The Boring PartsFederalLocal · USLocal · Canada
Palm Desert, CA

Palm Desert public meetings in 2024

181 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Wed Dec 25, 2024 · 9:00 AM

Historic Preservation Committee

No substantive items listed for Historic Preservation Committee meeting

The provided agenda contains only procedural boilerplate and software interface text. There are no specific decisions, proposals, or discussion items listed for this meeting.

procedural
Administrative Conference Room, City Hall
Tue Dec 24, 2024 · 12:30 PM

Architectural Review Commission

No substantive items listed for Architectural Review Commission meeting

The provided agenda contains only procedural boilerplate and software interface elements. There are no specific projects, decisions, or discussion items listed for this meeting.

procedural
Development Services Conference Room, City Hall
Mon Dec 23, 2024 · 1:00 PM

Library Advisory Committee

No agenda items listed for this meeting

The Library Advisory Committee agenda for December 23, 2024 contains no listed items or decisions. The document provides only generic headings and placeholders without specific topics, proposals, or votes.

Administrative Conference Room, City Hall
Thu Dec 19, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

El Paseo Board meets with no agenda items listed

The El Paseo Parking and Business Improvement District Board scheduled a meeting for December 19, 2024, but the agenda text provided contains no decisions, proposals, or discussions.

palm-desertboilerplatemeeting
Administrative Conference Room, City Hall
Wed Dec 18, 2024 · 10:00 AM

Outside Agency - Charitable Contributions Committee

Committee to review 2025-26 Community Development Block Grant funding

The Outside Agency Committee is meeting to discuss and approve funding recommendations for Program Year 2025-26 Community Development Block Grant (CDBG) applications. The body will review requests from public service providers and facilities for project funding.

grantscommunity-developmenthousingpublic-services
Administrative Conference Room, City Hall
Tue Dec 17, 2024 · 6:00 PM

Planning Commission

Planning Commission considers zoning ordinance amendments

The Planning Commission will hold a public hearing to consider recommending a zoning ordinance amendment to the City Council. The proposal involves changes to specific sections of the Palm Desert Municipal Code Title 25.

zoningmunicipal-codepublic-hearingland-use
Council Chamber, City Hall
Mon Dec 16, 2024 · 3:00 PM

Resource Preservation and Enhancement Committee

Resource Preservation and Enhancement Committee meets on Dec 16

The agenda for the December 16, 2024 meeting of the Palm Desert Resource Preservation and Enhancement Committee is procedural and does not list specific items for discussion or decision.

palm-desertcommitteeagendaprocedural
Administrative Conference Room, City Hall
Thu Dec 12, 2024 · Thursday, December 12, 2024 - Closed Session 3:30 p.m.; Regular Session 4:00 p.m.

Palm Desert City Council - Regular Meeting

Palm Desert City Council to certify 2024 election results and appoint Mayor

The City Council will declare the results of the November 5, 2024, general municipal election and appoint the Mayor and Mayor Pro Tem. The body is also considering several municipal code updates and historical property contracts.

electionszoninghousingmunicipal-codehistoric-preservation
✓ Decided: Council appoints new mayor and mayor pro tem, adopts election results

The Palm Desert City Council certified the November 5, 2024 election results, installed newly elected councilmembers, and appointed Jan Harnik as Mayor and Evan Trubee as Mayor Pro Tem for a one-year term. The council also approved a consent calendar with multiple contracts, ordinances, and appointments, and adopted a policy for notifying homeowner associations during the building permit process.

Council Chamber, City Hall
Thu Dec 12, 2024 · 3:00 PM

Palm Desert City Council - Study Session

Council receives update on Haystack Road Channel Improvements project

The City Council held a study session to receive an update on the design and progress of the Haystack Road Channel Improvements project (CDR00003). No decisions or actions will be taken during this meeting. The session was open to the public in person and via teleconference.

infrastructurewater-managementstudy-session
✓ Decided: Council discusses Haystack Road channel project, no formal action

The City Council held a study session to receive an update on the Haystack Road Channel Improvements Project. Councilmembers emphasized the need for a long-term solution and agreed to continue community conversations. No formal decisions were made; the session was informational only.

Council Chamber, City Hall
Wed Dec 11, 2024 · 3:30 PM

Housing Commission

Commission considers $591,229 roof replacement contract for Santa Rosa Apartments

The Housing Commission is meeting to recommend contracts and maintenance actions to the Palm Desert Housing Authority Board. Key items include a roof replacement project and the rejection of current pool maintenance proposals.

housingcontractsmaintenancebudget
✓ Decided: Housing Commission recommends $591K roof contract for Santa Rosa Apartments

The Housing Commission voted to recommend awarding a $591,229 construction contract to Garland/DBS for the Santa Rosa Apartments roof replacement project, with a 10% contingency. They also recommended rejecting all pool, spa, and water feature maintenance proposals and resoliciting those services. Consent items, including October's Home Improvement Program report, were approved. No other substantive decisions were made.

Administrative Conference Room, City Hall
Wed Dec 11, 2024 · 9:00 AM

Cultural Arts Committee

Committee to consider $25,000 Desert X sponsorship for 2025 exhibition

The Palm Desert Cultural Arts Committee will approve routine consent items, adopt the minutes from the November 13 meeting, and file a project status report for this meeting. The committee will also vote on a $25,000 sponsorship request from Desert X for the 2025 exhibition. Informational updates on a public sculpture and new mid‑block crosswalks will be presented.

cultural-artssponsorshipbudgetexhibitiondesert-xpublic-art
✓ Decided: Committee recommends $25K Desert X sponsorship for 2025 exhibition

The Cultural Arts Committee voted 7-0 to recommend City Council approve a $25,000 sponsorship for Desert X's 2025 exhibition. They also approved the consent calendar, including minutes and a project status report. No other substantive decisions were made; remaining items were informational updates.

Administrative Conference Room, City Hall
Tue Dec 10, 2024 · 3:30 PM

Public Safety Committee

Committee to discuss implementation of Measure G five-year spending plan

The Public Safety Committee will consider routine consent‑calendar items, including approval of the November 2024 meeting minutes and several departmental reports. Commissioners will receive a presentation on fire stations 102, 33 and 71, which requires no action. The committee will provide feedback on the implementation of Measure G’s approved five‑year spending plan.

public-safetymeasure-greportsfire-stationsbudget
✓ Decided: Committee approves Measure G five-year spending plan feedback

The Public Safety Committee approved the consent calendar and provided feedback on the Measure G five-year spending plan for public safety. All consent items were approved unanimously, including reports from various departments. The committee also received updates on fire station construction and public safety activities.

Administrative Conference Room, City Hall
Tue Dec 10, 2024 · 12:30 PM

Architectural Review Commission

ARC to consider design review for 146‑unit residential project in University Park

The Palm Desert Architectural Review Commission will approve the November 12 minutes and the routine consent calendar. Commissioners will then review three design proposals: a Rove electric‑vehicle charging station with a 4,500‑sq‑ft market in the Monterey Crossings Specific Plan, a façade modification for O’Reilly Auto Parts at 72875 Highway 111, and a 146‑unit detached residential development in University Park.

design-reviewhousingcommercialelectric-vehiclefacadeuniversity-park
✓ Decided: ARC approves Rove EV station with market in Monterey Crossings

The Architectural Review Commission approved a design review for a new Rove Electric Vehicle station with a 4,500-square-foot market within the Monterey Crossings Specific Plan, subject to conditions including a photometric plan and equipment screening. The commission continued two other items to a date uncertain: a façade modification for O'Reilly Auto Parts and a 146-unit residential development in University Park, both with specific design comments. All votes were unanimous (6-0, with one recusal on the residential item).

Development Services Conference Room, City Hall
Mon Dec 9, 2024 · 1:00 PM

Library Advisory Committee

Recommend presenting new library design to City Council

The Library Advisory Committee will consider routine consent items and approve the November 7, 2024 minutes. It will recommend that the conceptual design of the new library facility be presented to the City Council. The committee will also provide feedback on library statistics, the upcoming grand opening, programs, partnerships, and community engagement.

librarydesigncity-counciladvisory-committeemeeting
✓ Decided: Library Advisory Committee recommends new library design to City Council

The Library Advisory Committee voted unanimously to recommend the conceptual design of the new Palm Desert Library facility be presented to the City Council. The committee also approved the consent calendar, including the November 7, 2024 minutes, and provided feedback on library updates regarding statistics, grand opening, partnerships, and engagement. No other substantive decisions were made.

Administrative Conference Room, City Hall
Thu Dec 5, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board will consider a $5,000 sponsorship for the California Desert Plein Air Festival

The El Paseo Parking and Business Improvement District Board will approve routine items on the consent calendar, adopt the minutes from the October 17 meeting, and accept the October 31 financial statements. The board will hear a marketing update for October 2024. It will then consider a $5,000 sponsorship of the California Desert Plein Air Festival and vote to fill an open board seat.

budgetsponsorshipboard-electionfinancemarketingpublic-improvement
✓ Decided: Board approves $5,000 sponsorship for Plein Air Festival

The board approved a $5,000 sponsorship for the California Desert Plein Air Festival and voted to appoint Angela Rafferty to fill an open board seat. Consent calendar items, including approval of October minutes and financial statements, were also approved. No other substantive decisions were made.

Administrative Conference Room, City Hall
Tue Dec 3, 2024 · 8:30 AM

Parks and Recreation Committee

Parks and Recreation Committee to receive partner organization updates

The committee will meet to approve minutes from November 5, 2024, and receive informational reports. There are no items on the action calendar for decision.

parksrecreationcommunity-partners
Administrative Conference Room, City Hall
Tue Dec 3, 2024 · 3:00 PM

Public Affairs Marketing Panel

No agenda items listed for this meeting.

