. The board will also nominate officers and hear updates from staff and partner organizations.

parksgreenwaygrantspermitseventsdisc-golffarmers-market
Tue Apr 2, 2024

Parks and Recreation Board

Board to accept donated easement for new Cumberland River Greenway segment

The Parks and Recreation Board Acquisition Committee will consider accepting a donated Conservation Greenway Easement for a new segment of the Cumberland River Greenway at 1710 54th Avenue North. The easement would add 3.01 acres of conserved open space at no cost to Metro, with the developer designing, constructing, and maintaining the greenway in perpetuity.

parksgreenwayconservation-easementcumberland-riveropen-space
Tue Apr 2, 2024

Parks and Recreation Board

Parks board advocacy committee meets to discuss park resource awareness

The Advocacy Committee of the Metropolitan Board of Parks and Recreation is meeting to receive updates on advocacy and awareness of parks and recreation resources. The agenda includes a call to order, public comment period, and adjournment, with no specific action items listed.

parksrecreationadvocacypublic-comment
Tue Apr 2, 2024

Metropolitan Council

Council committee to review safety and housing for unhoused near Cumberland River

The Public Facilities, Arts, and Culture Committee will consider a resolution requesting a comprehensive analysis of recommended changes to improve safety, security, housing resources for the unhoused, and cleanliness of properties surrounding the Cumberland River within the downtown interstate loop. The resolution has been referred to three committees. Public comment is allowed on agenda items.

public-facilitieshousinghomelessnesssafetycumberland-riverdowntown
Tue Apr 2, 2024

Nashville Health and Well-being Leadership Council

Nashville Health and Well-being Leadership Council meeting on April 2, 2024

The council will conduct organizational development tasks including officer elections and setting the 2024 meeting schedule. Members will also review the 2024 Community Health Needs Assessment and progress on the 2023-2025 Community Health Improvement Plan. Additionally, there will be an update regarding the TDH CARES grant.

public-healthcommunity-healthgovernment-administrationgrants
Tue Apr 2, 2024

Metropolitan Council

Council committee to weigh beer permit exemption, fence rules, AT&T contract

The Government Operations and Regulations Committee is meeting to consider three items: a resolution exempting a business from beer permit distance rules, a bill to restrict fences in floodways and require fence permits, and a contract amendment with AT&T for telecommunications services. Public comment is limited to eight minutes total, with two minutes per speaker.

alcoholbeer-permitfloodplainfencestelecommunicationscontract
Mon Apr 1, 2024

Human Relations Commission

Human Relations Commission to discuss Title VI complaints and commissioner vacancies

The Metro Human Relations Commission is holding a regular meeting to review minutes, receive a financial update, and take public comments. New business includes updates on a pre-hearing conference, responses to Metro Arts Title VI complaints, and the executive committee nominations process. Old business covers commissioner vacancies and the compliance officer search.

human-relationstitle-vicommission-vacanciescompliancepublic-commentsnashville
Mon Apr 1, 2024

Metropolitan Council

Committee to discuss NDOT Connect Downtown update and 20 resolutions/bills

The Transportation and Infrastructure Committee will hear a progress update on the NDOT Connect Downtown project and consider 20 items, including resolutions for a multi-use performance space on the East Bank, a CSX bridge repair agreement, and several bills amending the Metropolitan Code on infrastructure, valet parking fees, and floodplain fencing. Public comment is limited to eight minutes total, with two minutes per speaker.

transportationinfrastructurepublic-worksfloodplainvalet-parkingeast-bankcsxperformance-arts
Mon Apr 1, 2024

Auditorium Commission

Auditorium Commission to hear Musician’s Hall of Fame update

The Metropolitan Auditorium Commission is meeting to discuss an agenda that includes an item on the Musician’s Hall of Fame and Museum, along with staff reports and new business. The meeting also includes a public comment period and approval of minutes.

auditoriumcommissionmeetingpublic-commentmusicnashville
Mon Apr 1, 2024

Continuum of Care Homelessness Planning Council

Homelessness council committee to discuss racial disparities data and equity priorities

The Equity & Diversity Committee of Nashville's Continuum of Care Homelessness Planning Council is meeting to discuss strategic plan objectives, including potential responsibilities and priorities. They will also review requests from other committees to examine data on racial disparities in homelessness outcomes, and receive updates on racial equity resources and training.

homelessnessracial-equitycommittee-meetingdatastrategic-planning
Mon Apr 1, 2024

Metropolitan Council

Budget committee to vote on East Bank performance space MOU

The Budget and Finance Committee will consider a memorandum of understanding for a multi-use performance space for the Tennessee Performing Arts Center on East Bank property. The committee also has a consent agenda with multiple affordable housing grant amendments, fuel card agreements, and intergovernmental agreements for internet crimes against children investigations. A late resolution authorizes counsel for a Title VI complaint against the Metropolitan Arts Commission.

budgetfinanceaffordable-housingpublic-safetyeconomic-developmenttransportationarts
Mon Apr 1, 2024

Metropolitan Council

Council to vote on East Bank performance space MOU and stadium campus development

The Planning and Zoning Committee is reviewing resolutions and bills on second reading, including a memorandum of understanding for a multi-use performance space on East Bank property, amendments to affordable housing grant contracts, and a master development agreement for the east bank stadium campus. Several items involve infrastructure easements and utility acceptances. Public comment is limited to eight minutes total.

zoningaffordable-housinginfrastructureeast-bankstadiumpublic-workstransportation
Mon Apr 1, 2024

Metropolitan Council

Council committee hears presentations on Nashville charter history and consolidation

The Metro Council Charter Revision Committee is holding an education session featuring presentations on the history of Nashville's consolidated government, including the influence of money, community impacts, and past charter revision efforts. No votes or decisions are scheduled; the session is informational only.

charterconsolidationcouncileducation-sessionnashville
Thu Mar 28, 2024

Employee Benefit Board

Benefit board to hear four insurance coverage appeals

The Medical and Life Committee of the Metropolitan Employee Benefit Board will meet to hear public comments and consider four appeals from employees and a pensioner regarding denials of coverage for specific medical treatments and medications under self-insured plans. The appeals involve GLP-1 medications for PCOS, toric lens and laser astigmatism correction, and Bivigam for a dependent.

benefitsinsuranceappealshealthemployee-benefits
Thu Mar 28, 2024

Metropolitan Council

Metro Council Charter Revision Committee to set prioritization criteria

The Metro Council Charter Revision Committee is meeting to review prior charter amendment submissions and determine criteria for prioritizing them. The committee will discuss next steps for handling these submissions.

charter-revisioncouncil-procedureprioritization
Thu Mar 28, 2024

Planning Commission

Commission to vote on 320-unit apartment plan at 4214 Central Pike

The Planning Commission will consider a request to amend a Specific Plan at 4214 Central Pike to permit 320 multi-family residential units, though staff recommends deferring the item to April 11. Other notable items include a rezoning along Cloverland Drive (112.76 acres) from R40 to RS40, which staff recommends disapproving as submitted, and a final plat for 82 cluster lots at Hobson Park. Several items are marked for deferral or consent.

zoninghousingmulti-familyrezoningsubdivisionshort-term-rentalsplanning-commission
✓ Decided: Planning Commission approves Cloverland Drive downzoning to single-family

The Metro Planning Commission approved a rezoning along Cloverland Drive from R40 to RS40, limiting the area to single-family homes, with a substitute ordinance removing certain parcels. The commission also approved several other rezoning requests, including a mixed-use development in the Stephens Valley area and a multi-family rezoning on Paragon Mills Road. Multiple items were deferred to future meetings, and a request to amend a specific plan on 10th Avenue South was withdrawn.

🏢 Building at this address: 5 m tall
Thu Mar 28, 2024

Work Release Commission

Work Release Commission approves 3, denies 1, continues 1

The Work Release Commission reviewed applications for the work release program. Three inmates were approved, one was denied, and one was continued for further review. The board discussed candidates' charges, history, institutional behavior, and treatment programs.

work-releaseinmatescorrectionsnashville
Thu Mar 28, 2024

Hospital Authority Board

Hospital board to approve CEO performance goals for FY24

The CEO Performance Evaluation Committee of the Metropolitan Hospital Authority Board will meet to approve the CEO's performance goals for fiscal year 2024 (July 1, 2023–June 30, 2024). The agenda also includes routine items such as a call to order, conflict of interest disclosures, mission statement review, and public comment. No other substantive decisions or discussions are listed.

hospitalceo-evaluationperformance-goalsboard-meeting
Thu Mar 28, 2024

Arts Commission

Arts Commission to vote on public art guidelines and lending library acquisitions

The Metro Arts Board of Commissioners will hold a special called meeting to take action on proposed amendments to the Public Art Guidelines and approve new acquisitions for the Lending Library. The board will also receive updates from its Oversight, Grant, and Anti-Racism and Equity committees, and discuss the status of the Executive Director position.

artspublic-artgrantsequitycommission-meeting
✓ Decided: Arts Commission approves public art guideline changes and 54 new artworks

The Metro Arts Board approved amendments to public art guidelines, increasing the Public Art Committee to nine members and streamlining selection panel approvals. They also approved the acquisition of 54 artworks for the lending library. The board passed motions to address financial and HR issues, including designating a person to work with Metro finance and legal, and to handle the executive director's FMLA status.

Thu Mar 28, 2024

Hospital Authority Board

Hospital board to review FY25 budget, CEO goals, and relocation updates

The Metropolitan Hospital Authority Board will consider approving the FY25 budget, CEO performance goals for FY24, and the January finance report. They will also receive updates on hospital utilization, relocation efforts, and a credentials report. Public comment is limited to agenda items scheduled for approval.

budgetceo-performancefinancehospitalrelocationcredentials
Thu Mar 28, 2024

Hospital Authority Board

Finance Committee to review FY23 audit and FY25 budget

The Metropolitan Hospital Authority Board of Trustees Finance Committee is meeting to discuss and approve financial items. Agenda items include an update on the FY23 audit, a preview of the FY25 budget, and approval of January 2024 financial reports and revenue cycle report.

hospital-authorityfinanceauditbudgetfinancial-reports
Thu Mar 28, 2024

Metro Action

Board to vote on converting Head Start slots and approving self-assessment

The Metropolitan Action Commission board will consider converting 200 Head Start slots to 80 Early Head Start slots, approve the 2024-2025 Head Start Self-Assessment, and sign ethics statements. They will also review program reports and approve minutes from prior meetings.

head-startearly-educationgrantsethicsboard-meeting
Thu Mar 28, 2024

Continuum of Care Homelessness Planning Council

CoC committee to review charter revisions and encampment closures

The Executive Committee of the Continuum of Care Homelessness Planning Council will review February and March meeting minutes, discuss revisions to the CoC Charter, receive updates from committee chairs, and plan next steps for the strategic plan and nominating committee. They will also hear updates on HUD technical assistance and recent encampment closures.

homelessnesscontinuum-of-carecharter-revisionsstrategic-planencampmentshud
Wed Mar 27, 2024

Human Relations Commission

Human Relations Commission to review Metro Finance letter

The Metro Human Relations Commission is holding an executive committee meeting with a short agenda. The only substantive item is a review of a letter from Metro Finance. The rest of the agenda is procedural, including call to order, quorum confirmation, old business, public comments, and adjournment.

human-relationsfinancemeeting
Wed Mar 27, 2024

Tax Incentive and Abatement Study and Formulating Committee

Committee reviews tax incentive policies and plans report to council

The Tax Incentive and Abatement Study and Formulating Committee is meeting to review revisions to its work based on input from the Government Finance Officers Association (GFOA). The committee will also plan its report to the Metro Council. The agenda includes discussion of tax redirects, assessment procedures, and an overall cap on incentives.

tax-incentivestax-abatementgfoacommittee-meetingnashville
Wed Mar 27, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board reviews permit applications and Déjà Vu VIP rooms

The Sexually Oriented Business Licensing Board will consider new and renewal entertainer permits and business licenses for dates from January 25 to March 27, 2024. The board will also review an inspector's report and examine Déjà vu of Nashville's floor plan showing newly built VIP rooms. Public comment and approval of prior meeting minutes are on the agenda.

sexually-oriented-businesslicensingpermitspublic-hearingnashville
Wed Mar 27, 2024

Arts Commission

Arts Commission budget committee meets for financial and legal updates

The Budget and Administrative Oversight Committee of the Metro Arts Commission is meeting to discuss financial overviews, legal and HR topics, and committee organization. The agenda includes public comment and routine administrative items, with no specific decisions or proposals listed.

artsbudgetcommitteefinancelegalpublic-comment
Wed Mar 27, 2024

Human Relations Commission

Human Relations Commission to discuss Metro Finance letter and pre-hearing prep

The Metro Human Relations Commission is holding a pre-hearing conference to discuss a letter from Metro Finance and prepare for an upcoming hearing with staff. The agenda is largely procedural, with no public hearings or votes scheduled.

human-relationscommissionpre-hearingfinance
Wed Mar 27, 2024

Nashville Education, Community and Arts Television Board

NECAT Board to vote on annual audit and approve minutes

The Nashville Education, Community and Arts Television Board will meet to vote on the annual audit and approve previous meeting minutes. The agenda also includes a chair report and board discussion.

public televisionboard meetingauditminutes
Wed Mar 27, 2024

Community Review Board

Committee discusses police department MOU

The Community Review Board's MOU Committee is meeting to discuss the memorandum of understanding (MOU) with the Metropolitan Nashville Police Department (MNPD). The meeting includes a public comment period. No votes or decisions are listed on the agenda.

community-review-boardpolicemoupublic-comment
Wed Mar 27, 2024

Continuum of Care Homelessness Planning Council

Consumer Advisory Board to set goals and brainstorm resource fairs

The Consumer Advisory Board of the Continuum of Care Homelessness Planning Council is meeting to set goals for the board and brainstorm future resource fairs and informational sessions. The agenda includes introductions and next steps.

homelessnessconsumer-advisory-boardresource-fairsplanning
Wed Mar 27, 2024

Short Term Rental Appeals Board

STR Appeals Board hears 5 cases on permit denials and primary residence rules

The board will hear five appeals from property owners seeking exceptions to short-term rental permit rules, including challenges to denials based on ownership requirements and primary residence status. One case (STR 2024-006) has been withdrawn.

short-term-rentalsappealszoninghousingpermits
Wed Mar 27, 2024

Beer Permit Board

Beer Board to decide on 15 new or changed beer permits and 2 fines

The Metro Beer Permit Board will consider 15 applications for new, changed, or special-event beer permits, including for Hank Williams Jr. Boogie Bar, The Finch Grill & Raw Bar, and a pop-up beer garden from East Nashville Beer Works. The board will also vote on $500 civil penalties against two businesses for failing to pay the annual privilege tax. An additional 17 applications are deferred indefinitely due to missing documents.

beer-permitsalcohol-regulationpublic-hearingsfinesnashville
✓ Decided: Metro Beer Board meeting cancelled due to lack of quorum

The March 27, 2024 meeting of the Metro Beer Permit Board was cancelled because no quorum was present. All items on the agenda, including applications, complaints, and administrative matters, were moved to the next meeting agenda. No decisions were made.

Tue Mar 26, 2024

Metro Action

Metro Action Finance Committee meets to review accounting policies

The Finance Committee of the Metropolitan Action Commission is holding a routine meeting to discuss accounting and financial policies and procedures. No specific actions or decisions are listed on the agenda.

financepoliciesprocedures
Tue Mar 26, 2024

Housing Trust Fund Commission

HTF Commission to vote on Round 12 grant awards and contract extensions

The Housing Trust Fund Commission will vote on grant contract extensions and amendments for several nonprofit developers, including Woodbine Community Organization, Clark UMC CDC, Urban Housing Solutions, and Affordable Housing Resources. They will also vote on Round 12 grant awards, including ARPA Co-Op and ARPA Shared Equity Homeownership contracts. Additionally, the commission will discuss and vote on policy changes for Round 13 grant funding sources and land acquisition.

housingaffordable-housinggrantsbarnes-fundarpanonprofit-developers
Mon Mar 25, 2024

Community Review Board

Community Review Board to discuss MNPD sexual misconduct policy report

The Nashville Community Review Board is holding its monthly meeting, where it will discuss an update on a policy advisory report concerning MNPD sexual misconduct and trauma-informed victim services, as well as meetings with the Mayor and Chief, a memorandum of understanding, and legal counsel matters. The meeting includes public comment, with each speaker allowed up to two minutes.

policeoversightpolicypublic-comment
Mon Mar 25, 2024

Continuum of Care Homelessness Planning Council

Committee to vote on funding priorities data report

The Data & HMIS Oversight Committees of the Nashville/Davidson County Continuum of Care will vote on a Funding Priorities Data Report. They will also discuss an Affordable Housing Data & Research Roundtable overview and the CoC Strategic Plan, focusing on priorities and capacity. Public comment is allowed on the action item.

homelessnessdatafundingaffordable-housingstrategic-planpublic-comment
Fri Mar 22, 2024

Continuum of Care Homelessness Planning Council

CoC committee chairs meet to review strategic plan and restructure committees

The Continuum of Care Joint Committee Chairs Collaborative is meeting to review the strategic plan, brainstorm distribution of responsibilities across committees, and discuss restructuring options including consolidating, redefining, dissolving, or establishing committees. The agenda also includes a check-in activity on what is going well and what needs work.

homelessnesscontinuum-of-carestrategic-planningcommittee-restructuring
Fri Mar 22, 2024

Human Relations Commission

Human Relations Commission to review nominee process and hearing procedures

The Metro Human Relations Commission is holding an executive committee meeting to discuss internal procedures, including the board nominee process, commissioner appointments for pre-hearing conferences, and a review of pre-hearing conference rules. No votes or public decisions are listed on the agenda.

human-relationscommissionproceduresappointments
Fri Mar 22, 2024

Human Relations Commission

Human Relations Commission reviews bylaws and rules

This is a procedural meeting of the Bylaws and Rules Review Ad hoc Committee to review the commission's bylaws and rules. No votes or decisions are scheduled; the agenda consists only of a call to order, quorum confirmation, new business (bylaws review), and adjournment.

human-relationsbylawsrulesprocedural
Fri Mar 22, 2024

Human Relations Commission

Human Relations Commission to review public hearing process

This is a procedural meeting of the Metro Human Relations Commission. The only substantive item is a review of the public hearing process. No votes, decisions, or public hearings are scheduled.

proceduralhuman relationspublic hearing process
Thu Mar 21, 2024

Health Board

Health board discusses urgent electronic health record replacement

The Board of Health is discussing the urgent need to replace its aging billing/documentation system (PTBMIS), which will be discontinued in September 2025. The board is being asked to advocate for and prioritize funding and procurement for a new electronic health record (EHR) system, as the current system does not collect discrete health information and its loss would reduce patient capacity and jeopardize grants.

healthelectronic-health-recordstechnologyfundingprocurement
Thu Mar 21, 2024

Emergency Communication District (E-911) Board

E-911 Board to review finances, AI call-taker training demo

The Davidson County Emergency Communication District Board will review the February 2024 financial statement, hear a public awareness update on the Rex system, and receive a demonstration of 'Angie,' an AI call-taker training solution. The meeting also includes approval of prior minutes and recognition of a cost savings achievement.

e-911emergency-communicationsfinancial-reportai-trainingpublic-awareness
Thu Mar 21, 2024

Wastewater Hearing Authority

Wastewater Hearing Authority to review industrial compliance and grease report

The Wastewater Hearing Authority is meeting to discuss updates on industrial pretreatment compliance for three permit holders and to review the annual Fats, Oils, and Grease (FOG) report. The meeting is open to the public and will include an opportunity for additional topics.

wastewaterindustrial-pretreatmentfog-reportpublic-meeting
✓ Decided: Wastewater authority reviews compliance, approves minutes

The Wastewater Hearing Authority approved the previous meeting's minutes with edits and discussed several compliance matters. No formal votes were taken on substantive items; the meeting was primarily informational, covering updates on Calypso Café, Welcome to 1979, Onsite Environmental's agreed order status, and the 2023 FOG Program Summary Report.

Thu Mar 21, 2024

Transportation Licensing Commission

TLC to hold public hearings on booting, Autura software, and entertainment transportation rules

The Transportation Licensing Commission will hold public hearings on three ordinance amendments: booting services, the Autura software system for emergency zone wreckers, and entertainment transportation rules. The commission will also review probationary conditions for Nashville Booting LLC, consider new and renewal applications for passenger vehicle and towing companies, and hear a disciplinary complaint against Apex Parking Enforcement LLC.

transportationlicensingpublic-hearingsbootingtowingentertainment-transportationpassenger-vehicles
✓ Decided: Commission defers booting ordinance, tables Autura software system

The Transportation Licensing Commission deferred consideration of a proposed ordinance to overhaul vehicle immobilization (booting) regulations until April, requesting a redlined version from Metro Legal. The commission also tabled indefinitely a proposal to modify emergency zone wrecker regulations using the Autura software system. Several consent items were approved, including new passenger vehicle for hire licenses and ending Nashville Booting LLC's probationary status.