The agenda for the Palm Desert Public Affairs Marketing Panel on Dec 3, 2024 contains no listed items. It appears to be a placeholder with no substantive decisions or discussions recorded.

public-affairsmeetingpalm-desert
Administrative Conference Room, City Hall
Tue Dec 3, 2024 · 3:00 PM

Public Affairs Marketing Panel

No agenda items were listed for this meeting.

The agenda contains no listed items. The meeting appears to be a placeholder with no substantive agenda.

public-affairsmeetingagenda
Administrative Conference Room, City Hall
Tue Dec 3, 2024 · 6:00 PM

Planning Commission

No agenda items listed for the Palm Desert Planning Commission meeting

The agenda for the Palm Desert Planning Commission meeting on 2024-12-03 contains no listed items; it appears to be procedural boilerplate.

Council Chamber, City Hall
Wed Nov 27, 2024 · 9:00 AM

Historic Preservation Committee

No agenda items listed for this meeting.

The agenda contains no listed items. No decisions or discussions are documented.

historic-preservation
Administrative Conference Room, City Hall
Tue Nov 26, 2024 · 12:30 PM

Architectural Review Commission

No substantive items listed for Architectural Review Commission meeting

The provided agenda contains only procedural boilerplate and software interface elements. There are no specific projects, decisions, or discussion items listed for this meeting.

procedural
Development Services Conference Room, City Hall
Tue Nov 26, 2024 · 10:00 AM

Finance Committee

No agenda items listed for this Finance Committee meeting

The Finance Committee meeting scheduled for November 26, 2024 in Palm Desert has no agenda items listed. As a result, no specific decisions or discussions are documented for this session.

financepalm-desertcity
Administrative Conference Room, City Hall
Thu Nov 21, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board will consider a $5,000 sponsorship for the California Desert Plein Air Festival

The El Paseo Parking and Business Improvement District Board will approve the consent calendar, the minutes from the October 17, 2024 meeting, and the financial statement ending October 31, 2024. The board will receive informational updates from city staff, the sheriff, and marketing. It will consider a proposed $5,000 sponsorship of the California Desert Plein Air Festival. Finally, the board will vote to fill an open board seat from three candidates.

budgetsponsorshipboard-electionmarketingfinance
Administrative Conference Room, City Hall
Tue Nov 19, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider use amendment for restaurant at 77734 Country Club

The Palm Desert Planning Commission will first vote to approve the consent calendar and the minutes from the October 29 meeting. The commission will then consider a conditional use permit amendment and a notice of exemption to allow expansion of an existing restaurant at 77734 Country Club Drive, Suite F1. Additional agenda items include informational reports, attendance data, and public notices.

planningzoningpermitspublic-hearingscity-government
Council Chamber, City Hall
Thu Nov 14, 2024 · Thursday, November 14, 2024 - Closed Session 3:15 p.m.; Regular Session 4:00 p.m.

Palm Desert City Council - Regular Meeting

City Council to adopt 5‑year transaction and use tax spending plan

The Palm Desert City Council will consider several routine items, including approval of the consent calendar and various contracts. It will also adopt Resolution 2024-080, authorizing the City Manager to implement a five‑year spending plan for the local transactions and use tax. Additional agenda items include awards of construction and professional services contracts and approval of out‑of‑state travel for the Public Affairs Manager.

taxbudgetcontractshousingtravelpublic-safety
Council Chamber, City Hall
Thu Nov 14, 2024 · 2:45 PM

Palm Desert City Council - Study Session

Council reviews options for Regency Estates retention basin

The City Council is holding a study session to review several policy and infrastructure items. No formal action will be taken during this meeting.

infrastructurezoningbusiness-licensinghomeowners-association
Council Chamber, City Hall
Wed Nov 13, 2024 · 3:30 PM

Housing Commission

Housing Commission to approve $175,000 flooring contract with Mohawk Commercial

The commission will consider routine consent items, approve the minutes from the October 9, 2024 meeting, receive the September Home Improvement Program activity report, and vote on a short‑form construction services contract with Mohawk Commercial, Inc. for floor coverings at Authority properties, limited to $175,000 for FY 2024/2025. Additional informational reports on city‑council actions and monthly housing data will be presented.

housingcontractsprocurementreportsfinance
Administrative Conference Room, City Hall
Wed Nov 13, 2024 · 9:00 AM

Cultural Arts Committee

Committee to review El Paseo crosswalk art and piano deaccession

The Cultural Arts Committee is meeting to rank designs for asphalt art at El Paseo raised mid-block crosswalks. The body will also consider the deaccession of a grand piano by David Mueller and review library art programming.

public-artel-paseolibrarycity-assets
Administrative Conference Room, City Hall
Tue Nov 12, 2024 · 3:30 PM

Public Safety Committee

Committee to form subcommittee for public safety camera systems

The Palm Desert Public Safety Committee will consider establishing a subcommittee to evaluate camera systems for public safety. The meeting also includes approval of monthly reports for specialized units, code compliance, and emergency services.

public-safetycommitteecameraspolicefirereportsagenda
Administrative Conference Room, City Hall
Tue Nov 12, 2024 · 12:30 PM

Architectural Review Commission

Commission to approve drive‑through coffee shop at Monterey Crossings.

The Palm Desert Architectural Review Commission will consider several design review requests, including a private pickleball court, a new Rove electric‑vehicle charging station with market space, and a 950‑square‑foot drive‑through coffee shop within the Monterey Crossings Specific Plan. The commission will also vote on an amendment to the sign program for the El Paseo Square Building G and routine consent‑calendar items such as approval of the October 22, 2024 meeting minutes.

design-reviewsignageelectric-vehiclecoffee-shoppickleballmonterey-crossings
Development Services Conference Room, City Hall
Thu Nov 7, 2024 · 1:00 PM

Library Advisory Committee

Library Advisory Committee reviews new library conceptual design

The committee will hear a presentation of the proposed new library conceptual design. It will also consider routine consent‑calendar items and approve the September 23, 2024 meeting minutes. Finally, the committee will receive and file library updates on statistics, the grand opening, partnerships, programs, and community engagement.

librarydesignconsent-calendarminutesupdates
Administrative Conference Room, City Hall
Tue Nov 5, 2024 · 8:30 AM

Parks and Recreation Committee

Committee considers fencing around city park playground equipment

The Parks and Recreation Committee will discuss whether to explore cost options for installing fencing around playground equipment at city parks. The committee is specifically considering an initial assessment of Freedom Park.

parksrecreationpublic-safetyfreedom-park
Administrative Conference Room, City Hall
Tue Nov 5, 2024 · 6:00 PM

Planning Commission

No agenda items listed for this Planning Commission meeting.

The agenda for the Palm Desert Planning Commission meeting on November 5, 2024 contains no listed items. No decisions or discussions are documented in the provided agenda. The meeting appears to be procedural with no substantive agenda items.

planningmeetingagenda
Council Chamber, City Hall
Mon Nov 4, 2024 · 3:00 PM

Homelessness Task Force

Taskforce approves 2025 workplan adding homeless prevention resources

The Palm Desert Homelessness Taskforce will vote on routine consent items, approve the September 4, 2024 meeting minutes, and adopt the City Net September 2024 Impact Report. Members will elect a chair and vice‑chair for fiscal year 2024‑2025. The primary decision is to approve the 2025 Workplan and incorporate a new “Homeless Prevention Resources” category.

homelessnesstaskforceworkplancity-netgovernance
Administrative Conference Room, City Hall
Mon Nov 4, 2024 · 9:00 AM

Homelessness Task Force

No agenda items listed for the Palm Desert Homelessness Task Force meeting

The agenda for the Palm Desert Homelessness Task Force meeting on November 4, 2024 contains no listed items. It appears to be a placeholder with only generic headings and no specific proposals, contracts, or decisions. No concrete agenda items are provided.

homelessnesstask-forcemeetingpalm-desert
Administrative Conference Room, City Hall
Mon Nov 4, 2024 · 10:00 AM

Homelessness Task Force

No agenda items listed; meeting appears procedural.

The Homelessness Task Force meeting on November 4, 2024 in Palm Desert has no agenda items detailed in the provided document. The agenda consists only of placeholders and software interface elements. No decisions or discussions are specified.

homelessness-task-forcemeetingprocedural
Administrative Conference Room, City Hall
Tue Oct 29, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider zoning changes for accessory dwelling units

The Palm Desert Planning Commission will meet to discuss amending municipal code sections regarding accessory dwelling units (ADUs) and junior ADUs to comply with state law. The body will also approve the minutes from the previous meeting.

planningzoninghousingadusmunicipal-codepublic-hearing
Council Chamber, City Hall
Mon Oct 28, 2024 · 1:00 PM

Library Advisory Committee

Library Advisory Committee meeting with no agenda items listed

The Palm Desert Library Advisory Committee meeting scheduled for 2024-10-28 has an agenda that contains no listed items. No decisions, proposals, or discussions are detailed in the provided agenda document.

libraryadvisory-committeemeeting
Administrative Conference Room, City Hall
Thu Oct 24, 2024 · 3:30 PM

Palm Desert City Council - Study Session

City Council to review Palm Springs International Airport Master Plan

The Palm Desert City Council is holding a study session to receive an update and provide feedback on the Palm Springs International Airport Master Plan. The agenda states that no action will be taken during this meeting.

airporttransportationplanning
Council Chamber, City Hall
Thu Oct 24, 2024 · 4:00 PM

Palm Desert City Council - Regular Meeting

City Council to award $733,400 traffic signal contract to DBX, Inc.