Thu Mar 21, 2024

Zoning Appeals Board

Board to hear 7 variance and special exception cases including a triplex, restaurant with drive-thru, and church expansion

The Metropolitan Board of Zoning Appeals will consider seven cases at its March 21, 2024 meeting. Items include requests for variances in street setbacks, wall height, and building width, as well as special exceptions for a church gym/fellowship hall and an in-home daycare. One case (2024-020) has been deferred to April 4.

zoningvariancesspecial-exceptionshousingcommercialreligious-institutionnashville
Thu Mar 21, 2024

Procurement Standards Board

Procurement Standards Board hears from outgoing and new purchasing agents

This meeting of the Procurement Standards Board includes a report from outgoing Purchasing Agent Michelle Lane and an introduction of new Purchasing Agent Dennis Rowland. The board will also approve minutes and take public comment. No procurement decisions or contract awards are on the agenda.

procurementpersonnelpublic-commentmeeting-minutes
Thu Mar 21, 2024

Sports Authority Board

Sports Authority to vote on stadium parking deal and site coordination agreement

The Sports Authority Board will consider approving an amended site coordination agreement that relieves the Authority of responsibilities and removes it as a party, and a memorandum of understanding with Metro Government addressing parking on the Nissan Stadium campus. The board will also consider awarding RFQ 357261 and receive a progress report on the enclosed Nissan Stadium project.

sports-authoritynissan-stadiumparkingcontractsstadium-renovation
Wed Mar 20, 2024

Metropolitan Council

Council hears PFLAG presentation on transgender awareness and training

The Metropolitan Council is receiving a presentation from PFLAG and Jake Martino on transgender awareness and training. The meeting also includes discussion of upcoming legislation, memorializing resolutions, and community listening sessions.

transgender-awarenesslgbtqcommunity-listeningcouncil-meetingnashville
Wed Mar 20, 2024

Historic Zoning Commission

Historic Zoning Commission to review 18 permit applications, 3 violations

The Metro Historic Zoning Commission will consider 18 permit applications for new construction, additions, outbuildings, signage, and infill projects in historic overlays across Nashville. Three violation cases are on the agenda, including a demolition/show-cause at 2504 Whites Creek Pike. The meeting also includes a commissioner training session on Metro's Zero Waste Nashville program.

historic-zoningpermitsviolationsnashvillepreservation
✓ Decided: Commission denies after-the-fact demolition at 2504 Whites Creek Pike

The Metro Historic Zoning Commission denied the after-the-fact demolition of a contributing building at 2504 Whites Creek Pike, requiring any new construction to reconstruct the historic massing. It also disapproved an outbuilding at 1110 Lillian St for exceeding permitted wall heights, ordering reduction within 90 days. Several new construction and signage projects were approved with conditions, and two items were deferred.

Wed Mar 20, 2024

Metro Development and Housing Agency Board

Board evaluates executive director's 2023 performance, sets 2024 goals

The Management Review Committee of the Metro Development and Housing Agency is meeting to evaluate the Executive Director's 2023 performance and propose 2024 performance goals. The agenda also includes approval of prior meeting minutes, public comments, and discussion of next steps. This is a routine administrative meeting focused on personnel oversight.

housingperformance-reviewexecutive-directorgovernance
Wed Mar 20, 2024

Continuum of Care Homelessness Planning Council

CoC committee to review HUD scores and FY2024 funding applications

The Performance Evaluation Committee of Nashville's Continuum of Care will meet to review HUD FY2023 scores, discuss the FY2024 competition for renewal and new project applications, and hear agency spotlights from the Mary Parrish Center and The Salvation Army. The agenda includes monitoring questions, timeline review, and next steps for Urban Housing Solutions. This is a working meeting focused on planning and evaluation, not final decisions.

homelessnessfundinghudhousingcommittee
Wed Mar 20, 2024

Investment Committee

Investment Committee to review pension performance and policy

The Investment Committee of the Metropolitan Employee Benefit System will meet to consider investment recommendations, review 4th quarter 2023 pension performance, and approve an updated Investment Policy Statement. The committee will also discuss a Credit Suisse contingent convertible bonds litigation update and set meeting dates for the remainder of 2024.

pensioninvestmentemployee-benefitsfinancelitigation
✓ Decided: Investment Committee approves $65M in new fund commitments

The Investment Committee approved four new investment recommendations totaling up to $65 million, including $10 million each to two venture capital funds, $25 million to a private debt fund, and $30 million to a multifamily real estate fund. The committee also approved updates to the Investment Policy Statement, including a new requirement for an independent pension plan review every 3-5 years. The pension plan was valued at $4.2 billion at the end of Q4 2023.

Wed Mar 20, 2024

Hospital Authority Board

Hospital Authority Board meets to approve CEO performance goals

The CEO Performance Evaluation Committee is holding an ad hoc meeting. The committee will review and vote on the CEO performance goals for fiscal year 2024.

healthcaregovernment-oversightleadership
Tue Mar 19, 2024 · 6:30 PM

Metropolitan Council

Council considers $375 million bond issuance and urban density studies

The Metropolitan Council is reviewing several appointments to local commissions and various business-related resolutions. Key items include a request for technical studies on increasing land use density and the authorization of bond anticipation notes up to $375 million.

budgetzoninghousingappointmentsbusiness
Metropolitan Courthouse
Tue Mar 19, 2024

Metropolitan Council

Council committee to vote on grants for arts, parks, and a CMA Fest zone

The Public Facilities, Arts, and Culture Committee will consider several resolutions and one bill on second reading. Items include accepting grants for the Parthenon security system, Green Hills Park improvements, Warner Park headquarters renovation, and a request for a wildflower program. A bill would create a temporary special event zone downtown for CMA Fest.

parksartsgrantspublic-safetyfestivalsinfrastructure
Tue Mar 19, 2024

Farmers Market Board

Nashville Farmers' Market Board meeting on March 19, 2024

The Board will meet to approve previous meeting minutes and review market house documents. The agenda also includes consideration of sponsorship legislation and various staff reports.

farmers-marketgovernment-administrationlegislationnashville
Tue Mar 19, 2024

Metropolitan Council

Committee to vote on beer permit, STR exemptions, density study, and contracts

The Government Operations and Regulations Committee will vote on five resolutions granting exemptions from distance requirements for a beer permit at 341 Douglas Avenue and four short-term rental permits on 28th Ave N. They will also discuss a resolution requesting a comprehensive study on increasing density and affordable housing, and two sole-source contracts for software replacement and amendment.

beer-permitshort-term-rentalsdensityaffordable-housingcontractssoftwaregovernment-operations
Tue Mar 19, 2024

Metro Development and Housing Agency Board

MDHA board to vote on affordable housing gap finance awards and Park Point East construction price

The Finance and Development Committee will hear presentations on the agency's draft financial audit and first-quarter budget, then vote on two items: awarding Affordable Housing Gap Finance Program funds and approving the guaranteed maximum price for vertical construction at Park Point East. The meeting also includes approval of prior minutes and public comment.

housingaffordable-housingbudgetauditfinanceconstruction
Tue Mar 19, 2024

Metropolitan Council

Public Health & Safety Committee to vote on police use-of-force reporting, CMA Fest special zone, and three grant/acceptance items

The committee will vote on a bill requiring MNPD to report use-of-force data, a bill designating a CMA Fest special event zone downtown, and three resolutions: one accepting a grant to reimburse police overtime from the Covenant tragedy, one accepting two police horses for the mounted patrol, and one amending a VOCA grant to serve more crime victims.

policepublic-safetygrantsuse-of-forcespecial-eventscma-festhomeless-services
Tue Mar 19, 2024

Election Commission

Election Commission to certify March 5 primary results and discuss FY24-25 budget

The Davidson County Election Commission will certify the March 5, 2024 Presidential Preference Primary, County Primary, and Berry Hill Municipal Election results. They will also call a City of Oak Hill election for August 1, 2024, and discuss and approve the FY24-25 budget. Other items include a temporary waiver of accrued leave limits for employees and required harassment training.

electionbudgetcertificationoak-hillharassment-trainingleave-waiver
✓ Decided: Election Commission certifies March 5 primary results, approves FY24-25 budget

The Davidson County Election Commission certified the March 5, 2024 Presidential Preference Primary, County Primary, and Berry Hill Municipal Election results, and called the City of Oak Hill Election for August 1, 2024. The commission unanimously approved the FY24-25 Operating and Administrative Budget, which includes an additional $35,300 for postage/printing of voter registration cards and a pay increase for poll officials. It also approved a temporary waiver of maximum accrued leave limits for employees. All decisions were unanimous.

Tue Mar 19, 2024

Metro Development and Housing Agency Board

MDHA board to vote on affordable housing gap finance awards

The Metro Development and Housing Agency Board will consider approving Affordable Housing Gap Finance Program Awards. The meeting also includes public comments, committee reports, and approval of prior minutes.

affordable-housinghousingfinancepublic-comments
Tue Mar 19, 2024

Metro Development and Housing Agency Board

MDHA Housing Committee to review 2024 capital improvement priorities

The Housing and Community Committee will hear a presentation on 2024 Capital Improvement Priorities. The meeting also includes approval of previous minutes and public comments.

housingcapital-improvementspublic-comments
Tue Mar 19, 2024

Nashville Education, Community and Arts Television Board

NECAT board to vote on annual audit and minutes

The Nashville Education, Community and Arts Television (NECAT) Board is meeting to vote on the approval of meeting minutes and the annual audit, followed by a chair report and board discussion. The agenda is largely procedural with no major policy or funding decisions listed.

televisionboard-meetingauditminutes
Tue Mar 19, 2024

Public Library Board

Library Board to hear Edgehill branch overview and plan retreat

The Nashville Public Library Board of Trustees is meeting for routine business, including approving the February minutes, hearing reports from the interim director and foundation, and discussing new business. The main substantive items are an overview of the Edgehill Branch Library and planning for a board retreat. Public comments are limited to agenda items, with up to five speakers allowed.

libraryboard-meetingpublic-commentretreatedgehill-branch
Tue Mar 19, 2024

Employee Benefit Board

Board to discuss 2025 medical plan rates and pensioner dependent rules

The Metropolitan Employee Benefit Board is holding a study session to discuss three items: medical plan rates for 2025, whether pensioners can add dependents outside of a qualifying change in status, and a final report on investment policies, procedures, and practices. No votes are scheduled; this is a discussion-only meeting.

benefitsmedical-ratespensionsinvestmentsemployee-benefits
Tue Mar 19, 2024

Metropolitan Council

Committee to vote on extending election equipment contracts and filling school board vacancy

The Rules, Confirmations, and Public Elections Committee will consider two contract amendments with Election Systems and Software, LLC to extend terms by 60 months and increase value, plus a resolution supporting state legislation to rename part of Nolensville Pike. The committee will also vote on filling a School Board District 5 vacancy and several commission appointments.

electionscontractsschool-boardresolutionsappointmentsnamingrecognition
Mon Mar 18, 2024

Metropolitan Council

Committee to consider density study and east bank stadium development

The Transportation and Infrastructure Committee is discussing a resolution requesting a comprehensive study on increasing allowable density and affordable housing strategies, and a bill to declare surplus property and authorize a master development agreement for the east bank stadium campus. Other items include several sewer and water infrastructure projects and a wildflower program request.

transportationinfrastructurezoninghousingstadiumsewerwaterwildflowers
Mon Mar 18, 2024

Historical Commission

Historical Commission to hear about Hubbard House, vote on minutes

The Metro Historical Commission meets to vote on February minutes, hear a guest speaker on the Hubbard House, and receive reports on historic zoning and director's updates. Public comment is allowed for up to two minutes per speaker.

historical-commissionhistoric-preservationpublic-commenthubbard-house
✓ Decided: Commission approves February minutes; hears Hubbard House update

The Metropolitan Historical Commission unanimously approved the February 2024 meeting minutes. The commission heard a guest presentation from Robert Churchwell Jr. on the Friends of Hubbard House's efforts to rehabilitate the historic Hubbard House, including a recent grant application. No other substantive decisions were made; the meeting was largely informational.

Mon Mar 18, 2024

Metropolitan Council

Minority Caucus to vote on bylaws changes and discuss budget

The Metropolitan Council Minority Caucus is meeting to vote on proposed changes to its bylaws and to discuss the treasurer's report, which includes hiring an accountant, a proposed budget, and dues. The caucus will also review old business such as the annual reception recap and board appointments, and new business regarding the Arts Commission.

minority-caucusbylawsbudgetarts-commissionboards-and-commissions
Mon Mar 18, 2024

Metropolitan Council

Council committee to consider $375M bond notes, affordable housing, and police grants

The Budget and Finance Committee is meeting to discuss and vote on resolutions and bills, including authorizing up to $375 million in general obligation bond anticipation notes, approving a cooperation agreement with the housing agency, and accepting grants for police overtime related to the Covenant tragedy and for affordable housing construction. Several items are on the consent agenda, meaning they may be approved without discussion.

budgetfinancebondspoliceaffordable-housinggrantsstadium
Mon Mar 18, 2024

Metropolitan Council

Council committee to consider density study, affordable housing, and multiple rezonings

The Planning and Zoning Committee is discussing a resolution requesting a comprehensive analysis of code changes to increase density and incorporate affordable housing strategies, along with several rezonings and infrastructure agreements. Items include a cooperation agreement with the housing agency, a second amendment to an affordable housing grant contract, and multiple bills on second and third reading for zoning changes and public works projects.

zoningaffordable-housingdensityrezoningpublic-worksstadium-campus
Thu Mar 14, 2024

Metropolitan Council

Council Executive Committee meets for scheduling and legislative updates

The Metropolitan Council Executive Committee is meeting for administrative updates, scheduling, a software update on CouncilConnect, and a state legislative update from Morrison Strategies. No votes or public hearings are scheduled; the agenda is procedural.

administrationcouncillegislative-updateschedulingsoftware
Thu Mar 14, 2024

Planning Commission

Planning Commission to vote on mixed-use development at 6842 Highway 70 S

The Planning Commission will consider a community plan amendment and rezoning for a mixed-use development at 6842 Highway 70 S in Bellevue, along with several other rezoning and subdivision requests. Many items are recommended for deferral to later meetings. The meeting also includes consent items and reports.

zoningrezoningcommunity-plan-amendmentmixed-use-developmentmulti-family-housingsubdivisionplanning-commission
✓ Decided: Planning Commission approves 46-unit Buena Vista Pike rezoning

The Planning Commission approved a rezoning to allow 46 multi-family residential units at 2840 and 2842 Buena Vista Pike, with conditions and a prohibition on short-term rentals. It also approved a community plan amendment and rezoning for a mixed-use retreat center at 6842 Highway 70 S, and several other rezoning and development approvals. Multiple items were deferred to later meetings, and one rezoning request was withdrawn.

Thu Mar 14, 2024

Beer Permit Board

Beer Board to vote on 12 new permits, 14 deferred items, and 3 alleged violations

The Metro Beer Permit Board will consider 12 applications for new beer permits, including on-sale, off-sale, and special event permits at locations across Nashville. The board will also address 14 items deferred for missing documents, 3 complaints alleging underage sales or public safety violations, and administrative matters including unpaid privilege taxes. Public comment is limited to five speakers at two minutes each.

beer-permitsalcohol-regulationpublic-hearingscomplaintspermitsnashville
✓ Decided: Beer Board approves 12 permits, defers 15 for missing docs

The Metro Beer Permit Board unanimously approved 12 beer permit applications and indefinitely deferred 15 applications due to missing documents. The board also accepted staff recommendations for two citations, including a $2,500 penalty for a second offense of selling beer to a minor, and deferred one complaint for further investigation.

Thu Mar 14, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals; several off track including encampment plan

The Shelter Committee of the Continuum of Care Homelessness Planning Council is meeting to review current goals and metrics. Several goals are off track, including addressing inflow/outflow issues with the camp plan, adopting an affordable housing development letter to HPC, and locating document-ready barriers. The committee will also hear agency announcements and discuss a to-do list covering topics like the camp engagement plan, interim housing, and family sheltering.

homelessnessshelterencampmentaffordable-housinginterim-housingcommittee-meeting
Thu Mar 14, 2024

Community Review Board

CRB executive committee to discuss budget, bylaws, and MOU

The Community Review Board's executive committee is meeting to discuss several operational items, including an update on a public policy forum, a memorandum of understanding, bylaws and rules, a meeting with the mayor and police chief, legal counsel matters, the FY25 budget, and a complaint case update. No votes or decisions are listed on the agenda; the items are marked for discussion only.

community-review-boardbudgetbylawspolice-oversightpublic-comment
Thu Mar 14, 2024

Fair Commissioners Board

Fairgrounds board sees $234K operating loss through February

The Board of Fair Commissioners is reviewing the Nashville Expo Center at the Fairgrounds' financial report for the fiscal year ending June 30, 2024, as of February 29, 2024. The report shows a year-to-date operating loss of $234,502, which grows to $971,330 when adjusted for depreciation. Revenues are below budget, while expenses are in line with budget.

budgetfinancefairgroundsrevenueexpenses
✓ Decided: Board raises sponsorship cap to $50K, extends Metro Parks MOU

The Board of Fair Commissioners approved an amendment to raise the sponsorship money cap from $25,000 to $50,000, and approved a 5-year extension to the MOU with Metro Parks for maintenance of Fair Park Phase 1. They also approved naming the new street connecting Benton Avenue and Craighead Street as 'Coliseum Way'. The board discussed racing at the Fairgrounds but took no formal action.

Wed Mar 13, 2024

Nashville Entertainment Commission

Ad hoc job description committee to elect chair and discuss business

This is a meeting of the Ad Hoc Job Description Committee of the Nashville Music, Film, and Entertainment Commission. The agenda includes only routine procedural items: call to order, chair election, unfinished business, new business, and adjournment. No specific decisions or substantive topics are listed.

committeeproceduralentertainmentnashville
✓ Decided: Committee updates executive director job description for Nashville entertainment commission

The Ad Hoc Job Description Committee agreed to revise the draft job description for the Executive Director of Nashville's Music, Film, and Entertainment Commission, adding qualifications like equivalent professional experience and tech skills, and incorporating duties from a Memphis film commissioner role. The changes will be compiled into a new document, but it won't be official until a music commissioner provides input. No final decision was made; the committee adjourned after the discussion.

Wed Mar 13, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission Budget Committee meets March 13

The Budget Committee of the Nashville Music, Film, and Entertainment Commission is meeting on March 13, 2024. The agenda lists only call to order, unfinished business, new business, and adjournment, with no specific items described.

entertainment-commissionbudget-committeeprocedural
✓ Decided: Budget committee moves FY25 budget drafts to full commission

The Budget Committee for the Metropolitan Nashville Film and Entertainment Commission (MFEC) met and discussed the FY25 budget process. They recommended creating both a wish-list budget and a minimal budget, and nominated Max Butler to meet with Metro Finance, with Stephanie Silverman as alternate. The committee passed a motion to move three draft budgets to the full commission for approval before presenting to finance.

Wed Mar 13, 2024

Nashville Entertainment Commission

Entertainment Commission to hear committee updates on budget, bylaws, and vacancies

The Nashville Entertainment Commission is meeting to hear reports from its Budget, Bylaws, and Ad Hoc Job Description committees, along with updates on open seats and possible legislative amendments. The agenda also includes a guest speaker and public comment period, but no specific new business items are listed.

entertainmentcommissionbudgetbylawsvacancieslegislation
✓ Decided: Commission approves budget committee recommendations and interim council chairs

The Nashville Music, Film, and Entertainment Commission approved several motions, including adopting the Budget Committee's recommendations to appoint Stephanie Silverman as backup budget presenter and to prepare three draft budget proposals. It also deferred the draft job description, appointed interim chairs for three councils, and amended bylaws to allow council members to elect their own chairs. All votes were unanimous.

Wed Mar 13, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board to review new VIP rooms at Déjà vu

The board will consider new and renewal permits for entertainers and business licenses covering several periods, and review a floor plan for newly built VIP rooms at Déjà vu of Nashville. Public comment and approval of prior meeting minutes are also on the agenda.

licensingsexually-oriented-businessespermitsdeja-vunashville
Wed Mar 13, 2024

Industrial Development Board

Industrial Development Board to vote on bond resolution for Cumberland Heights Foundation

The Industrial Development Board will consider a final authorizing bond resolution for Cumberland Heights Foundation, Inc. at 8283 River Road Pike, and receive a report on a Tennessee Economic Development Grant for August Bioservices. The meeting also includes public comment, approval of prior minutes, and committee reports.

industrial-development-boardbondseconomic-developmentpublic-commentnashville
✓ Decided: Industrial Development Board approves grant amendment and bond resolution

The Board approved a Tennessee Economic Development Grant amendment for August Bioservices, allowing for increased investment and job creation. They also approved a final authorizing bond resolution for Cumberland Heights Foundation's project at 8283 River Road Pike. Both votes were unanimous with Chair Hodge abstaining. The meeting was otherwise procedural, including approval of prior minutes and scheduling the next meeting.

Wed Mar 13, 2024

Industrial Development Board

Industrial Development Board to hear economic and small business updates

The Industrial Development Board's Ad Hoc Committee will receive presentations on economic and community development from Executive Director Jamari Brown and on the state of small business in Nashville from Dr. Isaac Addae. The board will also approve prior meeting minutes and schedule the next meeting. No votes on projects or financial incentives are on the agenda.

industrial-development-boardeconomic-developmentsmall-businesspublic-comment
✓ Decided: Ad Hoc committee tables minutes and small business update

The Ad Hoc Committee of the Industrial Development Board met on March 13, 2024, but made no substantive decisions. Chair Nigel Hodge tabled approval of prior meeting minutes and the small business presentation for future meetings. The committee received an economic development update from the Mayor's Office and scheduled its next meeting for April.

Wed Mar 13, 2024

Arts Commission

Arts Commission committee reviews FY25 grant applications and panel dates

The Grants and Funding Committee will receive updates on FY24 second payments, review current grant applications and rubrics, and discuss FY25 program updates including 109 operating grant submissions and 201 Thrive artist services submissions. Panel review dates and commissioner sign-ups will also be covered.

artsgrantsfundingcommissionnashville
✓ Decided: Arts Commission pauses FY25 grant panel reviews pending FY24 clarity

The Grants and Funding Committee paused the FY25 panel review process until questions about FY24 funding are resolved. Members also passed a motion to require key officials, including finance and legal, to attend future meetings. No minutes were approved, and the October 9, 2023 minutes were deferred.

Wed Mar 13, 2024

Hospital Authority Board

Bylaws committee to review and edit hospital authority rules

The Hospital Authority Board's Bylaws Ad Hoc Committee will meet to review and propose edits to the current MNHA Bylaws. The meeting includes a conflict-of-interest disclosure opportunity for members.

hospitalbylawsgovernance
Wed Mar 13, 2024

Continuum of Care Homelessness Planning Council

Council tracks $50M homelessness investment, reviews interim housing and supportive services data

The Continuum of Care Homelessness Planning Council is reviewing the status of $50 million in homelessness investments, including interim gap housing, permanent supportive housing financing, and Housing First supportive services. The meeting covers February 2024 updates on program spending, encampment closures, and housing placement data. No new votes or decisions are scheduled; the agenda is a monitoring and information-sharing session.

homelessnesshousingfundingsupportive-servicesencampment-closuresdata-reportingnashville
Tue Mar 12, 2024

Community Review Board

Public forum on sexual misconduct and trauma-informed victim services policy

The Community Review Board is holding a public forum to discuss a proposed policy on sexual misconduct and trauma-informed victim services. The meeting includes a presentation by Research Analyst Katherine Rule and an opportunity for public comment.

community-review-boardsexual-misconducttrauma-informed-carepublic-forumvictim-services
Tue Mar 12, 2024

Fire and Building Code Appeals Board

Board hears appeal to count railroad as public way for building area

The Fire and Building Code Appeals Board will hear one appeal case at this meeting. The appellant, Paul Thompson, requests that railroad property adjacent to 4040 Jordonia Station Road be considered a public way under the 2018 IBC, which would allow additional building area. The board will also open a public comment period and approve previous meeting minutes.

fire-and-building-code-appealsappealbuilding-codezoningnashville
✓ Decided: Board approves railroad as public way for building expansion

The board approved an appeal allowing a building at 4040 Jordonia Station Road to count adjacent railroad property as a public way, enabling additional building area under the 2018 IBC. The vote was 7-0. Minutes from the January and February meetings were also approved.

Tue Mar 12, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup reviews federal criteria to end veteran homelessness

The Continuum of Care Veterans Workgroup is meeting to review data from OHS and MDHA, discuss a Built for Zero update, and evaluate progress on federal criteria and benchmarks to end veteran homelessness. The group will assess what is working, what is in process, and what needs improvement regarding resources, plans, and system capacity for veterans at risk of or experiencing homelessness.

homelessnessveteransdata-reviewfederal-criteriabuilt-for-zeronashville
Tue Mar 12, 2024

Beautification and Environment Commission

Beautification Commission discusses spring clean, Arbor Day, and waste updates

The Beautification and Environment Commission is meeting to discuss routine updates on beautification projects, the Mayor's Spring Clean initiative, Arbor Day activities, and waste management. The agenda is largely procedural with no major decisions or public hearings listed.

beautificationenvironmentspring-cleanarbor-daywastenashville
Tue Mar 12, 2024

Civil Service Commission

Civil Service Commission approves dozens of hires, promotions, and separations

The Civil Service Commission will vote on a large slate of appointments, terminations, and eligibility registers covering multiple Metro departments. The agenda includes dozens of new hires, promotions, reclassifications, and resignations across agencies such as Police, Fire, NDOT, and Water Services.

civil-servicepolicefirendotwater-servicesparkssheriffpublic-library
Mon Mar 11, 2024

Arts Commission

Arts Commission meets to discuss director's employment and legal matters

The Metro Arts Commission is holding a special called meeting with an executive session for legal advice, followed by public comment and reports. The agenda includes an outside counsel's HR report, the status of the Director's employment and absence, a finance and operations update, and a Budget & Oversight Committee report on MHRC and next steps. The meeting is primarily procedural, with no specific policy decisions or public hearings listed.

arts-commissionexecutive-sessionhuman-resourcesbudgetoversight
Mon Mar 11, 2024

Traffic and Parking Commission

Commission to decide on Herman St parking restrictions, valet zones, and bus loading

The Traffic and Parking Commission will vote on removing timed parking restrictions on Herman St due to hardships for public housing residents, authorizing a valet zone for restaurants on 12th Ave N, and a bus-only loading zone for Belmont University on Compton Ave. It will also consider a new residential permit parking area on 18th Ave S and reauthorize an existing valet zone on 2nd Ave S.

parkingvalet-zonesresidential-permit-parkingbus-loadingtraffic
✓ Decided: No quorum; all votes moved to April meeting

The March 11, 2024 meeting of the Traffic and Parking Commission was called to order but lacked a quorum, so all items requiring a vote were postponed to the April meeting. No substantive decisions were made. The commission heard a presentation on Connect Downtown recommendations and received public comment on a Belmont loading zone item.

Mon Mar 11, 2024

Charter Revision Commission

Petition to replace auto racing with affordable housing at Nashville Fairgrounds

The Charter Revision Commission is considering a voter petition to amend the Metro Charter by removing "Auto Racing" from the list of required activities at the Nashville Fairgrounds and adding "Affordable Housing" instead. The petition also corrects grammatical errors and removes an outdated reference to December 31, 2010. The proposed amendment would be submitted to voters for ratification if approved.

charter-amendmentaffordable-housingfairgroundsauto-racingpetition
✓ Decided: Charter Revision Commission certifies revised petition (7-0)

The Commission unanimously approved minutes from February 22, adopted procedures for petition-initiated Charter amendments, and certified a revised petition as compliant with the Charter. It also added written comments from two individuals to the official record. All votes were 7-0.

Mon Mar 11, 2024

Investment Committee

Investment Committee to discuss response to investment policy review

The Investment Committee of the Metropolitan Employee Benefit System will meet to consider a response to the Investment Policies, Procedures, and Practices Review, led by Treasurer Michell Bosch. The meeting also includes a public comment period and scheduling of 2024 meeting dates for quarterly reviews and an educational session.

investmentpensionemployee-benefitspublic-commentmeeting-schedule
✓ Decided: Investment Committee approves Option B for pension plan compliance overhaul

The Investment Committee unanimously approved the Treasurer and Finance Director's recommendation (Option B) to expand the investment team, build an internal compliance team, and procure a compliance software system. This multi-year effort will add seven positions over 3-4 years, including a Compliance Manager, two Senior Analysts, three Investment Managers, and one Senior Analyst. The committee also scheduled its 2024 meeting dates.

Thu Mar 7, 2024

Metropolitan Council

Committee to vote on election grant, notary elections, and resolutions on airport, daycare alarms, housing

The Rules, Confirmations, and Public Elections Committee is considering several resolutions and appointments. Items include accepting a state grant for voting system upgrades, approving notary public elections, and resolutions urging preservation of Colemere Manor at the airport, requiring carbon monoxide alarms in daycares, and supporting state legislation for affordable housing funding. The committee will also vote on appointments to various boards and commissions.

electionsgrantshistoric-preservationpublic-safetyaffordable-housingappointmentszoning
Thu Mar 7, 2024

Transportation Licensing Commission

TLC to discuss ET permit renewal process for May 2024

The Transportation Licensing Commission is holding a work session to continue discussing how to determine which ET (emergency tow) permits will be renewed at the next annual meeting in May 2024. This discussion follows amendments to chapter 6.77 by BL 2023-1869 and considers updated data from the Connect Downtown Study. No decisions or action items are on the agenda.

transportationpermitstowinglicensingdowntown
Thu Mar 7, 2024

Convention Center Authority

Convention Center Authority to discuss procurement policy and software RFP

The Convention Center Authority will consider revisions to its procurement policy and receive an operations update including tax collections and a software RFP. The meeting also includes public comment, approval of prior minutes, and other business.

convention-centerprocurementsoftwaretax-collectionspublic-comment
Thu Mar 7, 2024

Metropolitan Council

Council committee to study code changes for higher density and affordable housing

The Government Operations and Regulations Committee is considering a resolution requesting multiple city departments to study and recommend changes to the Metropolitan Code of Laws that would increase allowable density in Nashville and Davidson County, with a focus on affordable and workforce housing strategies supported by infrastructure. The committee will take action on this resolution during the meeting.

zoninghousingdensityland-useaffordable-housing
Thu Mar 7, 2024

Metropolitan Council

Library grants and greenway easements before committee

The Public Facilities, Arts, and Culture Committee will consider five resolutions accepting grants from the Nashville Public Library Foundation and the Tennessee Department of Intellectual and Developmental Disabilities for library programs and equipment, and two bills approving greenway conservation easements with Heritage Creek Homeowners Association and Clayton Properties Group. The committee will also hear a presentation from the Interim Library Director and a recap of a prior special meeting.

public-facilitiesarts-and-culturelibrarygrantsgreenwayconservation-easementdonelson-branch
Thu Mar 7, 2024

Zoning Appeals Board

Board to decide on special exception for two homes on Old Hickory Blvd

The Metropolitan Board of Zoning Appeals will hear 14 cases, including requests for special exceptions, variances, and appeals. Several items have been deferred or withdrawn. The board will decide on a special exception to allow two single-family homes at 504 Old Hickory Blvd and a variance for a drive-thru at 2629 Gallatin Pike, among others.

zoningvariancesspecial-exceptionshousingreligious-institutionssignsnashville
Thu Mar 7, 2024

Downtown Code Design Review Committee

Downtown Code Design Review Committee to discuss design guidelines

This meeting agenda presents the Downtown Code Design Guidelines, which are used to evaluate development proposals in downtown Nashville. The document outlines goals and guidelines for ecological design, human-oriented design, contextual design, and architectural quality. No specific proposals or decisions are listed; the agenda is primarily informational.

design-guidelinesdowntownzoningurban-designsustainabilitytransportation
Thu Mar 7, 2024

Metropolitan Council

Council committee to vote on opioid, HIV/AIDS, animal care grants and tow-lot fees

The Public Health and Safety Committee is meeting to consider seven grant resolutions and two bills, including accepting federal and private grants for opioid treatment, HIV/AIDS prevention, animal care, emergency management, and family safety, as well as amending tow-lot administrative fees and approving an EMT training agreement. Public comment is allowed, and the agenda includes a department update and a community review board reorganization update.

grantspublic-healthopioidsanimal-careemergency-managementfeespublic-safety
Thu Mar 7, 2024 · 6:30 PM

Metropolitan Council

Council discusses zoning changes and appointments for various boards

The Metropolitan Council is considering several zoning ordinances related to residential developments and building material restrictions. The agenda also includes multiple elections and confirmations for advisory commissions and local boards.

zoninghousinggovernmentappointmentspublic-safety
Metropolitan Courthouse
Wed Mar 6, 2024

Metropolitan Council

Committee to review MOU for Tennessee Performing Arts Center on East Bank

The Transportation and Infrastructure Committee will consider a resolution approving a memorandum of understanding for a multi-use performance space for the Tennessee Performing Arts Center on East Bank property. The agenda also includes a resolution requesting studies on increasing density and affordable housing, and 22 bills authorizing easements and infrastructure improvements for various properties.

transportationinfrastructureperforming-artsaffordable-housinggreenwaystormwatereasementszoning
Wed Mar 6, 2024

Metropolitan Council

Budget committee to vote on $2.4M for eviction legal aid, $1.6M for immigrant services

The Budget and Finance Committee will vote on 26 items, including resolutions appropriating $2,395,322 in ARPA funds for legal representation for low-income renters facing eviction and $1,630,679 for immigrant legal services. Other notable items include a $75,000 allocation for minority-owned small businesses, a $150,000 allocation for small business entrepreneurs, and a $105,000 settlement for a fire department claim. The committee will also consider a memorandum of understanding for a Tennessee Performing Arts Center on East Bank property.

budgetarpa-fundshousinglegal-aidsmall-businessperforming-artssettlement
Wed Mar 6, 2024

Continuum of Care Homelessness Planning Council

CoC Governance Charter Committee to review charter revisions

The Continuum of Care Governance Charter Committee is meeting to review current charter revisions and discuss the timeline and next steps. No decisions are recorded; the agenda is procedural.

homelessnessgovernancechartercommittee
Wed Mar 6, 2024

Stormwater Management Commission

Stormwater commission to hear 4 floodway cases, including Trimble Road violation

The Stormwater Management Commission will consider four cases involving floodway and floodway buffer disturbances, including an unpermitted structure at 3817 Trimble Road, a covered awning at 628 Georgetown Drive, a preliminary plan for Belle Meade Plaza, and a final plan for the Omohundro stream relocation. The commission will also approve prior meeting minutes and decision letters, and receive ethics training from Metro Legal.

stormwaterfloodwaypermitsconstructionenvironment
Wed Mar 6, 2024

Metropolitan Council

Planning committee to discuss Tennessee Performing Arts Center MOU

The Planning & Zoning Committee will consider a resolution approving a memorandum of understanding for a multi-use performance space for the Tennessee Performing Arts Center on East Bank property. They will also discuss a resolution requesting a comprehensive analysis of code changes to increase density and incorporate affordable housing strategies. Several bills on second and third reading involve easements, utility abandonments, and zoning changes for various properties.

planningzoningaffordable-housingartsinfrastructurerezoningeasements
Tue Mar 5, 2024

Parks and Recreation Board

Board to vote on 440 Greenway Phase II license agreement

The Parks Board will consider a 10-year renewable license agreement with the State of Tennessee for Phase II of the 440 Greenway Project, connecting Sevier Park to Gale Lane Park to Browns Creek Park at no cost to Metro. The board will also vote on accepting two grants from the Tennessee Titans totaling $40,000 for technology at McFerrin and Coleman Park community centers and for youth flag football scholarships. Other items include a $20,278 staffing grant from Centennial Park Conservancy, a lease amendment for Walk of Fame Park management, and a five-year extension for Fair Park operations.

parksgreenwaysgrantscommunity-centersyouth-programsleases
✓ Decided: Board approves 10-year license for 440 Greenway Phase II

The Board approved a 10-year renewable license agreement with the State of Tennessee for Phase II of the 440 Greenway Project, connecting Sevier Park to Gale Lane Park and Browns Creek Park. It also accepted grants from the Tennessee Titans and Centennial Park Conservancy, approved a partnership with the Jr. NBA, and deferred a greenway easement request to the Acquisition Committee.

Tue Mar 5, 2024

Parks and Recreation Board

Parks board to approve license for 440 Greenway Phase II connecting three parks

The Acquisition Committee is deciding on a 10-year renewable license agreement with the State of Tennessee to install Phase II of the 440 Greenway Project at no cost to Metro. This segment will connect Sevier Park, Gale Lane Park, and Browns Creek Park and Greenway as part of the City Central Greenway.

parksgreenwaylicense-agreementtrailsnashville
✓ Decided: Parks board approves 10-year license for 440 Greenway Phase II

The Acquisition Committee recommended approval of a 10-year renewable license agreement between Metro Nashville and the State of Tennessee, allowing Metro Parks to use a portion of the licensed premises for Phase II of the 440 Greenway Project. The recommendation covers Council Districts 17 and 25. No other substantive decisions were made.

Tue Mar 5, 2024

Employee Benefit Board

Employee Benefit Board to review disability pensions and appeals

The Metropolitan Employee Benefit Board will meet to approve minutes from February, hear appeals, and consider disability pension requests, reexaminations, and service pensions. The agenda also includes public comment, committee reports, and utilization reports from Blue Cross Blue Shield and CIGNA.

employee-benefitspensionsdisabilitypublic-commentreports
✓ Decided: Board approves disability pensions, denies 3 new requests, defers 1

The Employee Benefit Board approved one new disability pension request, denied three, and deferred one pending an injury-on-duty claim determination. It also continued several existing disability pensions, approved a change from medical to injury-on-duty status for one pensioner, and approved a social security referral. The board approved service pensions, disability-to-service conversions, option elections, QDROs, and survivor benefits as listed.

Mon Mar 4, 2024

Industrial Development Board

Public hearing on $5M bond for 256-unit workforce housing at 900 Dickerson Pike

The Industrial Development Board is holding a virtual public hearing to consider issuing up to $5 million in multifamily housing revenue bonds to finance construction of the 256-unit workforce rental facility at 900 Dickerson Pike. The bonds would be repaid solely from project revenues and do not constitute a debt of the metropolitan government. Public comments can be made by phone or submitted by email before the hearing.

housingbondspublic-hearingworkforce-housingdevelopment
Mon Mar 4, 2024

Industrial Development Board

IDB to hold public hearing on $11.9M bond for Cumberland Heights addiction facility

The Industrial Development Board will hold a virtual public hearing on a proposed $11.9 million revenue bond issue to finance a 40-bed addiction treatment facility at Cumberland Heights Foundation's main campus on River Road Pike. The hearing is required under federal tax law and allows public comment on the project and bond issuance. The bonds would be paid solely from project revenues, not from city or county taxes.

industrial-development-boardrevenue-bondspublic-hearingaddiction-treatmentcumberland-heightsnashville
Mon Mar 4, 2024

Industrial Development Board

Board to hold public hearing on $180M bond for TSU student housing

The Industrial Development Board will hold a virtual public hearing on a proposed $180 million revenue bond issue to finance an off-campus student housing project for Tennessee State University. The project includes a 720-bed residential facility with a student center and amenities at three locations near W.H. Davis Drive and W. Heiman Street. The bonds would be issued through a nonprofit borrower and are not backed by the city or state's taxing power.

industrial-development-boardpublic-hearingrevenue-bondsstudent-housingtennessee-state-universitynashville
Mon Mar 4, 2024

Human Relations Commission

Human Relations Commission to discuss Metro Arts complaint report findings

The Metro Human Relations Commission is holding its regular monthly meeting. The agenda includes routine items like approving minutes and a financial update, but the main new business is discussion of a compliance officer search, community engagement updates, and a presentation of the Metro Arts complaint report findings, which may lead to a public hearing discussion.

human-relationscommissioncompliancecommunity-engagementartspublic-hearing
Mon Mar 4, 2024

Ethical Conduct Board

Board to consider amended procedures and elect officers

The Metropolitan Board of Ethical Conduct is meeting to consider amended procedures and organization rules, receive an annual lobbyist reporting update, and elect officers for the coming year. The agenda is largely procedural, with no specific complaints or enforcement actions listed.

ethicslobbyinggovernment-procedurenashville
Mon Mar 4, 2024

Continuum of Care Homelessness Planning Council

Equity committee discusses racial equity resources and training updates

The Equity & Diversity Committee of Nashville's Continuum of Care will discuss updates to the Racial Equity Resources web page and follow up on racial equity training. They will also review strategic plan objectives proposed for the committee. The meeting includes procedural items like reading the anti-racism pledge and setting the next agenda.

homelessnessracial-equitycontinuum-of-carenashvillecommittee-meeting
Mon Mar 4, 2024

Metropolitan Council

Council committee reviews East Bank master developer deal with Fallon Company

The East Bank Council Committee is discussing the Imagine East Bank implementation, including the selection of the Fallon Company as master developer for the first 30 acres of Metro-owned land. The committee is reviewing the Master Development Agreement, lease terms, and a memorandum of understanding with the Tennessee Performing Arts Center (TPAC). Key components include affordable housing requirements, infrastructure costs, and workforce development goals.

east-bankdevelopmentaffordable-housinginfrastructuretpacworkforce-developmentnashville
Fri Mar 1, 2024

Health Board

Board of Health annual retreat reviews budget, workforce, and succession planning

The Board of Health is holding its annual retreat to discuss the department's history, organizational structure, workforce, electronic health records, budget and finance (including grants, contracts, procurement, and proposed budget), ethics training, and succession planning for critical roles. No votes or decisions are scheduled; the meeting is a discussion and update session.

board-of-healthbudgetworkforceelectronic-health-recordsethics-trainingsuccession-planningannual-retreat
Thu Feb 29, 2024

Equalization Board

Equalization Board sets 2024 appeal dates and deadlines

The Metropolitan Board of Equalization is meeting to set dates for 2024 regular and special sessions, schedule hearing officers and appeals, and establish the deadline to appeal for Tax Year 2024. The board will also approve minutes and hear public comments on agenda items. This is an administrative meeting focused on the 2024 property tax appeal process.

property-taxappealsboard-of-equalizationmeeting-dates
✓ Decided: Board approves 2024 hearing officers and appeal schedule

The Metropolitan Board of Equalization approved the minutes from four prior meetings and unanimously approved the list of 2024 residential and commercial hearing officers. The board also discussed, but did not vote on, the proposed 2024 schedule for regular and special sessions, appeal deadlines, and hearing officer start dates. No other substantive decisions were made.