The Palm Desert City Council will consider a consent calendar of routine items and adopt several ordinances, including updates to short‑term rentals and right‑of‑way vacation procedures. Council members will vote on two major contract awards: a $733,400 traffic signal installation for the Vitalia project and a $750,000 on‑call contract for parks and landscape enhancements. Additional actions include a lease extension with the Artist Council at 72-567 Highway 111 and a resolution on dining‑deck lease rates.

contractstraffic-signalparkslandscapingshort-term-rentalsright-of-waydining-decks
Council Chamber, City Hall
Wed Oct 23, 2024 · 9:00 AM

Historic Preservation Committee

Committee to discuss Modernism week and Mills Act guidelines

The Cultural Resources Preservation Committee will meet to review updates on specific preservation topics. The body is seeking feedback on education topics, Modernism week, and updated Mills Act guidelines.

historic-preservationmills-actcultural-resources
Administrative Conference Room, City Hall
Tue Oct 22, 2024 · 12:30 PM

Architectural Review Commission

Commission to approve sign designs for San Pablo Ave and Sego Lane projects

The Architectural Review Commission will consider routine consent items and approve the minutes from the October 8 meeting. It will also review and vote on a design review for a monument sign at 44795 San Pablo Avenue and a sign program for two industrial buildings at 75051 Sego Lane.

signagedesign-reviewpermitsarchitecturedevelopment
Development Services Conference Room, City Hall
Tue Oct 22, 2024 · 10:00 AM

Civic Engagement Committee

Committee considers new resident guide and youth civic program

The Civic Engagement Committee is meeting to provide feedback on a guide for new Palm Desert residents. The body is also considering the approval of a one-day civic engagement event with Palm Desert High School.

civic-engagementyouthcommunity-outreacheducation
Administrative Conference Room, City Hall
Mon Oct 21, 2024 · 3:00 PM

Resource Preservation and Enhancement Committee

Committee to review greenhouse gas measures for the Comprehensive Climate Action Plan

The Resource Preservation and Enhancement Committee will consider routine consent items, approve the August 26, 2024 meeting minutes, receive and file the October 2024 status report, receive and file the 2024/2025 workplan update, and solicit public feedback on potential greenhouse gas reduction measures for the Comprehensive Climate Action Plan.

climate-actionenvironmentpublic-commentcommitteeagenda
Administrative Conference Room, City Hall
Thu Oct 17, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board to consider feedback on new raised mid‑block crossing on El Paseo

The El Paseo Parking and Business Improvement District Board will approve routine items such as the consent calendar, September 19 meeting minutes, and financial statements for July‑September 2024. The board will receive a public health presentation from the CV Mosquito and Vector Control District and a marketing update for September 2024. Action items include providing feedback on a proposed raised mid‑block pedestrian crossing on El Paseo between Portola Avenue and San Luis Rey Avenue, approving the agenda for the Fall Merchant Meeting on November 12, and directing FY 2024‑25 marketing initiatives.

pedestrian-crossingfinancemarketingpublic-healthagenda
Administrative Conference Room, City Hall
Tue Oct 15, 2024 · 6:00 PM

Planning Commission

No substantive items listed for October 15 Planning Commission meeting

The provided agenda contains only procedural boilerplate and software interface text. There are no specific projects, decisions, or discussion items listed.

procedural
Council Chamber, City Hall
Thu Oct 10, 2024 · Thursday, October 10, 2024 - 3:30 p.m. Closed Session; 4:00 p.m. Regular Session

Palm Desert City Council - Regular Meeting

City Council to consider affordable housing agreement and infrastructure contracts

The Palm Desert City Council will discuss a development agreement for the Palm Villas at Millenium affordable housing project. The body is also deciding on several infrastructure contracts and a policy for notifying homeowner associations during the building permit process.

affordable-housinginfrastructurezoningpublic-worksbudget
Council Chamber, City Hall
Thu Oct 10, 2024 · 3:15 PM

Palm Desert City Council - Study Session

Council studies draft ordinance to ban firearms at City Hall

The Palm Desert City Council will hold a study session to discuss a draft ordinance that would amend the municipal code to prohibit possession of firearms at City Hall. No vote or formal action will be taken on the proposal during this meeting. Council members and the public may provide feedback through written comments submitted before 10:00 a.m. on the day of the meeting.

city-hallfirearmsordinancestudy-sessionpublic-comment
Council Chamber, City Hall
Wed Oct 9, 2024 · 3:30 PM

Housing Commission

Housing Commission to review home improvement and occupancy reports

The Housing Commission will meet to approve previous meeting minutes and receive a Home Improvement Program activity report. The body will also review monthly occupancy and rent reports from Falkenberg/Gilliam & Associates for June and July 2024.

housingreportshome-improvement
Administrative Conference Room, City Hall
Wed Oct 9, 2024 · 9:00 AM

Cultural Arts Committee

Committee to consider $100,000 purchase of Rising Inversion sculpture

The Cultural Arts Committee will approve routine items on the consent calendar and adopt the September 11 meeting minutes. It will consider a $100,000 purchase of the “Rising Inversion” sculpture by Cristopher Cichocki. Additional actions include selecting an artist for a vinyl art wrap on a park bench at the Civic Center Park and approving the relocation of two existing sculptures—the Desert Gateway Rock Sculpture by Heath Satow and the Roadrunner sculpture by Allen Root to the Desert Willow Golf Resort.

cultural-artspublic-artsculpturebudgetparks
Administrative Conference Room, City Hall
Tue Oct 8, 2024 · 3:30 PM

Public Safety Committee

Public Safety Committee approves monthly reports and files Supreme Court ruling

The Palm Desert Public Safety Committee will approve routine monthly reports from specialized units, code compliance, and emergency services. The committee will also receive and file a ruling from the Supreme Court regarding the City of Grants Pass v. Johnson case.

public-safetypolicefirecode-compliancesupreme-courtrulingreports
Administrative Conference Room, City Hall
Tue Oct 8, 2024 · 12:30 PM

Architectural Review Commission

Commission considers design review for monument sign on San Pablo Avenue

The Architectural Review Commission is meeting to discuss a design review for a multitenant monument sign. This item is a continuation from a July 23, 2024, meeting.

signsdesign-reviewcommercial-development
Development Services Conference Room, City Hall
Tue Oct 1, 2024 · 8:30 AM

Parks and Recreation Committee

No substantive items listed for Parks and Recreation Committee meeting

The provided agenda contains only procedural boilerplate and software interface text. No specific decisions, discussions, or action items are listed.

parks-and-recreationprocedural
Administrative Conference Room, City Hall
Tue Oct 1, 2024 · 3:00 PM

Public Affairs Marketing Panel

No substantive items listed for Public Affairs Marketing Panel meeting

The provided agenda contains only procedural boilerplate and software interface text. No specific decisions, discussions, or action items are listed.

procedural
Administrative Conference Room, City Hall
Tue Oct 1, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider church permit and project extension

The Palm Desert Planning Commission will meet to consider approving a Conditional Use Permit for a church in an industrial building and granting a one-year extension for a development project. The meeting will be held in person and via Zoom.

planningzoningchurchdevelopmentextensionpublic-hearing
Council Chamber, City Hall
Thu Sep 26, 2024 · 4:00 PM

Palm Desert City Council - Regular Meeting

City Council to consider $950,000 funding for new electric substation

The Palm Desert City Council will discuss several funding approvals, including a partnership for a new electric substation and a new enterprise resource planning system. The body is also reviewing contracts for traffic consulting, grant writing, and housing authority services.

energybudgetinfrastructurehousingpublic-safety
Council Chamber, City Hall
Wed Sep 25, 2024 · 9:00 AM

Historic Preservation Committee

Committee considers historic landmark status for Avondale Golf Club Clubhouse

The Cultural Resources Preservation Committee is meeting to discuss the designation of a local historic landmark. The body will consider making a recommendation to the City Council regarding the Avondale Golf Club Clubhouse.

historic-preservationlandmarkspalm-desert
Administrative Conference Room, City Hall
Tue Sep 24, 2024 · 10:00 AM

Finance Committee

Finance Committee to review city financial and investment reports

The Finance Committee will elect a chairperson and vice-chairperson. The body will also receive and file financial reports for the General Fund, City Treasurer's investments, Desert Willow Golf Resort, and the Parkview Office Complex for the period of May through August 2024.

financeinvestmentsgeneral-fundsales-taxcity-management
Administrative Conference Room, City Hall
Tue Sep 24, 2024 · 12:30 PM

Architectural Review Commission

Commission considers facade renovation for Bighorn development spa

The Architectural Review Commission is meeting to discuss a design review for a spa building renovation. The body will also review minutes from the August 27, 2024 meeting.

design-reviewrenovationarchitecture
Development Services Conference Room, City Hall
Mon Sep 23, 2024 · 1:00 PM

Library Advisory Committee

Library Advisory Committee to review statistics and strategic updates

The Library Advisory Committee will meet to receive and file updates on library statistics, the website, and the strategic framework. The committee will also discuss the Library Advisory Committee workplan, the library of things, and various programs and partnerships.

librarystrategic-planningpublic-services
Administrative Conference Room, City Hall
Thu Sep 19, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board to discuss direction for El Paseo marketing initiatives

The El Paseo Parking and Business Improvement District Board will approve the consent calendar, the July 18, 2024 meeting minutes, and the financial statements for the month ending June 30, 2024. The board will receive informational reports on the 2025‑2026 sculpture exhibition, the sheriff, and marketing updates. Members will discuss proposed marketing initiatives, select a date for the Fall Merchant Meeting, and provide feedback on the El Paseo catalog and directory.

budgetmarketingmerchant-meetingcatalogpublic-district
Administrative Conference Room, City Hall
Tue Sep 17, 2024 · 6:00 PM

Planning Commission

No agenda items listed for the Palm Desert Planning Commission meeting

The Palm Desert Planning Commission meeting scheduled for September 17, 2024 has no agenda items listed in the provided document. The agenda consists only of placeholders and procedural headings, with no specific items for discussion or decision.

planningproceduralmeeting
Council Chamber, City Hall
Mon Sep 16, 2024 · 9:00 AM

Parks and Recreation Committee

Committee will adopt KPI scoring and park maintenance evaluations for all city parks

The Parks and Recreation Committee will consider routine consent items and approve the August 6, 2024 minutes. It will adopt a citywide Key Performance Indicator scoring system and park maintenance evaluations, with scoring sheets to be provided by Dec 31, 2024. The agenda also includes a community parks presentation and updates from partner groups such as the Palm Desert Aquatic Center, First Tee, and Friends of the Desert Mountains.

parksrecreationperformance-indicatorsmaintenancecommunity-updates
✓ Decided: Parks committee adopts new maintenance scoring for all city parks

The Parks and Recreation Committee approved the adoption of Key Performance Indicator (KPI) scoring and Park Maintenance Evaluation forms for all city parks, with a requirement to provide scoring sheets by December 31, 2024. The motion passed unanimously (9-0). The committee also approved the consent calendar, including the minutes from August 6, 2024. No other substantive decisions were made; other items were informational only.