Thu Feb 29, 2024

Hospital Authority Board

Hospital board to review FY25 budget, approve contracts totaling over $1M

The Finance Committee of the Metropolitan Hospital Authority Board of Trustees is meeting to review the FY25 budget, approve financial reports, and consider several contracts, including a marketing services agreement and a CT unit service agreement. The board will also receive an audit update and a revenue cycle report.

budgetcontractsfinancehospitalaudit
Thu Feb 29, 2024

Hospital Authority Board

Hospital board to vote on CEO performance, contracts worth over $1M

The Hospital Authority Board will vote on the CEO's FY23 performance evaluation and approve several contracts, including a $637,500 marketing deal and a 5-year CT service agreement. They will also receive updates on revenue, hospital utilization, and relocation plans.

hospitalcontractsbudgetCEO-evaluationmarketingpathologyimaging
Wed Feb 28, 2024

Metropolitan Council

Immigrant Caucus to discuss bylaws and Metro Human Relations Commission

This is a procedural meeting of the Immigrant Caucus. The agenda includes discussion of caucus bylaws and the Metro Human Relations Commission, followed by public comment. No specific votes or decisions are listed.

immigrant-caucusbylawshuman-relations-commissionpublic-comment
Wed Feb 28, 2024

Beer Permit Board

Beer Board to consider 25+ permit changes and 8 underage-sale complaints

The Metro Beer Board will vote on 25 applications for beer permit changes, including 14 off-sale ownership changes for Circle K stores and new on-sale permits for Dominic's Bar & Grill and Adventure Science Center. It will also hear eight complaints alleging underage beer sales at downtown venues, with staff recommending $1,500 civil penalties for seven and $1,000 for one. Additionally, an administrative hearing is scheduled for 404 Bar & Grill over alleged public health and safety violations.

beer-permitsalcohol-regulationpublic-safetycomplaintspermitsnashville
✓ Decided: Beer Board approves 26 permits, defers 15 for missing docs

The Metro Beer Board approved 26 beer permit applications, including new locations, ownership changes, and special events, and deferred 15 applications indefinitely due to missing documents. The board also accepted staff recommendations for civil penalties on eight complaints of underage sales, and deferred one administrative hearing to the next meeting.

Wed Feb 28, 2024

Short Term Rental Appeals Board

Short-term rental appeal granted for 1206A Ireland St

The Short Term Rental Appeal Board voted 2-1 to grant Toby Arceneaux's appeal (STR 2024-003) for permission to apply for a short-term rental permit earlier than normally allowed. The property is located at 1206A Ireland St in Council District 21, zoned RM20. No conditions were attached to the approval.

short-term-rentalappeals-boardzoningpermitsnashville
Wed Feb 28, 2024

Continuum of Care Homelessness Planning Council

Homelessness council discusses expanding consumer advisory board

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is meeting to review December minutes, discuss strategies for strengthening and expanding the board, and receive a status update on bylaws and collaboration with NAEH. The agenda includes identifying goals for the year ahead.

homelessnessconsumer-advisory-boardplanningnashville
Wed Feb 28, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board reviews permit applications and Déjà Vu VIP room floor plan

The board will hear public comment, approve January meeting minutes, and review new and renewal entertainer permits and business licenses for two periods in early 2024. It will also receive an inspector’s report and review Déjà vu of Nashville’s floor plan showing newly built VIP rooms.

sexually-oriented-businesslicensingpermitspublic-hearingnashville
Wed Feb 28, 2024

Hospital Authority Board

CEO Performance Evaluation for FY23

The Hospital Authority Board is meeting to discuss and approve the CEO's performance evaluation for fiscal year 2023 (July 1, 2022 – June 30, 2023). The agenda also includes standard items such as conflict of interest disclosures, mission statement review, and public comment.

hospital-authorityceo-evaluationperformance-reviewpublic-comment
Wed Feb 28, 2024

Tax Incentive and Abatement Study and Formulating Committee

Committee to review GFOA best practices on tax abatement caps

The Tax Incentive and Abatement Study and Formulating Committee will hear a presentation from Dr. Kyle Wedberg on GFOA best practices and guidance regarding caps and the general tax abatement process. The committee will also discuss a plan to present findings to the Metro Council.

tax-incentivestax-abatementgfoabest-practicescommittee-meeting
Tue Feb 27, 2024

Metropolitan Council

Women's Caucus meets with United Way, Raphah Institute guests

This is a meeting of the Nashville Metropolitan Council Women's Caucus. The agenda includes presentations from United Way representatives Brandon White and Megan Godbey, and Travis Claybrooks of the Raphah Institute, along with discussion of childcare and the Raising Readers Program. No votes or binding decisions are scheduled.

women's-caucuscommunity-programschildcareliteracy
Tue Feb 27, 2024

Sports Authority Board

Sports Authority Finance Committee to consider MLS stadium audit, FY25 budgets

The Sports Authority Finance Committee will meet to consider approving an audit of the Major League Soccer stadium construction project, the FY25 capital improvement plan for First Horizon Park, and the Authority's FY25 operating and capital budgets. The meeting also includes public comment, approval of prior meeting minutes, and an executive director's report.

sports-authorityfinancebudgetauditmls-stadiumfirst-horizon-parkcapital-improvements
Tue Feb 27, 2024

Sports Authority Board

Sports Authority to vote on enclosed football stadium design plans

The Sports Authority Board will consider approving preliminary design plans for an enclosed football stadium, along with resolutions for the FY25 operating and capital budgets, an audit of the MLS stadium construction, and a naming area at GEODIS Park. The board will also vote on granting an easement to Colonial Pipeline Company and receive a Titans stadium update.

sports-authoritystadiumbudgeteasementnaming-rightsauditcapital-improvement
Tue Feb 27, 2024

Health and Educational Facilities Board

Board to consider $413.5M in multifamily housing revenue bonds

The Health and Educational Facilities Board will hold public hearings and consider amendments to preliminary approvals for four multifamily housing revenue bond requests totaling $218.5 million, and preliminary approvals for four new requests totaling $230 million. The board will also hear public comments and review minutes from the previous meeting.

housingbondspublic-hearingmultifamilyfinance
✓ Decided: Board approves $70M Shelby House II bond increase

The Health and Educational Facilities Board approved amendments increasing revenue bond authorizations for three housing projects due to rising construction costs: Shelby House II (from $50M to $70M), Madison Station Phase I (from $50M to $65M), and Pedcor Ascent (from $35M to $38.5M, plus a term extension to Dec 31, 2025). The board also approved a term extension for St. Mary's Senior ($45M) and granted preliminary approval for four new bond issuances: North River ($55M), Trinity Flats ($55M), Artist Lofts ($85M), and Burning Tree ($35M). All resolutions passed unanimously with all members present voting affirmatively.

Tue Feb 27, 2024

Housing Trust Fund Commission

HTF Commission to vote on grant amendments and policy change for land acquisition

The Metropolitan Housing Trust Fund Commission will vote on six grant contract amendments for affordable housing projects, including extensions and schedule changes for nonprofits like Habitat for Humanity and the Mary Parrish Center. They will also vote on a policy edit for the R13 grant round regarding land acquisition. Additionally, the commission will receive updates on ARPA funds from MDHA and discuss the process for potential new appointees.

housingaffordable-housinggrantsbarnes-fundpolicynonprofitnashville
✓ Decided: HTF Commission approves grant amendments, defers land acquisition vote

The commission unanimously approved six grant contract amendments and extensions for Round 8 and Round 9 projects. A proposal to add land acquisition as an eligible cost to the Round 13 Barnes Fund grant was withdrawn and deferred to the March meeting for further discussion, with the change potentially applying to Round 14. The commission also conditionally approved the January minutes, deferring a disputed section for future discussion.

Mon Feb 26, 2024

Community Review Board

CRB to finalize Use of Force Report, discuss FY25 budget

The Community Review Board will finalize its Use of Force Report, discuss the FY25 budget, a Memorandum of Understanding (MOU), and a meeting with the Mayor and Police Chief. Public comment is also scheduled.

community-review-boarduse-of-forcebudgetpolice-oversightpublic-comment
Mon Feb 26, 2024

Historical Commission

Historical Commission to vote on marker for 1811 House in Warner Parks

The commission will vote on a historical marker for the 1811 House (Hodge House), the oldest structure in Warner Parks, and on several preservation awards. Members will also receive updates on interpretation at Sunnyside and reports from the director and historic zoning staff.

historical-markerspreservation-awardshistoric-zoningwarner-parkssunnyside
✓ Decided: Historical Commission approves 1811 House marker with conditions

The Metropolitan Historical Commission unanimously approved the text for a historical marker at the 1811 House in Percy Warner Park, with conditions to clarify the acquisition date and change 'charming' to 'historic'. The commission also approved the slate of nominees for the annual Honor Awards, including the Preservation Leadership Award to Mayor John Cooper. No public comments were made, and no other substantive decisions were taken.

Mon Feb 26, 2024

Arts Commission

Arts Commission panel selects artist for Lending Library Public Art Project

The Arts Commission's selection panel is meeting to review artist submissions and scores for the Lending Library Public Art Project. They will finalize artist selections by the end of the meeting. This is a decision-making meeting for the public art project.

public-artarts-commissionselection-panellending-library
Mon Feb 26, 2024

Continuum of Care Homelessness Planning Council

Committee to vote on funding priorities data report and new HMIS agency

The Data & HMIS Oversight Committees will vote on a funding priorities data report and a new HMIS participating agency. They will also review encampment strategy data and receive updates on the HPC retreat. The meeting includes a values and equity statement and conflict of interest disclosures.

homelessnesshmisdatafundingencampmentscontinuum-of-care
Mon Feb 26, 2024

Arts Commission

Arts Commission budget committee to review finances and legal topics

The Budget and Administrative Oversight Committee of the Metro Arts Commission will meet to organize the committee, receive a financial overview from the Director of Finance, and discuss legal and HR topics with Metro Legal. Public comment is limited to 20 minutes total, with 2 minutes per speaker.

arts-commissionbudgetfinancepublic-commentadministration
Mon Feb 26, 2024

Metropolitan Council

Metro Council Arts Committee reviews complaint report, hears from arts groups

The Public Facilities, Arts, & Culture Committee holds a special called meeting to review a past meeting, hear from the Director of Law, and receive presentations from arts organizations including Nashville Ballet, Nashville Shakespeare, and Princella Smith. The committee also discusses a non-profit BIPOC item and a Metro Arts Complaint Report presented by Davie Tucker of the Metro Human Relations Commission, followed by a presentation from Metro Arts Commission Executive Director Daniel Singh.

artsculturepublic facilitiesNashville BalletNashville ShakespearePrincella SmithBIPOCMetro Human Relations Commission
Fri Feb 23, 2024

Metro Action

Metro Action Commission annual retreat; Friday session cancelled

The Metropolitan Action Commission Board of Commissioners is holding its annual retreat on Thursday, February 22, 2024, with the Friday, February 23, 2024 session cancelled. The agenda includes a call to order, personnel committee report, executive director update, finance report, and board action items such as job descriptions and grants/contracts/MOUs. The notice also outlines appeal procedures for contested cases.

meeting-cancelledannual-retreatboard-of-commissionerspersonnelfinancegrantscontracts
Fri Feb 23, 2024

Community Review Board

Community Review Board MOU Committee meets to discuss agreement

The MOU Committee of the Community Review Board is meeting to discuss a Memorandum of Understanding. The agenda includes only a call to order, MOU discussion, and adjournment, with no specific proposals or decisions listed.

community-review-boardmoumeeting
Thu Feb 22, 2024

Charter Revision Commission

Petition seeks to replace auto racing with affordable housing at Nashville Fairgrounds

The Metro Charter Revision Commission is reviewing a voter-initiated petition to amend Sec. 11.602(d) of the Metro Charter. The proposed change would remove 'Auto Racing' from the list of required activities at the Tennessee State Fairgrounds and add 'Affordable Housing' instead. The petition also corrects grammatical errors and removes an outdated reference to December 31, 2010.

charter-amendmentfairgroundsaffordable-housingauto-racingpetition
Thu Feb 22, 2024

Planning Commission

Planning Commission to vote on 19 zoning, subdivision, and plan items

The Metropolitan Planning Commission will consider 19 items including zone changes, specific plan amendments, subdivision plats, and a community plan amendment. Several items are recommended for deferral or indefinite deferral. The commission also receives reports on downtown code initiatives, historic zoning, parks, and an executive committee update.

planning-commissionzoningsubdivisionrezoningspecific-plancommunity-plannashville
✓ Decided: Planning Commission approves multiple rezoning and subdivision requests

The Planning Commission approved several rezoning and subdivision requests, including a rezoning at 99 Thompson Lane from R10 to OR20-A-NS, a rezoning at 605 W. Due West Ave. from OG to MUL, and a code amendment to lower the historic landmark sign age threshold from 50 to 30 years. It also approved a specific plan for 41 multi-family units at 310-312 Donelson Pike with conditions, and deferred several other items to future meetings. All votes were 7-0 unless noted.

🏢 Building at this address: 6 m tall
Thu Feb 22, 2024

Convention Center Authority

Committee to review procurement policy revisions

The DBE & Development Committee of the Convention Center Authority is meeting to discuss procurement policy revisions and updates. The agenda also includes approval of minutes from a 2018 meeting and other business. Public comment is limited to six speakers at three minutes each.

procurementconvention-centercommittee-meetingpublic-comment
Thu Feb 22, 2024

Continuum of Care Homelessness Planning Council

Continuum of Care Executive Committee to discuss strategic plan, committee support, and Hermitage Camp closure

The Executive Committee of the Nashville CoC Homelessness Planning Council will review prior minutes, receive updates on board bylaws and the nominating committee, discuss next steps for the strategic plan, consider committee chair appointments and a proposed shelter committee letter, and get an update on the Hermitage Camp closure.

homelessnesscontinuum-of-carestrategic-planningbylawsshelterhermitage-camp
Thu Feb 22, 2024

Community Review Board

Executive Committee to discuss meeting with mayor, MOU, and FY25 budget

The Community Review Board Executive Committee is meeting to discuss several operational items, including a planned meeting with the Mayor and Police Chief, a Memorandum of Understanding (MOU), coordination with Metro Legal, the FY25 budget, and a complaint case update. The agenda is largely procedural and discussion-focused, with no votes or public hearings scheduled.

community-review-boardexecutive-committeebudgetpolice-oversightmoulegal
Thu Feb 22, 2024

Metro Action

Metro Action Commission holds annual retreat; Friday session cancelled

The Metropolitan Action Commission Board of Commissioners is holding its annual retreat over two days, though the Friday session is cancelled. The agenda includes a personnel committee report, an executive director update, a finance report, and board action on job descriptions and grants/contracts/MOUs. The meeting is largely procedural with no specific substantive items listed.

commission-meetingannual-retreatpersonnelfinancegrantscontracts
Wed Feb 21, 2024

Historic Zoning Commission

Historic Zoning Commission reviews 20+ permits for additions, demolitions, signage

The Metro Historic Zoning Commission will hold a public hearing on February 21, 2024, to review applications for work on properties in historic overlays, including new construction, additions, outbuildings, partial demolitions, and signage. The agenda includes a consent agenda, administrative permits, violation rehearings, and new business items on tax exemption revision and landmark signage qualifications. Two items were pulled from the agenda due to notice requirements not being met, and one was revised for an administrative permit.

historic-preservationzoningpermitsdemolitionsignageadditionsnew-construction
✓ Decided: Commission denies demolition of historic Maxwell Ave house, requires reconstruction

The Metro Historic Zoning Commission denied full demolition of the contributing house at 1003 Maxwell Ave, citing insufficient evidence of economic hardship, and allowed the Property Standards Division to demolish only as needed for health and welfare. The commission also denied a rehearing for an outbuilding violation at 3806 Central Ave, requiring the owner to correct the height violation within 180 days. Several other projects were approved with conditions, including additions at 2706 Westwood Ave, 323 50th Ave N, and 808 Powers Ave, while a rooftop addition at 215 Broadway was deferred to the March 20 meeting.

Wed Feb 21, 2024

Continuum of Care Homelessness Planning Council

CoC committee to review FY2024 competition timeline and renewal applications

The Performance Evaluation Committee will discuss the FY2024 Continuum of Care competition, including the local renewal application timeline and priority for Permanent Supportive Housing. They will also review FY2023 competition awards and hear a progress update on the Collaborative Applicant transfer. The meeting includes a values and equity statement on antiracism.

homelessnesshousingcontinuum-of-carefundingperformance-evaluationnashville
Wed Feb 21, 2024

Continuum of Care Homelessness Planning Council

Homelessness council discusses expanding consumer advisory board

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is meeting to review past minutes, discuss strategies for strengthening and expanding the board, and receive a status update on bylaws and collaboration with NAEH. The agenda includes identifying goals for the year ahead.

homelessnessconsumer-advisory-boardplanningnashville
Wed Feb 21, 2024

Health Board

Health board to discuss overdose prevention grant targeting three high-risk zip codes

The Metro Public Health Department is presenting a plan to implement the Strategic Partnership Framework (SPF) for Overdose Prevention, funded by a grant. The initiative will focus on zip codes 37207, 37208, and 37018, which have the highest overdose rates. The board is discussing this proposal at the meeting.

overdose-preventionpublic-healthsubstance-misusegrantcommunity-outreachdata-gapshealth-equity
Wed Feb 21, 2024

Employee Benefit Board

Benefit board to decide on four fire department line-of-duty medical care appeals

The Metropolitan Employee Benefit Board's In Line of Duty Committee will meet to consider four appeals or reversals of prior denials for medical care for fire department employees and pensioners. The meeting includes a public comment period.

employee-benefitsfire-departmentmedical-carepublic-commentappeals
Tue Feb 20, 2024

Metropolitan Council

Committee to consider park barn grant and mobile concert stage

The Public Facilities, Arts, and Culture Committee will discuss two resolutions: accepting an in-kind grant from Friends of Mill Ridge Park for a barn design and construction, and accepting a cooperative purchasing agreement for a mobile concert stage for the Parks Department. A presentation on the Municipal Auditorium is also scheduled.

parkspublic-facilitiesartsculturegrantsauditorium
Tue Feb 20, 2024

Metropolitan Council

Council committee to vote on resolution urging state to allow water/sewer infrastructure by resolution

The Rules, Confirmations, and Public Elections Committee will consider a resolution urging the Tennessee General Assembly to pass HB 1967/SB 2162, which would let local legislative bodies approve water and sewer infrastructure by resolution instead of ordinance. The committee will also vote on several board reappointments and an election to fill a vacancy on the Transportation Licensing Commission.

resolutionswater-and-sewerinfrastructureboard-appointmentstransportationhomeless-serviceszoning-appeals
Tue Feb 20, 2024

Metropolitan Council

Committee to vote on beer permit exemption for Skinny Dennis

The Government Operations and Regulations Committee will consider a resolution to exempt Skinny Dennis at 2635 Gallatin Avenue from minimum distance requirements for a beer permit. The committee will also vote on several sole source contracts for software and IT services, and a bill on second reading to amend outdoor construction hours.

alcohol-permitscontractsconstruction-hoursit-servicespublic-hearing
Tue Feb 20, 2024

Metropolitan Council

Council committee to consider police use-of-force reporting requirement

The Public Health and Safety Committee is meeting to discuss and vote on several resolutions accepting grants and donations for health, safety, and animal welfare programs, as well as a bill requiring the Nashville Police Department to report on use of force.

public-healthpolicegrantsanimal-controluse-of-forceemergency-managementdrug-enforcement
Tue Feb 20, 2024

Metropolitan Council

Council to vote on zoning, housing, and infrastructure items

The Planning and Zoning Committee will consider resolutions and bills on second and third reading, including affordable housing financing, a PILOT agreement for a multifamily project, and numerous infrastructure easements. The committee will also vote on zoning changes and code amendments.

zoninghousinginfrastructureeasementsaffordable-housingpublic-works
Tue Feb 20, 2024

Farmers Market Board

Board to decide on lease termination, space allocation, and handbook revision

The Nashville Farmers' Market Board will vote on a lease termination for the Natchez Trace Wine Tasting Room, consider a space allocation for Jamaicaway, and approve a temporary space agreement for Radical Shoots. They will also vote on revisions to the market house handbook and a lease amendment.

farmers-marketleasesspace-allocationhandbookpublic-comment
Tue Feb 20, 2024

Metropolitan Council

Council considers $514M bond issue, affordable housing, and grants

The Budget and Finance Committee is deciding on a $514M general obligation bond issue, amendments to affordable housing gap financing, and a PILOT agreement for a multi-family project at 500 Ocala Drive. It also reviews numerous grants and contracts for public health, safety, transportation, and technology.

budgetbondsaffordable-housinggrantstransportationpublic-safetycontracts
Tue Feb 20, 2024

Employee Benefit Board

Employee Benefit Board discusses Omada, pension, and FY2025 budget

The Metropolitan Employee Benefit Board is holding a study session to discuss three items: an update on the Omada program, annual updates on the Pension Fund and Metro Max 457 Deferred Compensation Plan, and a presentation on the Fiscal Year 2025 budget. No votes or decisions are scheduled; this is a discussion-only meeting.

employee-benefitspensionbudgetdeferred-compensationstudy-session
Tue Feb 20, 2024

Public Library Board

Library Board to hear reports, approve minutes, and view videos

The Nashville Public Library Board of Trustees will meet to hear public comments, remarks from the mayor, and reports from the interim director and foundation. They will also vote on amended minutes from November and December, and view videos on Black music history and the Wishing Chair.

libraryboard-meetingpublic-commentminutes-approvalvideo-presentation
✓ Decided: Library Board approves minutes, hears mayor affirm interim director

The Nashville Public Library Board approved the amended November 16 and December 12 meeting minutes unanimously. Mayor Freddie O'Connell affirmed the board's decision to keep Terri Luke as Interim Director and stated no new search would be conducted at this time. The board also heard public comments, including concerns about staffing and a request for information on banned books, and received reports on budget, renovations, and security.