Administrative Conference Room, City Hall
Thu Sep 12, 2024 · 2:00 PM

Palm Desert City Council - Study Session

Council studies Unified Development Code update and policy drafts, no action

The City Council, its successor redevelopment agency, the Housing Authority, and the Library Trustees will review several draft updates during a study session. Items include an introduction to the Unified Development Code, proposed amendments to Subdivision and Grading codes, changes to the Building Board of Appeals, and a draft policy on threats of violence and possible firearms restrictions on city property. The council will gather public feedback and direct staff to consider forming a subcommittee, but no formal action will be taken at this meeting.

unified-development-codemunicipal-codebuilding-boardpublic-safetypolicy
Council Chamber, City Hall
Thu Sep 12, 2024 · Thursday, September 12, 2024 - Closed Session 3:15 p.m.; Regular Session 4:00 p.m.

Palm Desert City Council - Regular Meeting

City Council to consider multiple contracts for Desert Willow Golf Resort

The Palm Desert City Council will review several infrastructure and maintenance contracts, including landscaping and lighting projects. The body is also deciding on alcoholic beverage license applications and real property negotiations in closed session.

contractsgolf-coursepublic-worksalcohol-licensesreal-estate
✓ Decided: Council approves consent calendar, awards contracts, supports Prop 36

The City Council approved the consent calendar (excluding three items that were considered separately), including contracts for landscaping, lighting, and drainage work, and a bid protest rejection. The Council also adopted a resolution supporting Proposition 36, opposed a League of California Cities resolution, and approved a $20,000 sponsorship for Tour de Palm Springs with a 4-1 vote. No public hearings were held.

Council Chamber, City Hall
Wed Sep 11, 2024 · 9:00 AM

Cultural Arts Committee

Committee considers sponsorship for inaugural California Desert Plein Air Festival

The Cultural Arts Committee is meeting to discuss the conversion of Little Free Libraries into Free Little Art Galleries and the discontinuation of a public art documentary series. The body is also considering a recommendation for City Council to sponsor a new art festival.

artspublic-artfestivalscommunity-programs
Administrative Conference Room, City Hall
Wed Sep 11, 2024 · 3:30 PM

Housing Commission

Commission to ratify $11.7M on‑call construction management contract

The Palm Desert Housing Commission will consider routine items on the consent calendar, approve June 12 minutes, and receive Home Improvement Program reports. It will vote on a $280,647 change order for the One Quail Place parking lot rehabilitation and on a contract up to $11,739,394 for TKE Engineering, Inc. as an on‑call construction manager. Additional actions include rejecting courtesy patrol proposals, adopting bylaws amendments, and appointing a liaison to the Homelessness Taskforce.

housingcontractsbylawspatrolliaison
Administrative Conference Room, City Hall
Tue Sep 10, 2024 · 12:30 PM

Architectural Review Commission

Architectural Review Commission meets for procedural items

The Palm Desert Architectural Review Commission met on September 10, 2024, to discuss procedural agenda items. The meeting included a video recording and standard voting procedures.

meetingagendaprocedural
Development Services Conference Room, City Hall
Tue Sep 10, 2024 · 3:30 PM

Public Safety Committee

Committee elects chairperson and vice chairperson for FY 2024‑25

The Public Safety Committee will elect a chairperson and vice chairperson for the 2024‑25 fiscal year. It will consider routine consent‑calendar items, approve the June 11, 2024 minutes, and reappoint Joseph Butts to the Homelessness Taskforce. The meeting also includes presentations and reports from various public‑safety agencies.

public-safetycommitteeappointmentsreportsgovernance
✓ Decided: Public Safety Committee elects Wahlstrom chair, Kramer vice chair

The Public Safety Committee elected Kevin Wahlstrom as Chairperson and Terry Kramer as Vice Chairperson for fiscal year 2024-25, both by unanimous votes. The committee approved the consent calendar (excluding the Emergency Services Coordinator report, which was later approved separately) and reappointed Joseph Butts to the Homelessness Taskforce. Several informational reports were received, and future agenda items were requested.

Administrative Conference Room, City Hall
Wed Sep 4, 2024 · 9:00 AM

Homelessness Task Force

Taskforce will receive and file the Permanent Local Housing Allocation Budget

The Palm Desert Homelessness Taskforce will approve routine consent items, including the May 21, 2024 meeting minutes. It will receive and file several reports: the City Net July 2024 Impact Report, the May‑June‑July Code Compliance Activity Report, an update on resources for homeless students at schools, and the Permanent Local Housing Allocation Budget. No new policy actions are listed on the agenda.

homelessnessbudgeteducationcity-netcode-compliancereports
Administrative Conference Room, City Hall
Tue Sep 3, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider Living Desert Zoo expansion conditional use permit

The Palm Desert Planning Commission will adopt a mitigated negative declaration and approve a conditional use permit and precise plan for the Living Desert Zoo and Gardens expansion project at 47900 Portola Avenue. The commission will also consider a six‑month extension for Tentative Parcel Map 37234 until March 12, 2025, and a notice of exemption with revised pad elevation for the Staybridge Hotel project at 74-755 Technology Drive. Routine consent items and informational reports will be addressed as well.

zoningconditional-useenvironmentdevelopmentplanning
✓ Decided: Planning Commission approves Living Desert Zoo expansion project

The Palm Desert Planning Commission approved the Living Desert Zoo and Gardens expansion project, adopting a Mitigated Negative Declaration and approving a Conditional Use Permit and Precise Plan. The commission also granted a six-month extension for Tentative Parcel Map 37234 and approved a revised PAD elevation and development standard for the Staybridge Hotel project. Public comments raised concerns about traffic and noise, prompting staff to propose a community meeting.

Council Chamber, City Hall
Wed Aug 28, 2024 · 9:00 AM

Historic Preservation Committee

Committee considers garden wall at 72861 El Paseo landmark

The Cultural Resources Preservation Committee will hold a public hearing regarding a construction project at a city landmark. The body will also review a historic context statement and survey presentation.

historic-preservationlandmarkszoningpublic-hearings
✓ Decided: Committee grants Certificate of Appropriateness for El Paseo garden wall

The Cultural Resources Preservation Committee approved a Certificate of Appropriateness for a new breeze block garden wall at the landmark property at 72861 El Paseo, determining the project is categorically exempt from CEQA. The committee also elected Chair McCune and Vice-Chair Vassalli, and approved the consent calendar including the June 26, 2024 minutes. No formal action was taken on the Historic Context Statement and Survey kick-off, which was presented for feedback.

Administrative Conference Room, City Hall
Tue Aug 27, 2024 · 12:30 PM

Architectural Review Commission

Palm Desert ARC to review jewelry store facade renovation

The Architectural Review Commission will consider approving design reviews for a jewelry store facade renovation at 72990 Highway 111 and a storefront modification for Shiraz Rugs at 74-220 Highway 111. The meeting also includes approval of the July 23, 2024, commission minutes.

architecturedesign-reviewhighway-111palm-desertcommercial
✓ Decided: ARC approves Hope Diamonds & Co. facade renovation with conditions

The Architectural Review Commission approved a design review for a facade renovation and architectural improvements for Hope Diamonds & Company at 72990 Highway 111, with conditions including anodized gold band trim, fade-resistant shadow box covers, and equipment screening. The commission also approved a facade modification for Shiraz Rug Company at 74-220 Highway 111, with Commissioner McAuliffe recused. Both approvals were unanimous among voting members.

Development Services Conference Room, City Hall
Mon Aug 26, 2024 · 3:00 PM

Resource Preservation and Enhancement Committee

Committee recommends City Council adopt artificial turf ban in public rights‑of‑way

The Resource Preservation and Enhancement Committee will elect a chair and vice‑chair, approve the consent calendar and the June 17 minutes, and recommend that City Council adopt a resolution prohibiting artificial turf in public rights‑of‑way. It will also receive and file updates on the Inland Regional Energy Network, the Comprehensive Climate Action Plan, and its 2024‑2025 workplan.

governanceelectionspolicyenvironmentclimateinfrastructure
✓ Decided: Committee recommends banning artificial turf in public rights-of-way

The Resource Preservation and Enhancement Committee voted unanimously to recommend that the City Council adopt a resolution prohibiting artificial turf/synthetic grass in public rights-of-way. The committee also elected new officers, approved the consent calendar with a clerical change, and received informational updates on regional energy, climate action, and its workplan. No other substantive decisions were made.

Administrative Conference Room, City Hall
Mon Aug 26, 2024 · 1:00 PM

Library Advisory Committee

Library Advisory Committee to approve FY 2024/2025 meeting schedule

The Library Advisory Committee is meeting to approve its meeting schedule for the 2024/2025 fiscal year and the minutes from July 22, 2024. The committee will also receive informational reports on library policies, partnerships, and the Civic Center Park Library.

libraryschedulingcivic-center-parkgovernment-administration
✓ Decided: Library Advisory Committee approves FY 2024/25 meeting schedule

The Library Advisory Committee approved its meeting schedule for fiscal year 2024/2025, with an amendment to combine the November and December meetings on December 9, 2024. The committee also approved the minutes from the July 22, 2024 meeting. No other substantive decisions were made; the rest of the meeting consisted of informational reports and public comments.