Tue Feb 20, 2024

Metropolitan Council

Joint committee to hear capital improvements budget prioritization presentation

The joint Budget and Finance and Planning and Zoning committees are meeting for a 10-minute session to receive a presentation on Capital Improvements Budget (CIB) prioritization results. No votes or decisions are listed on the agenda; the item is informational only.

budgetcapital-improvementspresentationcommittee-meeting
Tue Feb 20, 2024

Metropolitan Council

Council committee to review transit grants, fiber franchise, and numerous water/sewer easements

The Transportation and Infrastructure Committee will consider four resolutions and 21 bills on second reading. Key items include grant applications for traffic flow improvements and transit signal priority on Gallatin Pike, a fiber optic franchise for Uniti Fiber LLC, and numerous authorizations for water and sewer line easements and acceptances across Nashville. The agenda is largely routine infrastructure approvals, with no major policy changes.

transportationinfrastructuregrantsfiber-opticseasementsstormwaterwater-sewer
Tue Feb 20, 2024 · 6:30 PM

Metropolitan Council

Metro Council considers $514 million in bonds and zoning amendments

The council will consider a resolution to issue up to $514,055,000 in general obligation bonds. The agenda also includes zoning changes for properties on Murfreesboro Pike and Royal Parkway, along with board appointments.

budgetzoninghousingpublic-healthappointments
Metropolitan Courthouse
Fri Feb 16, 2024

Human Relations Commission

Human Relations Commission discusses board nominee process and complaints

The Metro Human Relations Commission is holding an executive committee meeting to discuss the board nominee process and provide a complaints update. The agenda is largely procedural with no specific decisions or votes listed.

human-relationsboard-nominationscomplaintsprocedural
Fri Feb 16, 2024

Human Relations Commission

Human Relations Commission ad hoc committee meets to review bylaws

The ad hoc committee is meeting to conduct a review of the commission's bylaws and rules. This meeting is scheduled for February 16, 2024.

government-operationsbylawsnashville
Fri Feb 16, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission Bylaws Committee meets Feb 16

The Bylaws Committee of the Nashville Entertainment Commission is meeting to discuss unfinished and new business. The agenda contains only procedural items with no specific proposals or decisions listed.

entertainment-commissionbylawsprocedural
Fri Feb 16, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission Budget Committee meets with no listed agenda items

The Budget Committee of the Nashville Music, Film, and Entertainment Commission is holding a meeting with only procedural items: Call to Order, Unfinished Business, New Business, and Adjournment. No specific decisions, proposals, or public hearings are listed on the agenda.

entertainment-commissionbudget-committeeproceduralnashville
Fri Feb 16, 2024

Continuum of Care Homelessness Planning Council

Homelessness council to debrief Point-In-Time count and plan next steps

The Continuum of Care Homelessness Planning Council's Data/HMIS subcommittee is meeting to debrief the recent Point-In-Time (PIT) count of people experiencing homelessness. They will discuss follow-up items such as team composition, youth engagement, volunteer training, and survey methods, as well as the timing for releasing statistics and next steps. This is a working meeting focused on process and data, not on making major policy decisions.

homelessnessdatapoint-in-time-countcontinuum-of-carenashville
Fri Feb 16, 2024

Continuum of Care Homelessness Planning Council

CAB Bylaws & Compensation Plan Discussion

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is holding a special planning meeting to discuss CAB bylaws and a compensation plan, and to plan for the February 28th meeting. The agenda includes a general check-in and other business items.

homelessnessplanningbylawscompensationconsumer-advisory-board
Fri Feb 16, 2024

Nashville Entertainment Commission

Nashville Entertainment Commission meets to discuss budget, bylaws, and fill vacancies.

The Nashville Music, Film, and Entertainment Commission will hold a regular meeting on February 16, 2024. The agenda includes approval of prior meeting minutes, committee reports, and discussion items on the budget, bylaws, and filling open seats. No votes on specific projects or funding are listed.

entertainment-commissionbudgetbylawshuman-resourcesethicsopen-meetingsvacancies
Thu Feb 15, 2024

Emergency Communication District (E-911) Board

E-911 board to review AI transcription and translation tool

The Davidson County Emergency Communication District Board will review a prepared AI audio transcription and translation solution, along with the January 2024 financial statement and a public awareness update. The meeting includes approval of prior minutes and a director's report.

e-911emergency-communicationsaitechnologypublic-safetybudget
✓ Decided: E-911 Board approves $498K AI call-handling software

The board unanimously approved purchasing the Prepared Assist AI software platform for $498,000 per year, funded through cost savings without increasing the budget. They also approved an additional $11,725 for a new advertising video and authorized a public awareness survey. The financial report for January was accepted, showing a net loss of $87,180.

Thu Feb 15, 2024

District Energy System Advisory Board

District Energy Board to review budget, gas purchasing, and contractor performance

The Metro Nashville District Energy System Advisory Board will discuss customer sales, contractor performance, natural gas purchasing, FY24 costs and budget, marketing, and capital projects. The meeting includes a Metro liaison update and system operator update.

district-energybudgetnatural-gascontractor-performancecapital-projectsmarketing
Thu Feb 15, 2024

Continuum of Care Homelessness Planning Council

CoC to discuss HUD funding, $50M ARP housing funds, and committee updates

The Continuum of Care Homelessness Planning Council will receive updates on the HUD CoC Notice of Funding Opportunity and Metro's $50 million American Rescue Plan Act funding. Committee reports will cover equity, governance, consumer advisory, Point-in-Time count, and youth homelessness. The meeting also includes a board retreat report and upcoming events.

homelessnessfundinghudarphousingdatacommitteesnashville
Thu Feb 15, 2024

Transportation Licensing Commission

Taxicab permit hearings and pedicab ordinance review on TLC agenda

The Transportation Licensing Commission is meeting to hold public hearings on taxicab permit applications, including a request for 20 additional permits by TN National Cab LLC and a new company application by Regal Taxi LLC. The commission will also review an ordinance that would allow reducing pedicab and pedal carriage certificates and permits. Other business includes wrecker applications, consent items for passenger vehicle companies, a disciplinary hearing, and updates on various transportation programs.

taxicabspedicabstowinglicensingpublic-hearingordinance
✓ Decided: TLC recommends pedicab/pedal carriage renewal ordinance to Metro Council

The Transportation Licensing Commission recommended a draft ordinance to Metro Council that would change how pedicab and pedal carriage permits are renewed, allowing the commission to reduce the number of permits if it finds the current number exceeds public need. The recommendation passed 3-1-3 with three abstentions. The commission also deferred the annual taxicab hearing to May 2024, approved several new transportation licenses, and placed Nashville Booting, LLC on probation for operating without a valid permit.

Thu Feb 15, 2024

Arts Commission

Arts Commission to vote on public art guidelines and design concept

The Metro Arts Board of Commissioners will consider amendments to Temporary Art on Metro Property Guidelines and Public Art Guidelines, and vote on the Old Hickory Community Center Design Concept. The meeting also includes public comment, an artist spotlight, and updates from the Human Relations Commission and Cultural Planning.

artspublic-artguidelinescommunity-centerequity
Wed Feb 14, 2024

Historical Commission

Historical Commission to review 2024 Honor Awards nominations

The MHC Events/Special Projects/Nominations Committee will review nominations for the 2024 Honor Awards, including the Fletch Coke Award, Achievement Award, and Commissioners' Award. This committee meeting selects a slate of nominees for the full Commission to consider at its February 26 meeting, where public comment will be allowed.

historical-commissionhonor-awardsnominationsnashville
Wed Feb 14, 2024

Greenways and Open Space Commission

Greenways Commission to nominate new chair, hear project updates

The Greenways and Open Space Commission will consider minutes from October and December 2023, introduce new members, and take public comment. The commission will also nominate a new chairperson, with the option to vote at this meeting or defer to April 2024. Project updates and the Greenways for Nashville Report are on the agenda.

greenwaysopen-spaceparkspublic-commentcommission-meeting
Wed Feb 14, 2024

Continuum of Care Homelessness Planning Council

CoC Charter Committee reviews charter and consumer board bylaws

The Continuum of Care Governance Charter Committee is meeting to review the current version of its charter and a draft of the Consumer Advisory Board bylaws. They will also discuss a timeline for revisions and plan future meetings. The agenda is mostly procedural, with no specific decisions or dollar amounts listed.

homelessnessgovernancecharterbylawscontinuum-of-care
Wed Feb 14, 2024

Continuum of Care Homelessness Planning Council

Homeless Planning Council to review FY2023 CoC award and HMIS data

The Nashville-Davidson County Continuum of Care Homeless Planning Council is meeting to receive reports from the Office of Homeless Services and MDHA, review HMIS monthly data and Point-in-Time Count results, and discuss the FY2023 Continuum of Care award. The agenda is largely routine, with updates and committee reports, plus a story of progress from Nashville Rescue Mission.

homelessnesscontinuum-of-carehmispoint-in-time-counthudnashville
✓ Decided: HUD funds Nashville nearly $9.7M for homelessness programs

The council received the FY2023 Continuum of Care award of almost $9.7 million from HUD, an increase of $1.86 million over last year, funding three new programs. The council also heard reports on cold weather sheltering, HMIS data, and the Point-In-Time Count, but took no formal votes. The Collaborative Applicant transition from MDHA to OHS is still pending HUD approval.

Wed Feb 14, 2024

Arts Commission

Arts Commission antiracism committee to discuss CARE application updates

The Committee for Antiracism and Equity will discuss updates to the CARE application and schedule, along with cultural planning updates. The meeting includes public comment and approval of prior minutes.

arts-commissionantiracismequitycultural-planningpublic-comment
Wed Feb 14, 2024

Sexually Oriented Business Licensing Board (Inactive)

SOB Licensing Board meets to review permits and Déjà Vu floor plan

The board will consider new and renewal entertainer permits and business licenses, review the inspector's report, and examine Déjà Vu of Nashville's floor plan for newly built VIP rooms. The agenda is largely procedural, with no major policy decisions or financial items listed.

licensingpermitssexually-oriented-businessespublic-safetynashville
Wed Feb 14, 2024

Industrial Development Board

Board to consider tax-incentive bonds for three projects: housing, treatment center, TSU dorms

The Industrial Development Board will hold a public comment period, approve prior meeting minutes, and appoint members to an ad hoc committee. The main business is considering inducement of revenue bonds for three projects: Nashville Leased Housing Associates III (900 at Cleveland Park), Cumberland Heights Foundation (8283 River Road Pike), and NDIC Corporation (TSU Student Housing).

industrial-development-boardbondshousingstudent-housingpublic-comment
✓ Decided: Board approves three revenue bond inducements for housing projects

The Industrial Development Board approved inducement resolutions for revenue bonds for three projects: Nashville Leased Housing Associates III (Dominium) at 900 Cleveland Park, Cumberland Heights Foundation at 8283 River Road Pike, and NDIC Corporation Project 1 (Tennessee State University Student Housing). All approvals were unanimous with Chairman Hodge abstaining. The board also approved prior meeting minutes with amendments and appointed a member to an ad hoc committee.

Tue Feb 13, 2024

Civil Service Commission

Civil Service Commission to approve dozens of hires, terminations, and pensions

The Civil Service Commission will vote on a large batch of appointments, terminations/pensions, and an eligibility register report covering multiple Metro departments. The agenda includes dozens of new hires, promotions, re-hires, and class changes across agencies such as Fire, Police, NDOT, Parks, and Water Services, as well as numerous resignations and retirements.

civil-serviceappointmentsterminationspensionsfire-departmentpolice-departmentwater-services
✓ Decided: Commission approves appointments, terminations, and eligibility registers

The Civil Service Commission approved the appointments, terminations/pensions, and eligibility register report as listed, along with several human resource items including open range salary increases and job description revisions. One item, an open range salary increase for Brandon Bradford, was deferred to the next month's meeting. No public comments were made.

Tue Feb 13, 2024

Fire and Building Code Appeals Board

Board hears appeal on occupancy limit for Harding Pike building

The Board of Fire and Building Code Appeals will hear one appeal case regarding a property at 4500 Harding Pike. The appellant seeks relief from an occupancy load restriction under the 2018 International Building Code. The meeting also includes a public comment period and approval of previous minutes.

fire-codebuilding-codeappealsoccupancynashville
Tue Feb 13, 2024

Audit Committee

Audit committee to discuss MNPS capital projects, HousingNOLA report, and 2024 work plan

The Metropolitan Audit Committee will discuss follow-up on audit recommendations for Metro Nashville Public Schools capital projects, a HousingNOLA contract investigative report, and the proposed 2024 annual work plan. The committee will also elect a chairman and vice chairman, and may enter executive session for pending audits.

auditschoolshousingjuvenile-courtethicsbudgetpublic-comment
✓ Decided: Audit Committee approves 2024 audit plan with three changes

The Audit Committee approved the 2024 Annual Audit Plan with amendments to remove the Metropolitan Council Legislation Implementation and Oversight audit and add the Fire Department Fleet Maintenance and Metro Government Credit Card Spending audits. The committee also approved updating the MNPS Capital Projects audit report to include a previously rejected recommendation, and re-elected Tom Bates as Chairman and Courtney Johnston as Vice Chair.

Tue Feb 13, 2024

Metro Development and Housing Agency Board

MDHA board to vote on 5th & Summer architectural contract change

The Metro Development and Housing Agency Board will consider approving a change order for architectural services on the 5th & Summer project. The meeting also includes public comments, committee reports, and approval of prior meeting minutes.

housingdevelopmentcontractspublic-comment
Tue Feb 13, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup reviews federal benchmarks to end homelessness

The Veterans Workgroup of the Nashville/Davidson County Continuum of Care will review data from the Office of Homeless Services and the Metropolitan Development and Housing Agency, discuss the Built for Zero initiative, and evaluate progress on federal criteria to end veteran homelessness, specifically focusing on capacity to swiftly move veterans into permanent housing using Housing First principles. The meeting includes agency updates and next steps.

homelessnessveteranshousingdata-reviewcontinuum-of-care
Tue Feb 13, 2024

COVID-19 Financial Oversight Committee

Committee to review new funding for eviction counsel and immigration rights

The COVID-19 Financial Oversight Committee will consider contract amendments for MAC and MDHA affordable housing gap financing, and new funding proposals for eviction counsel from Legal Aid Society and Conexion/Hispanic Bar Association, as well as immigration rights from TIRRC/TJFON. The committee will also review allocated funds and projects for departments and nonprofit organizations.

covid-19financial-oversightaffordable-housingeviction-counselimmigration-rightscontract-amendmentsfunding-proposals
Mon Feb 12, 2024

Metropolitan Council

Council minority caucus to vote on bylaws, hear presentations

This is the agenda for the Metropolitan Council's Minority Caucus meeting, which includes routine items like approving minutes and a treasurer's report, as well as a vote on proposed bylaws changes. The caucus will also hear guest presentations from The Village and Dr. Hildreth of Meharry, and discuss old business such as the annual reception and internship.

councilbylawsbudgetpresentationsmeeting
Mon Feb 12, 2024

Traffic and Parking Commission

Commission to vote on speed limit reductions on 10 Nashville streets

The Traffic and Parking Commission will vote on a Vision Zero initiative to reduce speed limits on 10 collector and local streets, including Anderson Rd, Buena Vista Pk, and Broadmoor Dr. They will also consider two residential permit parking expansions on Dallas Ave and 26th Ave S, a right-of-way abandonment for a new football stadium, a metered space rental fee policy, and a revised valet fee policy. A discussion on parking fines is scheduled as a non-voting item.

trafficparkingspeed-limitsvision-zeroresidential-permit-parkingright-of-wayvalet-feesnashville
✓ Decided: Commission approves 10 speed limit reductions and new parking zones

The Traffic and Parking Commission approved a consent agenda including 10 speed limit reductions under the Vision Zero initiative, a new residential permit parking zone on Dallas Ave, an extension on 25th Ave S, and an updated On Street Metered Space Rental Fee Policy. The Valet Fee Policy revision was deferred indefinitely, and a bus-only parking zone request was deferred one month.

Mon Feb 12, 2024

Auditorium Commission

Auditorium Commission to review updated contract

The Metropolitan Auditorium Commission is meeting to consider an updated contract for approval, along with routine items such as minutes approval and a public comment period. The agenda also includes a report from the Musician’s Hall of Fame and Museum and staff reports.

auditoriumcontractspublic-commentmuseums
✓ Decided: Auditorium Commission approves new streamlined License Agreement

The Metropolitan Auditorium Commission approved a new License Agreement for venue rentals, replacing outdated contracts. The agreement adds options for multi-year bookings, deposits, venue maps, and additional departmental approvals. The motion passed unanimously.