Administrative Conference Room, City Hall
Thu Aug 22, 2024 · Thursday, August 22, 2024 - Closed Session - 3:15 p.m., Regular Session - 4:00 p.m.

Palm Desert City Council - Regular Meeting

Palm Desert City Council to consider traffic hardware and parking lot contracts

The City Council will discuss various administrative approvals, including public art purchases and library policies. The body is deciding on several infrastructure contracts and the 2025 meeting schedule.

infrastructurepublic-artcontractslibrary-policyhousing
✓ Decided: Council approves consent calendar, contracts, and rejects El Paseo farmers market

The Palm Desert City Council approved a large consent calendar including multiple construction contracts, purchases, and policy resolutions, and rejected a proposal for a Saturday farmers market on El Paseo. They also approved a final tract map for a subdivision over one dissenting vote, established a nonprofit foundation, and continued several items to future meetings.

Council Chamber, City Hall
Thu Aug 22, 2024 · 2:45 PM

Palm Desert City Council - Study Session

Council reviews proposed smoking and lighting code amendments

The Palm Desert City Council held a study session to examine two proposed text amendments to the municipal code. Council members will provide feedback on changes to Chapter 8.36, Regulation and Prohibition of Smoking, and on updates to Chapter 24.16, Outdoor Lighting Requirements for commercial buildings. No formal action or vote will be taken at this meeting.

smokinglightingmunicipal-codestudy-sessioncity-council
✓ Decided: Council studies smoking and lighting ordinance changes

The City Council held a study session to discuss proposed text amendments to the municipal code regulating smoking and proposed regulations for exterior lighting on commercial buildings. No formal decisions were made; the session was informational only.

Council Chamber, City Hall
Tue Aug 20, 2024 · 6:00 PM

Planning Commission

Planning Commission to adopt permits for outdoor patio, zoo expansion, and guesthouse

The Palm Desert Planning Commission will consider three public‑hearing items. It will adopt a notice of exemption and conditional use permit for an outdoor patio at 72990 El Paseo Suite 3, a mitigated negative declaration and conditional use permit for the Living Desert Zoo and Gardens expansion at 47900 Portola Avenue, and a precise‑plan amendment for a 1,103‑square‑foot guesthouse at 72240 Upper Way West. The commission will also approve the consent calendar and the July 19 meeting minutes.

zoningconditional-useenvironmentaldevelopmentpublic-hearingplanning
Council Chamber, City Hall
Mon Aug 19, 2024 · 3:00 PM

Resource Preservation and Enhancement Committee

Palm Desert committee meets for procedural agenda

The Resource Preservation and Enhancement Committee convened on August 19, 2024, for a regular meeting. The agenda included procedural items and a video recording of the session, with no specific decisions or public hearings listed.

palm-desertcommitteeproceduralvideo
Administrative Conference Room, City Hall
Thu Aug 15, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

No substantive items listed for El Paseo Parking and Business Improvement District Board

The provided agenda contains only procedural software placeholders and boilerplate text. There are no specific decisions, proposals, or discussion items listed for this meeting.

procedural
Administrative Conference Room, City Hall
Thu Aug 15, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board meeting agenda lists no specific items

The Palm Desert El Paseo Parking and Business Improvement District Board agenda for August 15, 2024 contains no listed agenda items. It appears to be a procedural placeholder without substantive proposals, contracts, or decisions. No decisions or discussions can be identified from the provided document.

administrationboardprocedural
Administrative Conference Room, City Hall
Wed Aug 14, 2024 · 3:30 PM

Housing Commission

No substantive agenda items were listed for this meeting.

The Palm Desert Housing Commission agenda for August 14, 2024 contains no listed items. It appears to be a procedural placeholder without specific decisions or discussions. No rezoning, contracts, ordinances, fee changes, or public hearings are detailed.

housingcommissionmeeting
Administrative Conference Room, City Hall
Wed Aug 14, 2024 · 9:00 AM

Cultural Arts Committee

No substantive items listed on the Cultural Arts Committee agenda

The agenda for the Palm Desert Cultural Arts Committee meeting on August 14, 2024 contains no listed items. No decisions, proposals, or discussions are documented in the agenda. The document appears to be a placeholder without substantive content.

artsculturegovernment
Administrative Conference Room, City Hall
Tue Aug 13, 2024 · 12:30 PM

Architectural Review Commission

No substantive items listed for Architectural Review Commission meeting

The provided agenda contains only procedural boilerplate and software interface text. No specific projects, decisions, or discussion items are listed.

procedural
Development Services Conference Room, City Hall
Tue Aug 13, 2024 · 3:30 PM

Public Safety Committee

No specific agenda items listed for this Public Safety Committee meeting

The agenda for the Palm Desert Public Safety Committee on 2024-08-13 contains no listed items or decisions. It appears to be a placeholder with no concrete proposals, contracts, or hearings detailed.

public-safety
Administrative Conference Room, City Hall
Tue Aug 6, 2024 · 3:00 PM

Public Affairs Marketing Panel

Marketing Committee will consider a Firebirds docuseries pitch and campaign recap

The Palm Desert Marketing Committee will elect a chairperson and vice‑chairperson, approve the consent calendar and the minutes from the April 2, 2024 meeting, receive and file the Fiscal Year 2023‑24 marketing campaign recap, and consider a proposed Firebirds docuseries pitch. Public comment is allowed on non‑agenda items for up to three minutes.

marketingcommitteeelectionminutescampaigndocuseries
Administrative Conference Room, City Hall
Tue Aug 6, 2024 · 8:30 AM

Parks and Recreation Committee

Parks and Recreation Committee to elect leadership and receive partner updates

The committee will elect a chairperson and vice-chairperson. The meeting includes informational reports from local partner organizations and the approval of minutes from June 4, 2024.

parksrecreationgovernment-administration
✓ Decided: Parks committee elects new chair and vice-chair, approves consent calendar

The Palm Desert Parks and Recreation Committee elected John Maldonado as Chairperson and Ralph Perry as Vice-Chairperson, both by unanimous 8-0 votes. The committee also approved the consent calendar, which included the June 4, 2024 meeting minutes. No action items were on the agenda; the rest of the meeting consisted of informational reports from partner organizations and staff updates.

Administrative Conference Room, City Hall
Tue Aug 6, 2024 · 6:00 PM

Planning Commission

No substantive agenda items listed for this meeting

The Planning Commission agenda for August 6, 2024 contains no listed items; it appears to be a procedural placeholder without specific decisions or discussions.

planningmeetingprocedural
Council Chamber, City Hall
Wed Jul 24, 2024 · 9:00 AM

Historic Preservation Committee

No substantive items on agenda

The provided agenda contains only procedural boilerplate and software interface text. No specific decisions, discussions, or projects are listed for this meeting.

procedural
Administrative Conference Room, City Hall
Tue Jul 23, 2024 · 10:00 AM

Finance Committee

No substantive agenda items listed for this meeting

The Finance Committee agenda for July 23, 2024 in Palm Desert contains no listed items or details. The agenda appears to consist only of placeholder text and no specific decisions, contracts, or hearings are identified.

financebudgetmeeting
Administrative Conference Room, City Hall
Tue Jul 23, 2024 · 12:30 PM

Architectural Review Commission

ARC to review restaurant patio, guesthouse, and commercial sign

The Architectural Review Commission will consider design approvals for three local projects. The body will also elect a Chairperson, Vice Chairperson, and a liaison for the Cultural Arts Commission.

design-reviewcommercial-developmentresidential-constructionsignageappointments
Development Services Conference Room, City Hall
Mon Jul 22, 2024 · 1:00 PM

Library Advisory Committee

Committee will receive and file reports on library opening activities and usage

The Library Advisory Committee will elect a chairperson and vice‑chairperson. It will receive and file staff reports on pre‑opening activities, partnerships and programs, and usage statistics for the new library. Public comment is permitted on each action item for up to three minutes. The meeting also includes informational reports and standard procedural items.

librarygovernancereportsopeningattendance
✓ Decided: Library Advisory Committee elects Stewart as chair, Johnson as vice chair

The Library Advisory Committee elected Robin Stewart as Chairperson and Matthew Johnson as Vice Chairperson, both by unanimous 5-0 votes. The committee also received and filed reports on library opening activities, partnerships and programs, and usage statistics for the first two weeks of operations. No other substantive decisions were made; the meeting was procedural and informational.

Administrative Conference Room, City Hall
Thu Jul 18, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board to approve FY 2024‑25 media plan and routine financial items

The El Paseo Parking and Business Improvement District Board will consider routine consent items, approve the June 19, 2024 minutes, and adopt the financial statement ending May 31, 2024. The board will also vote to approve the proposed media plan for fiscal year 2024‑25. Additional agenda items include providing feedback on the Courtesy Cart signage program and receiving a report on Fashion Week and Palm Desert Food & Wine.

budgetmarketingfinancemedia-plancourtesy-cartfashion-weekpublic-comments
✓ Decided: Board approves FY 2024-25 media plan for El Paseo

The El Paseo Parking and Business Improvement District Board approved the proposed media plan for fiscal year 2024-25, along with the consent calendar (including June minutes and May financials) and re-elected Chair Klein and Vice Chair Elliott. The board also received and filed updates on Fashion Week on El Paseo and Palm Desert Food and Wine. No formal action was taken on the courtesy cart program, which was discussed for feedback only.

Administrative Conference Room, City Hall
Thu Jul 18, 2024 · 3:00 PM

Palm Desert City Council - Special Meeting

Council to adopt two special tax levy resolutions for University Park CFDs

The Palm Desert City Council will consider two resolutions that would authorize the levy of a special tax in Community Facilities District No. 2005-1 (University Park) and Community Facilities District No. 2021-1 (University Park) for fiscal year 2024‑25. Both resolutions are recommended for adoption by staff. The meeting also includes routine items such as call to order, roll call, and public notices.

special-taxcommunity-facilities-districtuniversity-parkbudgetcity-council
✓ Decided: Council levies special taxes in two University Park districts

The Palm Desert City Council held a special meeting and approved two resolutions authorizing the levy of special taxes in Community Facilities District No. 2005-1 and No. 2021-1 (both University Park) for fiscal year 2024-25. Both motions passed unanimously (4-0). No other substantive decisions were made.

Council Chamber, City Hall
Thu Jul 18, 2024 · 11:00 AM

Civic Engagement Committee

Committee to discuss neighborhood engagement program implementation

The Civic Engagement Committee will meet to discuss the necessity and structure of a neighborhood engagement strategy. The body will also elect a chairperson and vice chairperson and receive an update on a new speaker series.

civic-engagementcommunity-outreachgovernment-administration
✓ Decided: Committee re-elects Vogt as chair, Stjerne as vice chair

The Civic Engagement Committee re-elected Emily Vogt as chairperson and Brook Stjerne as vice-chairperson, both by unanimous 9-0 votes. The committee also approved the consent calendar, including the April 18, 2024 minutes and an informational update on the 'Palm Desert Discussions' speaker series. A discussion on a neighborhood engagement program for non-HOA communities took place, but no formal action was taken.

Administrative Conference Room, City Hall
Tue Jul 16, 2024 · 6:00 PM

Planning Commission

Planning Commission to review cannabis permits and zoning amendments

The Planning Commission will consider the revocation of a cannabis business permit and the modification of another. The body will also discuss a zoning ordinance amendment and the creation of a landscaping regulation task force.

zoningcannabislandscapingland-usepublic-hearings
Council Chamber, City Hall
Thu Jul 11, 2024 · Thursday, July 11, 2024 - 3:30 p.m. Closed Session; 4:00 p.m. Regular Session

Palm Desert City Council - Regular Meeting

Palm Desert Council to consider opioid settlement and fire station design contracts

The City Council will review several infrastructure projects and legal matters, including an opioid settlement with Kroger. The agenda also includes contract awards for fire station architectural services and park facility repairs. Additionally, the council will consider updates to meeting procedures.

opioid-settlementfire-stationpublic-worksinfrastructurelegalbudget
Council Chamber, City Hall
Thu Jul 11, 2024 · 2:45 PM

Palm Desert City Council - Study Session

Palm Desert Council reviews energy partnership and hospital lease agreement

The City Council will hold a study session to review two items without taking formal action. The council will discuss potential participation in the Imperial Irrigation District’s energy infrastructure partnership. They will also receive a presentation regarding a proposed hospital lease agreement for the Desert Healthcare District.

energyhealthcareinfrastructurehospitalpublic-policy
Council Chamber, City Hall
Wed Jul 10, 2024 · 9:00 AM

Cultural Arts Committee

Palm Desert committee to approve artwork installation and new art project RFP

The Cultural Arts Committee will elect its chairperson and vice chairperson. Members will also consider approving an expenditure for Development Services lobby artwork and authorizing a request for proposals for park bench vinyl art wraps. Additionally, the committee will select a theme for the 2025 Student Art and Essay Contest.

public-artstudent-contestpalm-desertcommunity-gallerycivic-center-park
Administrative Conference Room, City Hall
Wed Jul 10, 2024 · 3:30 PM

Housing Commission

Proposed $280,647 change order for One Quail Place parking lot project

The Housing Commission will elect a new Chairperson and Vice-Chairperson. The commission will also consider recommending a change order for the One Quall Place parking lot rehabilitation. Additionally, members will review patrol service bids and 2024 income limits.

housingbudgetparkingpublic-safetyelections
Administrative Conference Room, City Hall
Tue Jul 9, 2024 · 3:30 PM

Public Safety Committee

No specific agenda items were listed for this meeting

The provided text contains only procedural boilerplate and software interface elements. No specific topics, decisions, or discussions are recorded for this Public Safety Committee meeting.

proceduralpalm-desertpublic-safety
Administrative Conference Room, City Hall
Tue Jul 9, 2024 · 12:30 PM

Architectural Review Commission

No agenda items listed for the July 9 Architectural Review Commission meeting

The provided document contains only the structural template and boilerplate information for the Palm Desert Architectural Review Commission meeting. No specific projects, reviews, or decisions are documented in this record.

architectural-reviewpalm-desert
Development Services Conference Room, City Hall
Tue Jul 2, 2024 · 8:30 AM

Parks and Recreation Committee

No specific agenda items listed for the July 2 meeting

The provided document contains only procedural software boilerplate. No substantive agenda items, discussions, or decisions are recorded for this Parks and Recreation Committee meeting.

procedural
Administrative Conference Room, City Hall
Tue Jul 2, 2024 · 6:00 PM

Planning Commission

No substantive agenda items are listed in the provided document

The provided text contains only software interface metadata and boilerplate information. It does not include specific topics, projects, or decisions for the Palm Desert Planning Commission.

procedural
Council Chamber, City Hall
Mon Jul 1, 2024 · 9:00 AM

Homelessness Task Force

No specific agenda items are listed for this meeting

The provided text for the Palm Desert Homelessness Task Force contains only procedural boilerplate and empty template fields. No topics, decisions, or discussions are recorded in the document.

palm-deserthomelessnesstask-forceprocedural
Administrative Conference Room, City Hall
Wed Jun 26, 2024 · 9:00 AM

Historic Preservation Committee

Committee considers historic landmark status for Avondale Golf Club clubhouse

The committee will consider a recommendation to designate the Avondale Golf Club clubhouse as a local historic landmark. Members will also review proposed revisions to the Mills Act program manual. Additionally, the committee is scheduled to approve minutes from the March 27, 2024 meeting.

historic-preservationlandmarksavondale-golf-clubmills-act
Administrative Conference Room, City Hall
Tue Jun 25, 2024 · 12:30 PM

Architectural Review Commission

Design review for architectural revisions to the Bravo Gardens project

The Architectural Review Commission will consider design reviews for two development items. These include architectural revisions to the Bravo Gardens project and signage for Millennium Apartments.

design-reviewarchitecturedevelopmentpalm-desert
Development Services Conference Room, City Hall
Tue Jun 25, 2024 · 11:00 AM

Palm Desert City Council - Special Meeting

Palm Desert City Council to present 2024 State of the City Address

The Palm Desert City Council special meeting includes the 2024 State of the City Address and public notices. No other specific items are listed on this agenda.

palm-desertstate-of-the-citypublic-noticesgovernment
UCR Palm Desert Campus, Building B (Use Parking Lot B)
Thu Jun 20, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

No agenda items provided for El Paseo Parking and Business Improvement District Board

The provided text contains only procedural boilerplate and software interface elements. There are no specific meeting items, discussions, or decisions recorded.

proceduralboilerplate
Administrative Conference Room, City Hall
Wed Jun 19, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board to review Certified Farmer's Market proposal

The board will provide feedback on the FY 2023-2024 budget and give direction for the FY 2024-2025 budget preparation. Members will also interview candidates for board vacancies and receive a marketing update.

budgetfarmers marketboard vacancymarketing
Administrative Conference Room, City Hall
Tue Jun 18, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider 93-unit residential subdivision at Marriott Shadow Ridge

The Planning Commission will review several development proposals, including a new 93-unit single-family residential subdivision. The commission will also consider an amendment to release specific parcels of the Marriott Shadow Ridge project and a permit for an outdoor dining patio on El Paseo.

housingzoningland-usepalm-desertresidential
Council Chamber, City Hall
Mon Jun 17, 2024 · 3:00 PM

Resource Preservation and Enhancement Committee

Committee to receive presentation on Walk and Roll PD Phase 3

The Resource Preservation and Enhancement Committee will review an update on its 2024/2025 work plan. The meeting also includes a presentation regarding Walk and Roll PD Phase 3.

palm-desertwork-planresource-preservation
Administrative Conference Room, City Hall
Thu Jun 13, 2024 · Thursday, June 13, 2024 - Closed Session - 3:00 p.m., Regular Session - 4:00 p.m.