Mon Feb 12, 2024

Historical Commission

Marker Committee to review Warner Park 1811 House marker text

The Marker Committee will meet to select language for a proposed historical marker for the Warner Park 1811 House. No public comment will be taken at this meeting; the full Metro Historical Commission will decide on adoption on April 17, 2023, with public comment available then.

historical-markershistoric-preservationpublic-meeting
Mon Feb 12, 2024

Arts Commission

Lending Library Public Art Project selection panel orientation

The Arts Commission is holding an orientation meeting for the selection panel of the Lending Library Public Art Project. The meeting will cover project overview, selection criteria, bias awareness training, scoring instructions, and conflict-of-interest forms.

artspublic-artselection-panellending-library
Fri Feb 9, 2024

Continuum of Care Homelessness Planning Council

Homelessness council reviews committee structure and strategic plan

The Homelessness Planning Council is reviewing a HUD technical assistance recommendation to consolidate several committees, including merging Data, HMIS Oversight, and Point-in-Time Count committees, and combining Membership, Nominating, and Governance committees. The council is also reviewing its 2023-2026 strategic plan focused on collaborative infrastructure, data collection, and ending homelessness. Several committees report ongoing work, including the Consumer Advisory Board recruiting members and the Shelter Committee addressing capacity and encampment strategies.

homelessnesscontinuum-of-carecommittee-structurestrategic-plandatashelterconsumer-advisory-board
Fri Feb 9, 2024

Metro Action

Personnel Committee to discuss succession planning

The Personnel Committee of the Metropolitan Action Commission Board of Commissioners will meet to discuss succession planning. No other substantive items are on the agenda.

personnelsuccession-planningmetropolitan-action-commission
Thu Feb 8, 2024

Beer Permit Board

Beer Board to vote on 8 new/transfer permits, defer 18 for missing docs

The Metro Beer Permit Board will consider eight applications for new or transferred beer permits, including a new location for Eden Event Center and a caterer permit for Bar Continental. Eighteen other applications are listed for deferral due to missing documents, and one request to withdraw is noted. The board will also approve minutes from the prior meeting and hear public comment.

beer-permit-boardalcohol-licensespublic-hearingnashvillepermits
Thu Feb 8, 2024

Arts Commission

Public Art Committee to vote on Old Hickory Community Center design

The Public Art Committee will consider approving the design for the Old Hickory Community Center. The meeting also includes updates on several ongoing public art projects, including Nolensville Bus Shelters, Bordeaux Gateway, Donelson Library, Permanent Supportive Housing, and Looby Community Center.

public-artcommunity-centerdesign-approvalproject-updatesnashville
✓ Decided: Arts Commission approves 'Wings of Time' artwork for Old Hickory Center

The Public Art Committee approved artist Gordon Huether's design for 'Wings of Time' at the Old Hickory Community Center. The project is ahead of schedule, with the building awaiting demolition pending contractor procurement. Other project updates were provided, including the Nolensville Bus Shelters dedication and Donelson Library installation timeline.

Thu Feb 8, 2024

Continuum of Care Homelessness Planning Council

Shelter Committee reviews goals and agency updates

The Shelter Committee is reviewing progress on current goals regarding shelter capacity and encampment plans. The meeting includes updates from various agencies and a discussion on expanding inflow and outflow capacity.

homelessnessshelterhousingencampmentspublic-policy
Thu Feb 8, 2024

Tourism and Convention Commission

Tourism commission to hear staff reports, approve old minutes

The Metro Tourism and Convention Commission meets to approve minutes from May 2023, review financial reports, and receive staff updates on marketing, sales, and research. No major decisions or public hearings are scheduled; the agenda is largely procedural.

tourismconventioncommissionfinancial-reportsstaff-reports
Thu Feb 8, 2024

Health Board

Health board hears update on $9M Woodbine clinic replacement

The Board of Health received the Director's Update covering respiratory illness trends, a TB program recovery from a freeze-related flood, and organizational updates. Key items include a $9 million capital allocation for a new Woodbine clinic and $500,000 for MACC animal shelter planning, both pending Metro Council approval.

healthbudgetcapital-spendingrespiratory-illnesstbanimal-shelterclinic
✓ Decided: Health board approves grants, contracts, and MACC job changes

The Board of Health unanimously approved the January meeting minutes, a $20,000 grant application, four grants/contracts totaling over $1.7 million, and changes to Animal Care Assistant job descriptions. No public comments were made, and no items were denied or tabled.

Thu Feb 8, 2024

Planning Commission

Planning Commission to decide on 320-unit apartment complex at 4214 Central Pike

The Nashville Planning Commission is meeting to consider a range of zoning and subdivision requests, including a proposed 320-unit multi-family development at 4214 Central Pike, which staff recommends disapproving. Several items are scheduled for deferral to the next meeting, and a consent agenda will be voted on as a block. The commission will also review contracts and reports as part of its regular business.

zoninghousingplanning-commissionsubdivisionrezoningmulti-familycontracts
✓ Decided: Planning Commission approves two Homestead Road multifamily projects

The Planning Commission approved two multifamily residential projects on Homestead Road, totaling 56 units, and approved several other rezoning and subdivision requests. The commission also deferred the 4214 Central Pike amendment to allow 320 multifamily units to a later meeting. All votes were 9-0.

🏢 Building at this address: 5 m tall
Wed Feb 7, 2024

Arts Commission

Nashville Arts Commission executive committee to discuss budget request

The Metro Arts Commission's Executive Committee is meeting to discuss a budget committee request and receive the executive director's report. The agenda includes public comment and routine business items, with no specific votes or proposals detailed.

artsbudgetpublic-commentexecutive-committee
✓ Decided: Arts Commission creates ad hoc Budget & Oversight Committee

The Executive Committee voted to establish an ad hoc committee to serve as both Budget and Oversight Committee, with the Chair appointing members. It also voted to retain Ian Myers under contract until March 30, 2024. No public comments were made, and no other substantive decisions were taken.

Wed Feb 7, 2024

Community Review Board

Community Review Board Budget Committee discusses FY25 budget

The Budget Committee of the Community Review Board is meeting to discuss the board's fiscal year 2025 budget. No specific proposals or dollar amounts are listed in the agenda.

budgetcommunity-review-boardfy25
Wed Feb 7, 2024

Property Standards and Appeals Board

Board defers demolition appeal for Eastside Ave property to Feb. 7

The Board of Property Standards and Appeals is meeting to handle routine business, including public comments and approval of minutes. The main item is a deferred appeal from property owners at 1622 Eastside Ave, who seek permission to repair a structure currently under a demolition order; the board previously postponed the case due to the appellant's illness.

property-standardsappealsdemolitionrepairsnashville
✓ Decided: Board defers demolition appeal for Eastside Ave property to April

The Board approved the minutes of the previous meeting. In old business, the Board voted to defer the appeal of property owners Helen M Woodard and Jeffrey C Pope regarding 1622 Eastside Ave to the April 3, 2024 meeting, allowing time to contact heirs through probate and to show documentation that all heirs have approved the sale of the property. The motion was approved 5-0.

Wed Feb 7, 2024

Stormwater Management Commission

Commission to hear two floodway/stream buffer cases and MS4 report

The Stormwater Management Commission will consider two cases involving disturbances to floodway and stream buffers, and receive an update on the MS4 Permit Annual Report. The meeting includes approval of previous minutes and decision letters.

stormwaterfloodwaystream-bufferpermitsnashville
Tue Feb 6, 2024

Metropolitan Council

Council committee to consider rezoning 112.76 acres along Cloverland Drive

The Rules, Confirmations, and Public Elections Committee will meet to consider several resolutions, a late-filed zoning ordinance, a bill on second reading, and multiple board appointments. The most consequential item is a late-filed ordinance to rezone properties along Cloverland Drive from R40 to RS40. The committee will also vote on appointments to various boards and commissions.

zoningappointmentsresolutionsethicshonorary
Tue Feb 6, 2024

Employee Benefit Board

Employee Benefit Board to review pension plan valuation and disability reports

The Employee Benefit Board will meet to approve minutes, hear public comments, and receive reports including the final results of the pension plan valuation and experience study, as well as utilization reports from Blue Cross Blue Shield and CIGNA. No votes on specific benefit changes are listed.

pensionemployee-benefitspublic-meetingdisabilityhealth-insurance
Tue Feb 6, 2024

Parks and Recreation Board

Parks Board to vote on $3M grant for Warner Park HQ renovation

The board will consider accepting a $3 million in-kind grant from Friends of Warner Parks for renovating and expanding the Warner Park Headquarters, plus other grants for security at the Parthenon and a new water fountain at Green Hills Park. They will also vote on a lease agreement for redeveloping the Naval Reserve Training Facility in Shelby Park and a license agreement for Phase II of the 440 Greenway. Several event permits and alcohol requests are on the consent agenda.

parksgrantsgreenwaysshelby-parkwarner-parksparthenon440-greenway
✓ Decided: Parks Board accepts $3M grant for Warner Park HQ renovation

The Board accepted an in-kind grant not to exceed $3,000,000 from the Friends of Warner Parks to fund the renovation and expansion of the Warner Park Headquarters. The Board also approved several facility use permits, including renewals for Broken Paddle Outfitters and Grow Enrichment, and accepted grants for security and park improvements. A request for a 10-year license agreement for the 440 Greenway Phase II was deferred to the Acquisition Committee.

Tue Feb 6, 2024

Parks and Recreation Board

Parks board advocacy committee meets for updates

The Advocacy Committee of the Metropolitan Board of Parks and Recreation is meeting to receive updates on advocacy and awareness of parks and recreation resources. The agenda includes a call to order, a public comment period, and adjournment, with no specific action items listed.

parksrecreationadvocacypublic-comment
✓ Decided: Parks board discusses $32M capital plan, Miracle Field funding

The Advocacy Committee met and discussed updates on staffing, the proposed FY24 Capital Spending Plan (including about $32 million for deferred maintenance), and funding possibilities for the proposed Miracle Field project. No formal decisions or votes were taken; the meeting was informational only.

Tue Feb 6, 2024

Work Release Commission

Work Release Commission approves 3 inmates, denies 2

The Work Release Commission reviewed applications for work release candidates. Three inmates were approved, two were denied, and no decisions were continued. The board discussed current charges, past history, institutional behavior, and treatment programs.

work-releasecorrectionsinmate-approvalsnashville
Tue Feb 6, 2024

Parks and Recreation Board

Staff requests easement dedications for Whites Creek and Ewing Creek Greenways

The Acquisition Committee will consider a request to approve five conservation greenway easement dedications. These easements are located at 4808, 4804, and 4800 Buena Vista Pike to allow for future expansion of the two greenway systems.

parksgreenwayseasementsland-acquisition
Tue Feb 6, 2024

Metropolitan Council

Council committee to consider video camera purchase and housing pattern book

The Government Operations and Regulations Committee is meeting to discuss two resolutions: one accepting a cooperative purchasing agreement for video cameras for the IT department, and another requesting the creation of a pattern book for medium-density housing. Public comment is allowed, but no final decisions are made at this committee level.

technologyhousingplanningpublic-safetyprocurement
Tue Feb 6, 2024

Metropolitan Council

Committee to vote on grants, leases, and Rose Park rules

The Public Facilities, Arts, and Culture Committee will vote on three items: a grant application for child and adult care food programs at 14 community centers, a lease agreement with Friends of Shelby Park for the Naval Building, and an amendment to Rose Park advisory group requirements. They will also receive information on potential renovation of Municipal Auditorium.

parkscommunity-centersgrantsleasesauditoriumchild-carefood-programs
Tue Feb 6, 2024

Fair Commissioners Board

Fair board reviews $211,672 operating loss through January

The Board of Fair Commissioners is reviewing a financial report for the Nashville Expo Center at the Fairgrounds covering July 1, 2023 through January 31, 2024. The report shows revenues of $2,313,956 against expenses of $2,525,672, resulting in a $211,672 operating loss before depreciation. The agenda is primarily a procedural financial update with no decisions or public hearings listed.

budgetfinancefairgroundsnashville
✓ Decided: Board approves fee study with 80% expo rental rate increase

The Board of Fair Commissioners approved the fee study recommendations, including an 80% increase in expo center rental rates and a 50% increase in move-in/move-out fees, to be phased in. They also approved legislation authorizing acceptance of sponsorships up to $25,000. The meeting included updates on finances, events, capital projects, and new staff introductions.

Tue Feb 6, 2024 · 6:30 PM

Metropolitan Council

Council reviews $514M bond authorization and multiple zoning ordinance changes

The Nashville Metropolitan Council will hold public hearings on four zoning ordinances, review seven board appointments, and consider resolutions for capital financing and departmental contracts. A primary resolution would authorize up to $514,055,000 in general obligation bonds to fund future capital projects, while another appropriates $22,848,000 from the General Fund Reserve for equipment and building repairs. The zoning hearings address property development standards near Gallatin Pike and Murfreesboro Pike, which could alter neighborhood density and design rules.

zoningbondsbudgetcontractsappointmentspublic-hearings
Metropolitan Courthouse
Mon Feb 5, 2024

Metropolitan Council

Joint committee to consider Fusus contract amendment for police surveillance tech

The Budget & Finance and Public Health & Safety committees will jointly hear a presentation and consider legislation (RS2024-158) to amend a sole-source contract with Fusus, Inc., increasing its value. The item is on the agenda for discussion and possible action.

policesurveillancecontractbudgetpublic-safety
Mon Feb 5, 2024

Metropolitan Council

Council committee to consider $145K donation for 12th Ave South project

The Transportation and Infrastructure Committee will review several resolutions and bills, including accepting a $145,000 donation for the 12th Avenue South Complete and Green Streets Project, approving grant applications for EV charging and traffic safety, and authorizing easements for stormwater and water projects. The agenda also includes numerous routine water and sewer infrastructure acceptances and abandonments.

transportationinfrastructuregrantseasementswatersewerzoning
Mon Feb 5, 2024

Human Relations Commission

Nashville Human Relations Commission to discuss budget, director evaluation

The Metro Human Relations Commission is holding its regular full commission meeting. The agenda includes routine items like approving minutes and a financial update, plus new business on a budget request, executive director evaluation, FUSUS, and community engagement. There will also be an update on complaints and a public comment period.

human-relationsbudgetevaluationcommunity-engagementcomplaints
✓ Decided: Commission approves executive director evaluation, requests 3 new staff positions

The Metro Human Relations Commission approved the executive director's evaluation and discussed a budget request for three new staff positions. The commission also noted the withdrawal of a resolution related to a surveillance technology contract and plans to draft resolutions on workplace discrimination related to the Gaza War and antisemitic conduct in schools. No final votes were taken on these items.

Mon Feb 5, 2024

Continuum of Care Homelessness Planning Council

CoC Equity Committee meets to discuss anti-racism pledge and equity strategies

The Continuum of Care (CoC) Equity & Diversity Committee is holding a tentative meeting to discuss racial equity resources, strategies for advancing equity in CoC-funded agencies, and collaboration with other committees. The agenda includes reading the CoC's anti-racism pledge and planning for the next meeting. No formal decisions or votes are listed.

homelessnessequitydiversityanti-racismcommittee-meeting
Mon Feb 5, 2024

Arts Commission

New commissioners onboarding session, no votes or decisions scheduled

The Metro Arts Board of Commissioners is holding a meeting focused solely on onboarding new commissioners, with time for questions and discussion. No votes, public hearings, or action items are listed on the agenda.

arts commissiononboardingpublic commentnashville
Mon Feb 5, 2024

Metropolitan Council

Council to consider $514M bond issuance and $22.8M equipment fund

The Budget and Finance Committee will review a capital spending plan and vote on resolutions including a $514 million general obligation bond issuance, a $22.8 million appropriation from the General Fund Reserve for equipment and building repairs, and several grant and contract approvals. The meeting includes public comment and covers items related to affordable housing, homeless services, and transportation.

budgetbondsfinancegrantsaffordable-housingtransportationpublic-safety
Mon Feb 5, 2024

Metropolitan Council

Council committee to review affordable housing grants, zoning changes, and infrastructure easements

The Planning and Zoning Committee will consider resolutions and bills on second and third reading, including amendments to affordable housing grant contracts, authorization for aerial encroachments, and numerous easement acquisitions for stormwater and utility projects. The agenda also includes a request for a pattern book for medium-density housing and a capital improvements budget presentation.

zoningaffordable-housingeasementsinfrastructurestormwaterencroachmentsbudget
Mon Feb 5, 2024

Metropolitan Council

Council committee reviews grants, contracts for health and homeless services

The Public Health and Safety Committee is reviewing nine resolutions and one bill, mostly involving grant approvals and contract amendments for health, emergency communications, and homeless services. Items include extending an ARPA-funded program, approving a mental health crisis center contract, and accepting grants for family planning and homeless coordination. The committee will vote on these items, which will then move to the full council.

healthhomelessnessgrantsemergency-servicespublic-safety
Fri Feb 2, 2024

Continuum of Care Homelessness Planning Council

Homelessness council meets; agenda is procedural only

This meeting of the Continuum of Care Homelessness Planning Council covers only parking logistics and facility details. No substantive decisions or discussions on homelessness policy are listed.

homelessnesscontinuum-of-careparkingprocedural
Thu Feb 1, 2024

Downtown Code Design Review Committee

Committee to consider Pinnacle skyline sign size and height modifications

The Downtown Code Design Review Committee is reviewing a request by Pinnacle to modify skyline sign size and height limits for a new sign at Nashville Yards Tower 3a. The applicant seeks a 1,279.25 SF sign (vs. 720 SF allowed) and 17' height (vs. 14' allowed). Staff recommends disapproval, citing conflicts with the approved common sign plan and lack of urban design justification.

zoningsignagedowntowndesign-review
Thu Feb 1, 2024

Convention Center Authority

Convention Center Authority to consider multiple service RFPs and carpet replacement

The board will discuss several procurement items including RFPs for insurance brokerage, snack vending, and interior landscaping services, as well as a carpet replacement project for the Karl F. Dean Grand Ballroom. An update on DBE participation and tax collections is also scheduled.

convention-centerprocurementrfpfacilitiesdbe
Thu Feb 1, 2024

Zoning Appeals Board

Zoning board approves 8 townhomes, new police precinct, and mixed-use projects

The Metropolitan Board of Zoning Appeals held a public hearing on February 1, 2024, and voted on 13 variance and special exception requests. The board granted most requests, including a height variance for 8 townhomes on Old Amqui Road, a special exception for a new police precinct on Murfreesboro Pike, and a parking reduction for a mixed-use development on Cumberland Bend. One request for a front addition on Preston Drive was denied, and several others were deferred for further review.

zoningvariancesspecial-exceptionspolice-precincttownhomesmixed-useparking
Thu Feb 1, 2024

Continuum of Care Homelessness Planning Council

CoC Charter Committee reviews charter and consumer board bylaws

The Continuum of Care Governance Charter Committee is meeting to review the current charter, discuss draft bylaws for a Consumer Advisory Board, and plan for the upcoming Homelessness Planning Council retreat on February 9. The agenda is largely procedural, focusing on governance documents and scheduling.

homelessnessgovernancecharterconsumer-advisory-boardretreat
Thu Feb 1, 2024

Behavioral Health and Wellness Advisory Council

Council to review opioid settlement RFP and HSRI report

The Behavioral Health and Wellness Advisory Council is meeting to approve December minutes, receive a mayoral report, and discuss membership and an opioid settlement RFP. They will also hear a report from HSRI. The meeting is largely procedural with updates and discussions.

behavioral-healthopioid-settlementcouncil-meetingpublic-health
Wed Jan 31, 2024

Social Services Commission

Metro Social Services board holds retreat with budget, shelter, and strategic planning updates

The Metro Social Services Board of Commissioners is holding a retreat to receive departmental updates, discuss the budget, review a new executive order, and plan for succession and strategy. Topics also include a new building and the MSS Overflow Shelter for the homeless. No votes or decisions are listed; the agenda is informational and discussion-based.

social-servicesbudgethomelessnessstrategic-planningexecutive-orderfacilities
Tue Jan 30, 2024

Metropolitan Council

Women's Caucus discusses childcare, arts funding, and restorative therapy

The Women's Caucus of the Metropolitan Council is meeting to hear from a guest, review a treasurer report, and discuss priority committees. Items under review include a restorative therapist initiative, Metro Arts funding, and a childcare initiative in Davidson County. No votes or binding decisions are scheduled.

women's-caucuschildcarearts-fundingrestorative-therapydavidson-county
Tue Jan 30, 2024

Employee Benefit Board

Employee Benefit Board Medical and Life Committee to hear two insurance appeals

The Medical and Life Committee of the Metropolitan Employee Benefit Board will meet on January 30, 2024, to hear two appeals: one regarding a pensioner's dependent's dental coverage and another concerning a self-insured Cigna HRA plan appeal for a disability pensioner from MNPS involving a peripheral nerve neurostimulator procedure. The agenda also includes a public comment period.

employee-benefitsinsurance-appealspublic-commentpensionersnashville
✓ Decided: Committee denies two benefit coverage appeals

The Medical & Life Committee denied two appeals: one from a pensioner seeking to add his spouse to dental coverage, and another from a disability pensioner's dependent seeking coverage for a nerve stimulator procedure. Both denials were approved without objection.