Palm Desert City Council - Regular Meeting

Palm Desert Council considers $1.1 million contract for arboricultural services

The City Council will review several service agreements and contract amendments. Key items include fire protection services with Riverside County, road repair projects funded by Senate Bill 1, and housing program funding.

fire-servicesroadshousingcontractspublic-art
Council Chamber, City Hall
Wed Jun 12, 2024 · 3:30 PM

Housing Commission

Housing Commission to consider $1.1 million contract for arboricultural services

The commission will review several service contracts for Housing Authority properties. These include agreements for tree maintenance, flooring installation, and property upkeep services.

housingcontractsmaintenancearboriculturepalm-desert
Administrative Conference Room, City Hall
Wed Jun 12, 2024 · 9:00 AM

Cultural Arts Committee

Committee considers $300,000 sculpture proposal for San Pablo roundabout

The Cultural Arts Committee is reviewing several public art proposals and reports. Key items include a recommendation for the 'Dueling Palms' sculpture and the relocation of artwork to the Burrtec Waste Management Recycle Center. Members will also receive updates on the library's public art plan and the City Poet Laureate.

public-artsculpturepalm-desertbudgetarts-committee
Administrative Conference Room, City Hall
Tue Jun 11, 2024 · 3:30 PM

Public Safety Committee

Public Safety Committee to approve summer recess and FY 2024-25 meeting schedule

The committee will review May 2024 reports from the Sheriff, Fire Department, and Code Compliance. Members will also consider approving a summer recess and the meeting schedule for fiscal year 2024-25.

public-safetypolicefirecode-compliancebudgetmeeting-schedule
Administrative Conference Room, City Hall
Mon Jun 10, 2024 · 11:00 AM

Palm Desert Recreational Facilities Corporation Board

The board will approve the 2024-2025 financial plan and elect new officers

The Palm Desert Recreational Facilities Corporation Board is meeting to review and approve the proposed financial plan for the 2024-2025 fiscal year. The agenda also includes receiving annual financial reports and tax returns for the fiscal year ended June 30, 2023. Additionally, the board will hold elections for Chair and Vice-Chair.

financebudgetelectionpalm-desert
Administrative Conference Room, City Hall
Tue Jun 4, 2024 · 9:30 AM

Palm Desert City Council - Study Session

No specific agenda items listed for the June 4 study session

The provided document contains only procedural boilerplate and does not list any topics for discussion or decision.

procedural
North Wing Conference Room
Tue Jun 4, 2024 · 6:00 PM

Planning Commission

Environmental study review for Haystack Channel Improvement Project

The Planning Commission will consider an environmental impact study and mitigation program for the Haystack Channel Improvement Project. The commission will also review a recommendation to the City Council regarding amendments to several sections of the city's zoning ordinance.

zoningenvironmentinfrastructurepublic-hearing
Council Chamber, City Hall
Tue Jun 4, 2024 · 3:00 PM

Public Affairs Marketing Panel

No substantive agenda items listed for June 4 meeting

The provided document contains only procedural software metadata and boilerplate text. No specific topics, decisions, or discussions are recorded in the source.

proceduralboilerplate
Administrative Conference Room, City Hall
Tue Jun 4, 2024 · 8:30 AM

Parks and Recreation Committee

Committee to consider Baja California Park improvements and the 2024/25 meeting schedule

The committee will discuss directing staff to obtain quotes for signage, lighting, and landscaping at Baja California Park. Members will also vote on the regular meeting schedule for Fiscal Year 2024/25. Updates from several partner organizations are also scheduled.

parkslandscapingmeeting-schedulerecreation
Administrative Conference Room, City Hall
Thu May 30, 2024 · 2:00 PM

Outside Agency - Charitable Contributions Committee

Committee to award $1.05M in sponsorships and CDBG funds

The Outside Agency Committee will consider approving Community Sponsorship Awards totaling $533,500, Outside Agency Funding Awards totaling $521,000, and an additional $90,000 budget increase for FY 2024-25. They will also review Community Development Block Grant (CDBG) funding allocations for various public services and facility projects. The meeting includes public comment periods and a consent calendar for routine items.

sponsorshipsgrantsbudgetcommunity-developmentpublic-services
Administrative Conference Room, City Hall
Thu May 30, 2024 · 9:00 AM

Palm Desert City Council - Study Session

Palm Desert City Council study session agenda is procedural only

This agenda contains only boilerplate interface text from the eSCRIBE agenda management system and no actual agenda items, decisions, or discussion topics. The meeting is listed as a study session for May 30, 2024, but no substantive business is described.

city-councilstudy-sessionprocedural
Administrative Conference Room, City Hall
Tue May 28, 2024 · 10:00 AM

Finance Committee

Finance Committee to review monthly financial reports and city budget update

The Palm Desert Finance Committee will meet to receive and file routine financial reports for March and April 2024, including General Fund, Parkview Office Complex, Desert Willow Golf Resort, and City Treasurer's investment reports. The committee will also hear a city budget update from staff. The agenda is largely procedural, with no major decisions or public hearings.

financebudgetreportsinvestmentsgolf-resortparkview
Administrative Conference Room, City Hall
Thu May 23, 2024 · 4:00 PM

Palm Desert City Council - Regular Meeting

Council to decide on El Paseo dining decks, road work, and $3M CV Link contract

The Palm Desert City Council, along with the Successor Agency and Housing Authority, will consider a consent calendar with routine approvals and several action items. Key decisions include direction on the El Paseo dining deck program and street improvement schedule, the scope of the Walk and Roll PD Phase 3 project, and a $3.05 million contract for CV Link enhancements and slurry seal. The meeting also includes presentations on the Lift to Rise action plan and a proclamation for National Public Works Week.

zoninghousingroadsbudgetparkspublic-workseconomic-development
Council Chamber, City Hall
Thu May 23, 2024 · 3:00 PM

Palm Desert City Council - Study Session

Council to review library programs and zoning code amendments

The Palm Desert City Council will hold a study session to receive an informational update on library programs and partnerships, and to provide feedback on proposed clean-up amendments to Title 25 of the municipal code. No formal action will be taken at this meeting.

libraryzoningcity-councilstudy-session
Council Chamber, City Hall
Thu May 23, 2024 · 8:00 AM

Building Board of Appeals

Appeal over Serena Drive den's bedroom status heads to board

The Building Board of Appeals will hear an appeal of the Chief Building Official's determination that a room at 239 Serena Drive, approved as a den in the original 1979 floor plan, cannot be used as a bedroom because it lacks required emergency escape and rescue egress under the 2022 California Residential Code. The board will also nominate and appoint a chair and vice chair. The meeting is otherwise procedural, with time for non-agenda public comments.

building-codeappealshousingzoningpublic-hearing
Administrative Conference Room, City Hall
Wed May 22, 2024 · 9:00 AM

Historic Preservation Committee

Agenda contains only procedural boilerplate

The agenda for the Palm Desert Historic Preservation Committee meeting on May 4, 2022, contains no substantive items. The text is entirely composed of interface elements and placeholders from the eSCRIBE system, with no decisions, proposals, or discussions listed.

Administrative Conference Room, City Hall
Tue May 21, 2024 · 6:00 PM

Planning Commission

Planning Commission to review 40-unit multifamily project and 332-home development

The Palm Desert Planning Commission will hold public hearings on three major items: a 40-unit multifamily development (ARC Village), a 332 single-family home project by Pulte Homes, and the potential revocation of a cannabis business permit. The commission will also review the Fiscal Year 2024-25 Capital Improvement Program for consistency with the General Plan. Consent items include approval of the May 7, 2024 minutes.

zoninghousingcannabiscapital-improvementspublic-hearingplanning-commission
Council Chamber, City Hall
Tue May 21, 2024 · 9:00 AM

Homelessness Task Force

Task force to weigh $100K CV Housing First contribution

The Palm Desert Homelessness Taskforce will consider recommending City Council approval of a Memorandum of Understanding with the Coachella Valley Association of Governments and a $100,000 annual contribution to the CV Housing First Program for Fiscal Year 2024/2025. The task force will also approve its FY 2024/2025 meeting schedule and minutes from March 4, 2024. Informational reports on code compliance and CityNet activity will be received and filed.

homelessnesshousingbudgetintergovernmental-agreement
Administrative Conference Room, City Hall
Thu May 16, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

El Paseo Parking and Business Improvement District Board meeting agenda is procedural only

This agenda contains only boilerplate and no substantive items. The meeting is scheduled for May 16, 2024, but no decisions, discussions, or specific agenda items are listed.

parkingbusiness-improvement-districtprocedural
Administrative Conference Room, City Hall
Tue May 14, 2024 · 3:30 PM

Public Safety Committee

Palm Desert Public Safety Committee to review road work scheduling during special events

The Public Safety Committee is meeting to review and provide feedback on current procedures for scheduling road work and road closures during special events. The agenda also includes routine consent items such as approval of minutes and monthly reports from police, fire, code compliance, emergency services, and other public safety units.

public-safetyroad-closuresspecial-eventspolicefirecode-compliancebudgethomeless-services
Administrative Conference Room, City Hall
Tue May 14, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

Board to review FY 2023-24 budget, set direction for FY 2024-25

The El Paseo Parking and Business Improvement District Board is meeting to approve routine items including minutes and financial statements, and to review the current fiscal year budget and marketing plan to provide direction for the upcoming budget. Public comment is allowed on non-agenda items and consent calendar items.

budgetfinancialsmarketingparkingbusiness-improvement-district
North Wing Conference Room
Thu May 9, 2024 · 2:45 PM

Palm Desert City Council - Study Session

Council to review Chuckwalla monument, mobility plan, library policies

This is a study session only; no formal action will be taken. The City Council, along with the Successor Agency and Housing Authority, will receive updates on the proposed Chuckwalla National Monument and Joshua Tree National Park expansion, discuss future updates to the General Plan Mobility Element, and hear an informational report on library policies.

study-sessionnational-monumentgeneral-planmobilitylibraryjoint-meeting
Council Chamber, City Hall
Thu May 9, 2024 · 4:00 PM

Palm Desert City Council - Regular Meeting

Council to vote on catalytic converter ban, library board, and more

The Palm Desert City Council is holding a regular meeting with a consent calendar covering routine approvals and several action items. Key decisions include adopting ordinances on catalytic converter possession and a library board, approving contracts and leases, and providing direction on the Lupine Plaza project. A public hearing will consider an appeal of a short-term rental bedroom determination.

ordinancecatalytic-converterlibrarycontractsleaseshort-term-rentalpublic-hearing
Council Chamber, City Hall
Wed May 8, 2024 · 3:30 PM

Housing Commission

Housing Commission to award $418,680 landscape contract, approve vendor purchases

The Palm Desert Housing Commission will consider consent and action items, including approving minutes, setting FY 2024/2025 meeting dates, and authorizing purchases from Lowe's, Home Depot, HD Supply, and Sherwin Williams for housing authority properties. Action items include awarding a landscape maintenance contract to Excel Landscape, Inc. for $418,680 annually plus up to $85,000 for repairs, and approving agreements with Garland/DBS for roof repairs and with Quill and Waxie for supplies. The commission will also receive informational reports, including a Home Improvement Program activity report.