Tue Jan 30, 2024

Employee Benefit Board

Employee Benefit Board to discuss PPO audit and pension valuation

The Metropolitan Employee Benefit Board is holding a study session to discuss two items: a follow-up on the PPO plan claim audit and preliminary results of the pension plan valuation. No votes or decisions are scheduled; the meeting is for discussion only.

employee-benefitspensionauditnashville
Tue Jan 30, 2024

Farmers Market Board

Farmers Market Board to approve kitchen and farm shed agreements, discuss FY24 budget

The Nashville Farmers' Market Board is holding a special session to consider approving the Grow Local Commissary Kitchen handbook and agreement, as well as the 2024 Farm Shed handbooks and agreements. The board will also discuss the FY24 budget and hear the Executive Director's report. Public comments are limited to three minutes per speaker.

farmers-marketbudgetagreementspublic-commentscommissary-kitchen
Mon Jan 29, 2024

Continuum of Care Homelessness Planning Council

Data Committee to vote on funding priorities report

The Nashville/Davidson County CoC Data Committee will vote on a Funding Priorities Data Report and discuss an encampment plan survey. The meeting also includes approval of previous minutes and future agenda planning.

homelessnessdatafundingencampmentsnashville
Mon Jan 29, 2024

Community Review Board

Community Review Board to discuss MOU, bylaws, and sexual misconduct report

The Nashville Community Review Board is holding its January monthly meeting. The board will discuss a memorandum of understanding (MOU), its bylaws and rules, and receive a policy advisory report on sexual misconduct and trauma-informed victim services. Public comment is limited to two minutes per speaker.

community-review-boardpublic-safetypolice-oversightbylawssexual-misconduct
Fri Jan 26, 2024

Human Relations Commission

Human Relations Commission to evaluate executive director and review budget

The Metro Human Relations Commission is meeting to discuss new business including an executive director evaluation, a budget proposal review, and a complaints update. No decisions are recorded; the agenda lists only discussion items.

human-relationsbudgetpersonnelcomplaints
Fri Jan 26, 2024

Election Commission

Election Commission to move Bellevue early voting site due to water damage

The Davidson County Election Commission will consider approving a temporary change of the early voting location for the March 5 election from Bellevue Library to Bellevue Community Center because of water damage at the library. The commission will also approve minutes from the December 18, 2023 meeting, set the date for the Provisional Counting Board, and hear reports. The meeting is largely procedural, with the early voting location change being the only substantive item.

electionsearly-votingproceduraldavidson-county
✓ Decided: Election Commission moves early voting site due to library water damage

The Davidson County Election Commission approved moving the temporary early voting location for the March 5 election from Bellevue Library to Bellevue Community Center because of water damage. They also rescheduled the Provisional Counting Board to March 11, 2024, and approved the previous meeting's minutes. No public comments were made, and all motions passed unanimously.

Thu Jan 25, 2024

Metro Action

Metro Action Commission to review grants, contracts, and job changes

The board will consider job descriptions, position changes, and selection criteria for 2024-25, along with grants, contracts, and MOUs. They will also hear reports on programs including housing, early education, and workforce development. The meeting includes approval of prior minutes and updates from the executive director.

commission-meetinggrantscontractshousingworkforce-developmentearly-educationpersonnel
Thu Jan 25, 2024

Arts Commission

Arts Commission to vote on public art guidelines and temporary art rules

The Metro Arts Board of Commissioners will hold a regular meeting with public comment, committee reports, and several action items. Key decisions include proposed amendments to the Temporary Art on Metro Property Guidelines and Public Art Guidelines, plus approval of a Lending Library Panelists list. The meeting also features a cultural planning introduction and an update from the Metro Human Relations Commission.

artspublic-artguidelinescultural-planninghuman-relationspublic-comment
Thu Jan 25, 2024

Hospital Authority Board

Hospital board to vote on $420K CT scanner, $37.5K/month marketing contract

The board will consider approving several contracts including a 5-year, $420,000 CT scanner service agreement, a $637,500 marketing contract, and a $56,400 garden maintenance deal. They will also receive reports on hospital finances, quality, and updates on the Bordeaux clinic relocation.

contractsfinancequality-reportbordeaux-clinictelepsychiatry
Thu Jan 25, 2024

Metropolitan Council

Council executive committee to review lobbyist contract and Council Connect relaunch

The Metropolitan Council Executive Committee is meeting to discuss the State Relations & Lobbyist Contract and the relaunch of the Council Connect platform, along with general updates. The agenda is brief and procedural, with no specific dollar amounts or detailed proposals listed.

councillobbyisttechnologyprocedural
Thu Jan 25, 2024

Hospital Authority Board

Finance Committee to vote on $637,500 marketing contract

The Metropolitan Hospital Authority Finance Committee will consider approving several contracts, including a $637,500 community health marketing deal and a $420,000 CT scanner service agreement. The committee will also vote on October 2023 financial reports and minutes from prior meetings.

hospitalfinancecontractsmarketingtelepsychiatryimagingleasing
Thu Jan 25, 2024

Continuum of Care Homelessness Planning Council

CoC Homelessness Planning Council to review HUD technical assistance and restructuring

The Executive Committee of the Continuum of Care Homelessness Planning Council is meeting to review minutes, discuss board updates, and consider HUD technical assistance recommendations, including restructuring and the formation of an ad hoc committee. The agenda also includes a story on cold weather sheltering and affordable housing solutions.

homelessnesshousingcochudtechnical-assistancebylawscold-weather-sheltering
Wed Jan 24, 2024

Community Review Board

Executive Committee discusses bylaws, MOU, and FY25 budget

The Community Review Board Executive Committee is meeting to discuss internal governance items including bylaws, a memorandum of understanding (MOU), the Metro FY25 budget, and communications. A staff presentation is also scheduled. No votes or decisions are listed on the agenda.

community-review-boardbylawsbudgetmoucommunicationsexecutive-committee
Wed Jan 24, 2024

Metropolitan Council

Council LGBTQ caucus hears NashvilleLAUNCHPAD presentation, discusses mayor partnership

The Metropolitan Council's LGBTQ caucus meets to receive a presentation from NashvilleLAUNCHPAD and discuss partnership opportunities with the Mayor's Office on LGBTQ goals, board nominations, upcoming legislation, and community initiatives.

lgbtqcommunity-engagementboards-and-commissionspublic-artcrosswalktransgender-day-of-visibility
Wed Jan 24, 2024

Beer Permit Board

Beer Board to hear 17 permit applications and 3 administrative hearings on sales to minors

The Metro Beer Board will consider 17 beer permit applications, including new locations, ownership changes, and special events. The board will also hold three administrative hearings for alleged sales to minors, with recommended penalties including civil fines and suspensions.

beer-permitsalcohol-regulationpublic-hearingspermitsenforcementnashville
✓ Decided: Beer Board approves 17 permits, defers 13 for missing docs

The Metro Beer Board approved 17 beer permit applications, including new locations, ownership changes, and special events, and deferred 13 applications indefinitely due to missing documents. In administrative hearings, Daddy's Dogs Catering received a $4,500 civil penalty or 21-day suspension plus 120-day probation for two underage sale violations, and The Silo Market received a $750 penalty or 5-day suspension plus 30-day probation for a first offense. The board also discussed inspector safety but took no official action.

Wed Jan 24, 2024

Sexually Oriented Business Licensing Board (Inactive)

Board to review entertainer and business permits from Oct 2023 to Jan 2024

The Sexually Oriented Business Licensing Board will hold a routine meeting to approve minutes, review new and renewal entertainer permits and business licenses issued over several periods from October 2023 to January 2024, hear the inspector's report, and elect officers. The agenda is largely procedural, with no substantive policy decisions listed.

licensingpermitssexually-oriented-businesspublic-meeting
Wed Jan 24, 2024

Short Term Rental Appeals Board

Short-term rental appeal denied; may reapply March 11

The board heard an appeal from Rosanne Spindler for 4810 Gallatin Pike 201, seeking permission to apply for a short-term rental permit earlier than allowed. The board denied the request, with the condition that the appellant may reapply on March 11, 2024. The vote was unanimous among present members.

short-term-rentalsappealszoningpermits
Wed Jan 24, 2024

Metropolitan Council

Council committee to review equity on Metro boards

The Special Rules, Confirmations, and Public Elections Committee will receive a demographic breakdown of Metro boards and commissions and a presentation from the Human Relations Commission on equity practices. No votes or decisions are scheduled; the meeting is informational only.

equityboards-and-commissionshuman-relationsdemographics
Wed Jan 24, 2024

Arts Commission

Arts Commission CARE committee discusses roster outreach and cultural planning

The Committee for Antiracism and Equity (CARE) of the Nashville Arts Commission will meet to discuss changes since the last meeting, new roster outreach efforts, and updates on cultural planning. The meeting includes public comment and approval of prior minutes.

arts-commissionantiracismequitypublic-commentcultural-planningcommittee-meeting
Tue Jan 23, 2024 · 6:30 PM

Metropolitan Council

Metro Council considers zoning for 230 multi-family units and a fire station

The Metropolitan Council is holding a special called meeting to review several legislative items. The agenda includes public hearings for multiple zoning changes and various board appointments. The council will also consider a contract amendment for Fusus, Inc.

zoningappointmentscontractshousingpublic-hearing
Metropolitan Courthouse
Tue Jan 23, 2024

Metropolitan Council

Committee to vote on parks contracts, grants, and pump track

The Public Facilities, Arts, and Culture Committee is considering four resolutions and one late-filed resolution. Items include a sole-source contract for park furniture, a child care food program grant, an in-kind grant for a pump track at Watkins Park, a license amendment for a property on Anthes Drive, and an AmeriCorps grant agreement for Metro Arts.

parkscontractsgrantspublic-facilitiesarts-and-culturecommunity-centers
Tue Jan 23, 2024

Metropolitan Council

Council committee to vote on Fusus contract amendment, grants for victim services

The Public Health and Safety Committee will consider a resolution to increase a sole-source contract with Fusus, Inc. (RS2024-158). They will also vote on accepting a state grant for Spanish-speaking victim witness coordinators (RS2024-162), a federal grant for a Nashville Assessment Center for youth diversion (RS2024-168), and several other grants for health, homelessness, and family safety services.

public-safetygrantscontractsvictim-servicesyouth-diversionhomeland-securityhomelessness
Tue Jan 23, 2024

Metropolitan Council

Committee to vote on cybersecurity contract and short-term rental appeals

The Government Operations and Regulations Committee will consider a resolution approving a contract with the Center for Internet Security for cybersecurity services, and a bill amending the review process for appeals to the Short-Term Rental Appeals Board. Both items are up for discussion and possible action.

cybersecurityshort-term-rentalscontractsgovernment-operationspublic-safety
Tue Jan 23, 2024

Housing Trust Fund Commission

Commission to vote on Round 13 funding, contract extensions, and officer elections

The Metropolitan Housing Trust Fund Commission will vote on Round 13 funding documents, including timeline, grant policy, and funding amount, and will elect a chair and vice chair. They will also consider contract extension requests for six grantees and discuss rescinding two Round 11 grants totaling $4 million, which would be reallocated to Round 13. The commission will also discuss recording future meetings and receive a presentation on the FY2023 Barnes Annual Report.

housinggrantsfundingcontractsaffordable-housingcommission
Tue Jan 23, 2024

Metropolitan Council

Council committee to vote on opposing Education Savings Account expansion

The Rules, Confirmations, and Public Elections Committee will consider several resolutions, including one opposing the expansion of Education Savings Accounts in Tennessee, and will vote on numerous appointments to boards and commissions. The agenda also includes two late-filed resolutions requiring emergency votes, one for a grant agreement with Hands On Nashville and another authorizing legal counsel for a Title VI complaint. Most items are routine confirmations or honorary resolutions.

educationappointmentsgrantsresolutionsboards-and-commissions
Mon Jan 22, 2024

Historic Zoning Commission

Historic Zoning Commission to vote on 10 property alterations in historic overlays

The Metro Historic Zoning Commission will consider 10 applications for new construction, additions, outbuildings, and material changes in Nashville's historic overlay districts. Several items have been deferred or had notification issues, and the agenda includes a commissioner training on zero waste and historic preservation.

historic-zoningpreservationnew-constructionadditionsoutbuildingsviolationscommissioner-trainingzero-waste
✓ Decided: Commission denies third-story addition on 9th Ave S

The Metro Historic Zoning Commission unanimously denied a proposed third-story addition to a non-contributing house at 2414 9th Ave S, citing design guideline violations. The commission also approved consent items, including 16 administrative permits and several new construction projects, with conditions. Several items were deferred at the applicant's request, and one was resolved.

Mon Jan 22, 2024

Metropolitan Council

Council committee to vote on historic grants, sewer deals, and a Cheatham Place rezoning

The Planning & Zoning Committee will consider 19 items, including grants for historic preservation and cemetery surveys, several sewer and easement agreements, and a rezoning at 909-917 Cheatham Place to allow eight multi-family units. The meeting includes public comment on these legislative items.

zoninghistoric-preservationgrantssewersidewalkscemeteryeasements
Mon Jan 22, 2024

Metropolitan Council

Council briefed on East Bank deal with Fallon; rezoning, housing, TPAC

The Metropolitan Council is receiving a briefing on the status of negotiations with Fallon for the East Bank development. The presentation covers draft plans for the initial development area, including rezoning, land uses, infrastructure costs, affordable housing, and SMWBE targets. No final decisions are being made at this meeting; legislation is expected in March/April and summer.

east-bankzoningaffordable-housinginfrastructuretpacsmwbedevelopment
Mon Jan 22, 2024

Metropolitan Council

Committee to vote on stormwater fee appeals, sidewalk grant, and sewer deals

The Transportation and Infrastructure Committee will consider 19 items, including a resolution to create a stormwater capacity fee appeal process, acceptance of a TDOT grant for sidewalk construction on James Avenue/63rd Avenue North, and multiple bills authorizing sewer infrastructure agreements and easements for private developments. Several items involve contracts with specific dollar amounts or property locations.

transportationinfrastructurestormwatersidewalkssewergrantszoningpublic-works
Mon Jan 22, 2024

Metropolitan Council

Budget committee to vote on Fusus contract increase, $30K settlement, and grants

The Budget and Finance Committee is considering 34 items, including a sole-source contract amendment with Fusus, Inc., a $30,000 settlement for Joy Harris, and multiple grants for parks, courts, and health services. The committee will also vote on extending a tax incentive study and approving contracts for cybersecurity and park equipment.

budgetfinancecontractsgrantssettlementspublic-safetyparks
Mon Jan 22, 2024

Historical Commission

Historical Commission to hear speaker, review zoning report

The Metropolitan Historical Commission is meeting to vote on December minutes, hear a guest speaker from Nashville Public Television, review Robert's Rules of Order, and receive reports from the director and historic zoning staff. The agenda is largely routine, with no major decisions or public hearings listed.

historical-commissionmeetingzoningpublic-televisionrules-of-order
✓ Decided: Historical Commission approves December minutes, hears NPT and zoning updates

The Metropolitan Historical Commission unanimously approved the December 2023 meeting minutes. The meeting included a guest presentation from Nashville Public Television CEO Becky Magura, a review of Robert's Rules of Order, and updates on historic zoning and preservation awards. No substantive policy decisions were made; the actions were procedural and informational.

Fri Jan 19, 2024

Health Board

Health Board reviews COVID vaccine, emergency prep, and clinic services

This meeting covers updates on COVID vaccine, emergency preparedness, and immunizations, along with reports from various bureaus including finance, facilities, and clinical services. The agenda also includes items on notifiable diseases, STD/HIV outreach, and viral hepatitis C. No votes or decisions are explicitly listed; the agenda appears to be a review of ongoing operations.

healthcovid-19emergency-preparednessimmunizationsstd-hivclinic-servicesnashville
Fri Jan 19, 2024

Continuum of Care Homelessness Planning Council

Homelessness council agenda lists parking and facility logistics only

This agenda for the Continuum of Care Homelessness Planning Council meeting contains only logistical items about parking, emergency call stations, electric car charging, and a bus stop. No policy decisions, proposals, or public hearings are listed, making it procedural boilerplate.

parkingfacilitieshomelessnesslogistics
Thu Jan 18, 2024

Sports Authority Board

Board to vote on enclosed football stadium design plans

The Sports Authority Board will consider approving preliminary design plans for an enclosed football stadium and a 2025 capital asset management plan for First Horizon Park. The meeting includes public comment, approval of prior minutes, and updates on Titans stadium progress and GEODIS Park.

sports-authoritystadiumtitansgeodis-parkfirst-horizon-park
Thu Jan 18, 2024

Transportation Licensing Commission

Commission to decide on 42 new taxi permits and pedicab rule changes

The Transportation Licensing Commission will hold public hearings on two taxicab applications: TN National Cab LLC seeks 20 new permits, and Regal Taxi LLC requests to operate a new company with 22 vehicles. A separate hearing will consider amending city code to allow reducing pedicab and pedal carriage permits if consistent with public convenience. The commission will also review consent items for other passenger vehicle companies and discuss a ride-summary report.

transportationtaxicabspedicabspublic-hearingpermitslicensing
Thu Jan 18, 2024

Employee Benefit Board

Employee Benefit Board Medical and Life Committee to hear two insurance appeals

The Medical and Life Committee of the Metropolitan Employee Benefit Board will meet to hear two appeals: one regarding a pensioner's dependent's dental coverage and another concerning a self-insured Cigna HRA plan appeal for a disability pensioner from MNPS involving a peripheral nerve neurostimulator procedure. The meeting includes a public comment period for up to five speakers.

employee-benefitsinsurance-appealspublic-commentnashville
Thu Jan 18, 2024

Continuum of Care Homelessness Planning Council

CoC to discuss $50M ARP funding, HUD NOFO, and committee updates

The Nashville-Davidson County Continuum of Care for People Experiencing Homelessness will meet to receive committee updates, discuss a collaborative applicant transfer, and review the HUD CoC Notice of Funding Opportunity. The agenda also includes an update on Metro's $50 million American Rescue Plan Act funding and a monthly HMIS data report. No votes or decisions are explicitly listed; the meeting appears to be informational and procedural.

homelessnessfundinghudarphmiscocnashville
Thu Jan 18, 2024

Arts Commission

Arts Commission to vote on public art guidelines and temporary art rules

The Metro Arts Board of Commissioners will consider amendments to the Temporary Art on Metro Property Guidelines and the Public Art Guidelines, and will approve a lending library panelist list. The meeting also includes committee updates, a cultural planning introduction, and the executive director's report on advocacy, audit, hiring, and project delays.

arts-commissionpublic-artguidelinescultural-planningnashville
Thu Jan 18, 2024

Emergency Communication District (E-911) Board

E-911 board to review AI transcription and translation solution

The Davidson County Emergency Communication District Board will meet to approve minutes, review the December 2023 financial statement, hear a public awareness update, and receive the director's report. A key agenda item is a presentation on a prepared AI audio transcription and translation solution, which may be discussed for potential adoption.

e-911emergency-communicationtechnologyaipublic-safety
Thu Jan 18, 2024

Zoning Appeals Board

Board to hear 7 variance and special exception requests for properties across Nashville

The Metropolitan Board of Zoning Appeals will hold public hearings and deliberations on seven applications for variances or special exceptions from zoning rules. Items include requests to reduce setbacks, increase height, allow a home daycare, and modify parking requirements at specific addresses. The board will decide each case after hearing public comments.

zoningvariancesspecial-exceptionspublic-hearingnashville
Wed Jan 17, 2024

Continuum of Care Homelessness Planning Council

Homelessness council discusses expanding consumer advisory board

The Continuum of Care Homelessness Planning Council's Consumer Advisory Board is meeting to review December minutes, discuss strategies for strengthening and expanding the CAB, and receive a status update on CAB bylaws and collaboration with NAEH. The agenda includes identifying goals for the year ahead.

homelessnessconsumer-advisory-boardplanningnashville
Wed Jan 17, 2024

Metropolitan Council

East Bank Committee to hear update on Fallon Company negotiations

The Ad Hoc East Bank Committee will receive an administration update on negotiations with the East Bank Master Developer, Fallon Company. The committee will also discuss anticipated forthcoming legislation and make announcements.

east-bankdevelopmentfallon-companynegotiationslegislation
Wed Jan 17, 2024

Arts Commission

Arts Commission CARE committee to review applicants, cultural planning

The Committee for Antiracism and Equity (CARE) of the Nashville Arts Commission is meeting to discuss changes since its last meeting, review new CARE applicants, and receive updates on cultural planning. The committee will also discuss training and alignment for new members and set future meeting dates.

arts-commissionantiracismequitycultural-planningcommittee-meeting
Tue Jan 16, 2024

Metropolitan Council

Committee to vote on opposing Tennessee's Education Savings Account expansion

The Rules, Confirmations, and Public Elections Committee will consider a resolution opposing the expansion of the Education Savings Account program in Tennessee. The agenda also includes approval of notaries public, several honorary resolutions, and appointments to boards and commissions.

educationschool-choiceresolutionsappointmentsnotarieshonorary
Tue Jan 16, 2024

Metropolitan Council

Transportation committee to vote on stormwater fee appeal process

The Transportation and Infrastructure Committee is meeting to discuss and vote on 19 items, including resolutions and bills on second reading. Key items include a stormwater capacity fee appeal process, acceptance of a TDOT grant for sidewalk construction, and multiple sewer and water infrastructure agreements.

transportationinfrastructurestormwatersewersidewalksgrantsredevelopment
Tue Jan 16, 2024

Metropolitan Council

Council committee to vote on cybersecurity contract and short-term rental appeals change

The Government Operations and Regulations Committee is meeting to consider two items: a resolution approving a contract with the Center for Internet Security for cybersecurity services, and a bill amending the review process for appeals to the Short-Term Rental Appeals Board. Public comment is limited to eight minutes total, with two minutes per speaker.

cybersecurityshort-term-rentalscontractsordinancepublic-comment
Tue Jan 16, 2024

Farmers Market Board

Farmers Market Board discusses 2024 budget and handbook approvals

The Farmers' Market Board will meet to review the FY24 budget and approve handbooks for the Grow Local Commissary Kitchen and the 2024 Farm Shed. The meeting also includes an Executive Director's report and a review of December 2023 meeting minutes.

budgetfoodgovernment-operationsnashville
Tue Jan 16, 2024

Metropolitan Council

Public Health and Safety Committee reviews grants, contracts, and funding allocations

The Public Health and Safety Committee is reviewing several resolutions regarding government grants and contract amendments. Items include funding for victim witness coordinators, school oral health services, and COVID-19 health disparity responses.

public-healthjusticegrantshomelessnessemergency-managementsafety
Tue Jan 16, 2024

Metropolitan Council

Council committee reviews grants, easements, and a zoning change

The Planning and Zoning Committee is reviewing several resolutions and ordinances, including accepting grants for historic preservation and a sidewalk project, approving easements and sewer improvements, and a zoning change for multi-family housing. These items will be voted on and may proceed to the full council.

zoninghistoric-preservationsidewalkssewerseasements
Tue Jan 16, 2024

Continuum of Care Homelessness Planning Council

CoC Charter Committee to review charter and draft consumer board bylaws

The Continuum of Care Governance Charter Committee will review the current charter and a draft of Consumer Advisory Board bylaws. They will also discuss a timeline for the Homelessness Planning Council retreat on February 9. The meeting includes a values and equity statement on antiracism.

homelessnessgovernancecharterbylawsequityplanning
Tue Jan 16, 2024

Public Library Board

Library Board to hear budget preview for FY2025

The Nashville Public Library Board will meet to receive an interim director report, a foundation report, and a preview of the FY2025 budget. The agenda also includes approval of prior meeting minutes and a NECAT update. No votes on substantive policy or spending are scheduled.

librarybudgetpublic-commentboard-meeting
Tue Jan 16, 2024

Employee Benefit Board

Employee Benefit Board to discuss PPO audit and pension valuation

The Metropolitan Employee Benefit Board is holding a study session to discuss two items: a follow-up on the PPO plan claim audit and preliminary results of the pension plan valuation. No votes or decisions are scheduled; the agenda is limited to discussion items.

benefitspensionauditemployee-benefits
Tue Jan 16, 2024

Metropolitan Council

Budget committee to vote on $30K settlement, grants, and contracts

The Budget and Finance Committee will consider 32 items, including a $30,000 settlement for Joy Harris, a $25,000 grant to Meharry Medical College, and multiple grants for historic preservation, courthouse security, and homeless services. The committee also reviews contracts for cybersecurity, park equipment, and a sewer pump station for the Tennessee Stadium project.

budgetfinancegrantssettlementspublic-safetyhistoric-preservationhomeless-services
Tue Jan 16, 2024

Metropolitan Council

Council committee to review four park-related contracts and grants

The Public Facilities, Arts, and Culture Committee is meeting to review four resolutions involving Metro Parks: a sole-source contract for park equipment, a federal food program grant, an in-kind grant for a pump track, and an amendment to a license agreement. These are all under consideration, not final decisions.

parkscontractsgrantspublic-facilitiesrecreation
Tue Jan 16, 2024 · 6:30 PM

Metropolitan Council

Metropolitan Council meeting on January 16, 2024, was cancelled

The Metropolitan Council meeting scheduled for January 16, 2024, was cancelled due to inclement weather. No items were presented or discussed.

metropolitan-councilcancellation
Metropolitan Courthouse
Fri Jan 12, 2024

COVID-19 Financial Oversight Committee

Committee reviews COVID relief fund allocations and contract changes

The COVID-19 Financial Oversight Committee is meeting to review previous allocations of CARES Act and ARP funds, discuss the impact of the US Treasury's new definition of obligation on current allocations, and consider contract amendments including date extensions and scope changes for several organizations. The meeting also includes public comment and planning for a February board and committee training session.

covid-19financial-oversightcares-actarpcontract-amendmentspublic-comment
Thu Jan 11, 2024

Planning Commission

Planning Commission to consider multiple rezoning and development proposals

The Nashville Planning Commission will hold a regular meeting to consider a variety of zoning changes, subdivision plats, and community plan amendments. Several items are recommended for deferral to future meetings, while others are slated for approval or consent. The meeting includes public hearings on each item.

zoningrezoningplanning-commissionhousingdevelopmentsubdivisioncommunity-plan
✓ Decided: Planning Commission approves multiple rezoning and development requests

The Nashville Planning Commission approved several rezoning requests and development plans, including a 249-unit mixed-use development on Charlotte Pike and a 24-unit multifamily project on Solley Drive. Multiple items were deferred to future meetings, and the commission also approved a zoning ordinance amendment and various administrative items.

🏢 Building at this address: 6 m tall
Thu Jan 11, 2024

Continuum of Care Homelessness Planning Council

Shelter committee reviews goals, encampment plan, and winter shelter status

The Shelter Committee is meeting to review progress on its current goals, including shelter capacity, encampment plans, and affordable housing advocacy. They will also hear agency announcements and discuss next steps on items like the revised encampment plan and voucher utilization.

homelessnessshelterencampmentaffordable-housingwinter-shelter
Thu Jan 11, 2024

Investment Committee

Investment Committee to review policies and elect officers

The Metropolitan Employee Benefit System Investment Committee will meet to elect officers, approve prior meeting minutes, and receive a legal rules refresher. The main agenda item is a 60-minute review of investment policies, procedures, and practices by The Hackett Group. The committee will also set meeting dates for 2024.

investmentpensionemployee-benefitspoliciesmeeting-dates
✓ Decided: Investment Committee accepts Hackett Group review, elects Crumbo chair

The Investment Committee unanimously elected Kevin Crumbo as chair and approved the November 30, 2023 minutes. The Hackett Group presented a review of investment policies and practices, including 12 observations and recommendations, and three options for improving processes. The committee unanimously accepted the report but took no action on the recommendations or options.

Thu Jan 11, 2024

Health Board

Health Board hears behavioral health system assessment and grant updates

The Board of Health received updates on behavioral health grants, an opioid care RFP, and a system assessment by HSRI. The assessment found that existing resources are not maximized, workforce shortages hamper performance, and a proactive, trauma-informed system is needed. No votes or decisions were taken; the items were presented for discussion.

behavioral-healthgrantsopioidspublic-healthworkforcetrauma-informed-careharm-reduction
Thu Jan 11, 2024

Metro Action

Personnel committee to discuss executive director search firm

The Personnel Committee of the Metropolitan Action Commission is meeting to discuss the executive director search firm and next steps. The agenda is brief and procedural, with no specific actions or decisions listed.

personnelexecutive-searchcommission
Thu Jan 11, 2024

Sports Authority Board

Sports Authority to review new Nissan Stadium design progress

The Sports Authority Board of Directors will hold a public work session to review the design progress of the new Nissan Stadium. The agenda includes only this review item, along with routine call to order and adjournment. Public comments are allowed on agenda items, with prior registration required.

sports-authoritystadiumdesign-reviewpublic-meeting
Thu Jan 11, 2024

Arts Commission

Arts Commission to vote on public art guidelines amendment and lending library panel

The Public Art Committee will consider recommending an amendment to the Public Art Guidelines and approve a selection panel for the Lending Library. The meeting also includes updates on several projects, including the Arthur Avenue, Looby Mural, and Permanent Supportive Housing contracts, the Old Hickory Community Center design phase, and the Nashville Fairgrounds installation scheduled for mid-February.

public-artguidelineslending-librarymuralscommunity-centers
✓ Decided: Arts Commission expands Public Art Committee to nine members

The Public Art Committee approved three amendments to the Public Art Guidelines: expanding the committee from seven to nine members, removing the requirement that the committee approve selection panel members, and increasing the number of visual artists on selection panels from one to two. The Lending Library selection panel approval was not voted on because the committee no longer needs to approve selection panels. No other substantive decisions were made.

Thu Jan 11, 2024

Beer Permit Board

Beer Board to review 47 permit applications and 13 alleged underage sale violations

The Metro Beer Permit Board will consider 47 beer permit applications, mostly Mapco Express ownership changes, plus several new locations and name changes. It will also hear 13 complaints alleging sales of beer to minors, with staff recommending civil penalties ranging from $1,500 to $3,000. Four applications are deferred for missing documents. The meeting includes public comment and approval of prior minutes.

beer-permitsalcohol-regulationpublic-safetypermitscomplaintspenalties
✓ Decided: Beer Board approves 47 permits, fines 13 businesses for underage sales

The Metro Beer Permit Board unanimously approved 47 beer permit applications, including 39 Mapco Express ownership changes, and deferred 4 applications indefinitely due to missing documents. The board also unanimously accepted staff recommendations for civil penalties against 13 businesses for alleged underage beer sales, with fines ranging from $1,500 to $3,000.

Wed Jan 10, 2024

Continuum of Care Homelessness Planning Council

Council to vote on Point-in-Time count methodology

The Continuum of Care Homelessness Planning Council will review and vote on the Point-in-Time Count methodology, which determines how the annual homeless count is conducted. The meeting also includes updates from the Office of Homeless Services and MDHA, as well as discussions on the Consumer Advisory Board bylaws and outdoor housing strategy.

homelessnesspoint-in-time-counthousingcocnashville
Wed Jan 10, 2024

Industrial Development Board

Industrial Development Board to elect officers, review revenue bond policies

The Industrial Development Board will hold a public comment period, approve prior meeting minutes, elect officers, update bylaws, receive ethics training from Metro Legal, and discuss revenue bond policies and applications.

industrial-development-boardofficer-electionsbylawsethics-trainingrevenue-bondspublic-comment
✓ Decided: IDB elects officers, approves revenue bond policies and $5,000 fee

The Industrial Development Board approved corrected September minutes, elected officers for 2024, amended bylaws for meeting dates, and approved revenue bond policies and application procedures, including a proposed $5,000 fee. Chair Hodge abstained from most votes.

Wed Jan 10, 2024

Tax Incentive and Abatement Study and Formulating Committee

Committee discusses GFOA input on tax abatement cap and process

The Tax Incentive and Abatement Study and Formulating Committee is meeting to discuss input from the Government Finance Officers Association (GFOA) on a cap and the general tax abatement process. The committee will also consider a resolution to extend its work to April and plan a presentation to the Metro Council.

tax-abatementgfoaincentivescommitteenashville
Wed Jan 10, 2024

Sexually Oriented Business Licensing Board (Inactive)

Sexually Oriented Business Licensing Board to review permits and elect officers

The board will consider new and renewal entertainer permits and business licenses for several periods from October 2023 through January 2024, hear an inspector's report, and elect officers. The meeting is largely procedural, with no major policy changes or public hearings on the agenda.

licensingpermitssexually-oriented-businessboard-meetingnashville
Tue Jan 9, 2024

Civil Service Commission

Civil Service Commission to consider extending MNPD officer's injury leave

The Metropolitan Civil Service Commission is meeting to consider a request from MNPD employee Gary Bridgeman to extend his Injury On Duty (IOD) time under Civil Service Rule 4.8 D. This is the only substantive item on the late item agenda.

civil-servicepoliceinjury-leavepersonnel
✓ Decided: Civil Service Commission approves appointments, terminations, and HR items

The Metropolitan Civil Service Commission approved the appointments, terminations/pensions, and eligibility register report as listed, along with several human resource items including salary increases, an order of dismissal, injury-on-duty extensions, equity adjustments, and job description revisions. All motions were approved without objection by the commissioners present; Commissioner Sanders was absent.

Tue Jan 9, 2024

Metro Development and Housing Agency Board

MDHA board to approve $1.6M HOPWA grant, PILOT, vouchers

The MDHA Board of Commissioners will consider several items, including a $1,626,609 HOPWA grant to Nashville Cares for housing assistance for low-income people with HIV/AIDS, a PILOT agreement for a 90-unit affordable housing complex, project-based vouchers for a new 240-unit development, and administrative policies. The board will also vote on a union MOU and HR policy updates.

housinggrantsaffordable-housingpilotvoucherslaborpolicy
Tue Jan 9, 2024

Fair Commissioners Board

Fairgrounds board reviews preliminary 2023 finances showing $1.9M revenue vs $2.4M expenses

The Board of Fair Commissioners reviewed a preliminary financial report for the Nashville Fairgrounds through December 2023. Revenue totaled $1,902,105 against expenses of $2,366,255, resulting in a loss of $464,150 before depreciation. The report is marked as not final.

fairgroundsbudgetfinancenashville
Tue Jan 9, 2024

Metro Development and Housing Agency Board

MDHA board to vote on SEIU union MOU, employee code of conduct

The Human Resources Committee will consider and recommend approval of a Memorandum of Understanding with SEIU Local 205, an updated Employee Code of Conduct, and revisions to the Human Resources Policy. These items require full board action in January.

housinglaborhuman-resourcespolicy
Tue Jan 9, 2024

Continuum of Care Homelessness Planning Council

Veterans workgroup reviews criteria to end veteran homelessness

The Continuum of Care Veterans Workgroup is meeting to review minutes, discuss data from the Office of Homeless Services, and work on federal criteria and benchmarks to end veteran homelessness. The group will also consider a request to change the meeting location.

homelessnessveteranscontinuum-of-carenashvillehousingshelter
Tue Jan 9, 2024

Parks and Recreation Board

Parks board to consider naming tennis court after Deborah Armour

The board will vote on naming a tennis court at Centennial Sportsplex after Deborah Armour, approve several event permits and renewals, and accept a $1.5M in-kind grant for a barn at Mill Ridge Park. The agenda also includes consent items for amplification, alcohol, and fundraising permits for various park events.

parksrecreationnaminggreenwaysgrantspermitsevents
Tue Jan 9, 2024

Fire and Building Code Appeals Board

Board hears appeal for alternative fireproofing on 4-story building

The Fire and Building Code Appeals Board will hear an appeal from Shelby House 1, LP regarding a 4-story multi-family building at 405 S 4th Street. The appellant seeks approval to use a 1-hour fireproofing assembly for steel beams and columns in lieu of standard UL assemblies, as reviewed by a third-party engineer. The case was deferred from the December 12, 2023 meeting. The board will also hold a public comment period and approve previous meeting minutes.

fire-codebuilding-codeappeals-boardfireproofingmulti-familynashville
Tue Jan 9, 2024

Parks and Recreation Board

Tennis court naming request at Centennial Sportsplex

The Naming Committee will consider a request from the Armour Strong Tennis Association to officially name one tennis court at the Centennial Sportsplex after Deborah Armour, a long-time player and captain. The meeting includes a call to order and public comment period.

parksnamingtenniscentennial-sportsplex
Mon Jan 8, 2024

Traffic and Parking Commission

Commission to vote on Bell Rd speed limit reduction to 40 mph

The Traffic and Parking Commission will vote on lowering the speed limit on Bell Road from 50 to 40 mph between Smith Springs Rd and Blackwood Rd. Other items include a bus-only parking zone on Compton Ave for Belmont University, revocation of a valet lane on Demonbreun St, new pay parking on Church St, a parking fee waiver for homeless outreach on Gay St Connector, and a 2-hour parking limit on Herman St. The commission will also vote on expanding the downtown No Vending zone.

trafficparkingspeed-limitsbus-parkingvaletpay-parkinghomeless-outreachvending
✓ Decided: Nashville traffic commission approves speed limit reduction on Bell Road

The Traffic and Parking Commission approved lowering the speed limit on Bell Road from 50 mph to 40 mph, revoked a valet lane on Demonbreun Street, and authorized new parking restrictions and fee waivers. Several items were deferred, including a bus-only parking zone and a valet fee policy update. The commission also discussed but did not vote on a food truck pilot program and a Vision Zero update.

Mon Jan 8, 2024

Metropolitan Council

Minority Caucus to vote on bylaws changes, discuss violence interruption pilot

The Metropolitan Council Minority Caucus is meeting to vote on proposed bylaws changes and discuss a violence interruption pilot program. Other items include a treasurer's report with a proposed budget and hiring an accountant, updates on the annual reception, and a community concern regarding the Nashville Public Library.

minority-caucusbylawsviolence-interruptionbudgetpublic-library
Mon Jan 8, 2024

Human Relations Commission

Human Relations Commission to discuss office move, bylaws, and executive director evaluation

The Metro Human Relations Commission is holding a regular meeting to review minutes, receive a financial update, and discuss new business including an office move, bylaws committee update, and executive director evaluation. Old business includes a complaints update. The agenda is largely procedural with no specific votes or dollar amounts listed.

human-relationscommission-meetingbylawsoffice-moveexecutive-director-evaluationcomplaints
Thu Jan 4, 2024

Employee Benefit Board

Employee Benefit Board to consider disability pensions, copay changes, and RFP for benefits consulting

The Metropolitan Employee Benefit Board will meet on January 4, 2024, to discuss and act on several items including disability pension requests, a request to terminate a line-of-duty disability pension, and a reconsideration for return to work with restrictions for an MNPS employee. The board will also consider a change to the medical PPO plan office visit copay for therapeutic/rehabilitative/habilitative services, and review requests for proposals for benefits consulting services and a Medicare Advantage plan.

employee-benefitspensionsdisabilityhealth-insuranceprocurementpublic-comment
Thu Jan 4, 2024

Metro Development and Housing Agency Board

Housing committee to review final HCI report update

The Housing and Community Committee of the Metropolitan Development and Housing Agency is meeting to approve minutes from December 7, 2023, hear public comments, and receive a final update on the HCI report. The agenda is mostly procedural, with the HCI report update being the only substantive item.

housingcommitteereportpublic-comments
Thu Jan 4, 2024

Metro Development and Housing Agency Board

Committee to consider PILOT agreement for Hickory Forest and 5th & Summer change order

The Finance and Development Committee of the Metro Development and Housing Agency will meet to consider two action items: a PILOT (payment in lieu of taxes) agreement for the Hickory Forest project, with a board decision requested in January, and an architectural services change order for the 5th & Summer project, with a board decision requested in February. The meeting also includes approval of prior minutes and public comments.

housingfinancepilotdevelopment
Thu Jan 4, 2024

Convention Center Authority

Convention Center Authority discusses food and beverage contracts and software RFP

The Authority will receive an operations update regarding food and beverage contract renewals and tax collections. The meeting also includes the entry of a software Request for Proposals (RFP).

food-and-beveragesoftwareoperationstaxation
Thu Jan 4, 2024

Zoning Appeals Board

Zoning board grants 4 of 6 appeals, denies height variance and non-conforming addition

The Metropolitan Board of Zoning Appeals heard six appeals on January 4, 2024. They granted variances for a home addition at 5501 Meadowcrest Ln, a non-residential building at 170 Windsor Dr, a daycare relocation at 374 Hicks Rd, and an accessory dwelling at 1020B Stainback Ave. They denied a height variance for a garage at 1711 Sevier St and an addition to a non-conforming structure at 319 Hancock St.

zoningvariancesspecial-exceptionsheight-restrictionssetbacksnon-conforming-structuresdaycare
Thu Jan 4, 2024

Continuum of Care Homelessness Planning Council

Executive Committee to review HUD technical assistance and restructuring

The Executive Committee of the CoC Homelessness Planning Council will review minutes, discuss board updates including an appointment and retreat content, consider a proposed letter from the shelter committee, and evaluate HUD technical assistance from Cloudburst, NAEH, and CSH, including recommendations for restructuring, bylaws, and a collaborative applicant ad hoc committee. An update on the Hermitage Camp closure is also on the agenda.

homelessnesscontinuum-of-careexecutive-committeehudtechnical-assistancesheltercamp-closure
Wed Jan 3, 2024

Stormwater Management Commission

Stormwater Management Commission reviews floodplain and stream buffer cases

The Commission will review two specific case files regarding uncompensated fill and unpermitted structures in floodways. The meeting also includes the election of a new chairperson and vice chairperson.

stormwaterfloodplainzoningenvironment
Wed Jan 3, 2024

Property Standards and Appeals Board

Board to decide on two demolition-order properties and review a deferred case

The Board of Property Standards and Appeals will hear two new cases (2023 PS-06 and 2023 PS-07) where the owner seeks permission to repair properties under demolition orders at 2206 and 2208 Goodrich Ave. It will also review a previously deferred case (2023 PS-04) at 1622 Eastside Ave, which was approved 5-0 with conditions including cleanup and probate proof.

property-standardsdemolitionrepair-permitspublic-hearing