Administrative Conference Room, City Hall
Wed May 8, 2024 · 9:00 AM

Cultural Arts Committee

Committee to recommend mural donation, sculpture purchase, and deaccession

The Cultural Arts Committee will consider recommending City Council action on several public art items: accepting a donated 50th Anniversary children's mural, deaccessioning a library mural, and purchasing a sculpture from the El Paseo exhibition. They will also provide input on a potential Civic Center Park art installation and receive a presentation from Desert X. The meeting is largely routine, with consent calendar items and informational reports.

public-artcultural-artsmuralsculpturedonationdeaccession
Administrative Conference Room, City Hall
Tue May 7, 2024 · 10:00 AM

Palm Desert City Council - Study Session

Council continues FY 2024-25 budget study session

The Palm Desert City Council, Successor Agency, and Housing Authority will hold a joint study session to continue reviewing the proposed Fiscal Year 2024-25 Financial Plan and Five-Year Capital Improvement Program. No action will be taken; the council will receive a presentation and provide general feedback.

budgetcapital-improvementcity-councilfinancial-planstudy-session
Council Chamber, City Hall
Tue May 7, 2024 · 6:00 PM

Planning Commission

Palm Desert Planning Commission discusses animal clinic and environmental guidelines

The Commission will consider several public hearing items, including an environmental study for the Haystack Channel Improvement Project. They will also review a permit for a 24-hour emergency animal clinic and a recommendation regarding local CEQA guidelines.

zoninganimal-clinicsenvironmentpublic-hearingsinfrastructure
Council Chamber, City Hall
Tue May 7, 2024 · 8:30 AM

Parks and Recreation Committee

Parks committee to weigh adding KPI scoring to monthly park reports

The Palm Desert Parks and Recreation Committee is meeting to discuss adding KPI scoring, or 'Park Maintenance Evaluations,' to its monthly parks reports. The committee will also consider approving the April 2, 2024 minutes and receive updates from partner organizations and city staff. The meeting is largely routine, with most items being informational reports to be received and filed.

parksrecreationkpireportspublic-art
Administrative Conference Room, City Hall
Mon May 6, 2024 · 9:00 AM

Homelessness Task Force

Homelessness Task Force meeting agenda contains no substantive items

This agenda for the Palm Desert Homelessness Task Force meeting on May 6, 2024, contains only procedural boilerplate and no listed agenda items, decisions, or discussion topics. The document appears to be a system-generated placeholder with no substantive content for residents to review.

homelessnesstask-forceprocedural
Administrative Conference Room, City Hall
Mon May 6, 2024 · 1:00 PM

Palm Desert City Council - Study Session

Council reviews proposed FY 2024-25 budget and five-year capital plan

The Palm Desert City Council, along with the Successor Agency and Housing Authority, will hold a study session to review the proposed Fiscal Year 2024-25 Financial Plan and Five-Year Capital Improvement Program. No formal action will be taken; the council will receive the report and provide general feedback. The meeting is a joint session and may be conducted as a hybrid meeting.

budgetcapital-improvementcity-councilstudy-session
Council Chamber, City Hall
Thu Apr 25, 2024 · 3:15 PM

Palm Desert City Council - Study Session

Council to review stormwater protection plan update

The Palm Desert City Council holds a study session to review an update on current stormwater protection efforts and proposed improvements. No action will be taken at this meeting. The session is a joint meeting with the Successor Agency and Housing Authority.

stormwaterinfrastructurecity-council
Council Chamber, City Hall
Thu Apr 25, 2024 · 3:45 PM

Palm Desert City Council - Regular Meeting

Council to vote on rail station study, catalytic converter ban, and $11.7M contract

The Palm Desert City Council will hold a regular meeting with a consent calendar and several action items. Key decisions include adopting a rail station feasibility study, introducing an ordinance to ban unlawful possession of catalytic converters, and awarding a large on-call construction management contract. The council will also consider a street vacation, library board establishment, and various project approvals.

zoningpublic-safetytransportationcontractsparkslibrary
Council Chamber, City Hall
Wed Apr 24, 2024 · 9:00 AM

Historic Preservation Committee

Historic Preservation Committee meeting agenda contains no substantive items

This agenda for the Palm Desert Historic Preservation Committee meeting on April 24, 2024, contains only procedural boilerplate and no listed agenda items, decisions, or discussion topics. The document is essentially empty of substantive content.

historic-preservationprocedural
Administrative Conference Room, City Hall
Tue Apr 23, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

EPPBID board to set FY 2024-25 budget meeting date, discuss merchant mixer

The El Paseo Parking and Business Improvement District Board will hold a regular meeting with routine consent items (minutes, financials) and informational reports from staff, sheriff, and marketing. Action items include selecting a date for the FY 2024-2025 budget special meeting, providing feedback on a potential May merchant mixer, receiving a courtesy cart special event request protocol, and discussing updates on El Paseo benches and trash receptacles.

budgetbusiness-improvement-districtparkingmarketingpublic-worksspecial-events
Administrative Conference Room, City Hall
Thu Apr 18, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

El Paseo Parking and Business Improvement District Board meeting agenda is procedural only

This agenda for the Palm Desert El Paseo Parking and Business Improvement District Board meeting contains only procedural boilerplate and no substantive items. No decisions, proposals, or discussions are listed for the 2024-04-18 meeting.

parkingbusiness-improvement-districtprocedural
Administrative Conference Room, City Hall
Thu Apr 18, 2024 · 11:00 AM

Civic Engagement Committee

Committee to discuss outreach methods, approve 2024 work plan

The Palm Desert Civic Engagement Committee will discuss how to improve outreach to diverse communities, including methods to increase meeting attendance and survey responses. The committee will also vote on approving its 2024 work plan. Informational items include a presentation on the new municipal library and an update on the HOA outreach strategy.

civic-engagementoutreachlibraryhoawork-plan
Administrative Conference Room, City Hall
Tue Apr 16, 2024 · 6:00 PM

Planning Commission

Planning Commission meeting agenda contains no substantive items

This agenda for the Palm Desert Planning Commission meeting on April 16, 2024, contains only procedural boilerplate and no listed agenda items, decisions, or discussions. The document appears to be a system-generated template with no substantive content.

planning-commissionprocedural
Council Chamber, City Hall
Mon Apr 15, 2024 · 3:00 PM

Resource Preservation and Enhancement Committee

Committee to outline 2024/2025 workplan and hear waste services presentation

The Resource Preservation and Enhancement Committee is meeting to consider approving its draft 2024/2025 workplan for City Council approval, and to receive a presentation from Burrtec Waste and Recycling Services. The agenda also includes routine items such as approving minutes and public comments.

workplanwaste-servicesrecyclingcommittee-meetingpublic-comment
Administrative Conference Room, City Hall
Thu Apr 11, 2024 · 4:00 PM

Palm Desert City Council - Regular Meeting

Council to consider $6.75M affordable housing loans and new design standards

The Palm Desert City Council, Successor Agency, and Housing Authority will meet jointly to decide on consent items and several major actions. Key items include approving a $1.64M land purchase for flood infrastructure, increasing facilities repair contracts by $1.5M, and introducing a zoning ordinance for residential and mixed-use design standards. The council will also consider a broadband master plan and a resolution on mayor appointment procedures.

affordable-housingzoningbroadbandbudgetpublic-workscontractsflood-infrastructure
Council Chamber, City Hall
Thu Apr 11, 2024 · 3:00 PM

Palm Desert City Council - Study Session

Council to review Mills Act guidelines and Dining Deck program updates

This is a study session of the Palm Desert City Council, Successor Agency, and Housing Authority. No formal action will be taken; the council will review and provide feedback on proposed changes to the Mills Act Contract Guidelines and an update on the Dining Deck Program.

mills-actdining-deckstudy-sessioncity-council
Council Chamber, City Hall
Wed Apr 10, 2024 · 3:30 PM

Housing Commission

Housing Commission to review proposed FY 2024-25 Housing Authority budget

The Palm Desert Housing Commission will consider recommending approval of the proposed FY 2024-25 Palm Desert Housing Authority budget and capital improvement plan for inclusion in the city's comprehensive annual financial plan. The agenda also includes routine consent items, such as approving the March 13, 2024 minutes, and informational reports on property management, renovations, and the Home Improvement Program.

housingbudgetcapital-improvementsproperty-managementrenovationshome-improvement
Administrative Conference Room, City Hall
Wed Apr 10, 2024 · 9:00 AM

Cultural Arts Committee

Committee to select student art winners, approve El Paseo sculptures and murals

The Palm Desert Cultural Arts Committee is meeting to approve several public art projects, including selecting winners of the 2024 Student Art and Essay Contest for vinyl art wrap installations, approving sculptures for the 2025/2026 El Paseo Sculpture Exhibition, and approving mural designs for the Aquatic Center and a community mural project. The committee will also receive an informational report on the FY 2024/2025 Public Art budget and projects, and approve minutes from prior meetings.

public-artstudent-contestsculpturemuralsbudget
Administrative Conference Room, City Hall
Tue Apr 9, 2024 · 3:30 PM

Public Safety Committee

Committee to recommend catalytic converter possession ordinance to City Council

The Public Safety Committee will consider recommending an ordinance to the City Council that would prohibit unlawful possession of catalytic converters in Palm Desert. The committee will also approve routine consent items including monthly reports from police, fire, code compliance, emergency services, and citizen patrol programs.

public-safetycatalytic-converterspolicefirecode-complianceordinance
Administrative Conference Room, City Hall
Tue Apr 2, 2024 · 8:30 AM

Parks and Recreation Committee

Parks committee to receive reports from partner organizations

The Parks and Recreation Committee will meet to approve minutes from March 5, 2024, and receive informational updates from partner organizations including the Palm Desert Aquatic Center, First Tee - Coachella Valley, Friends of the Desert Mountains, Palm Desert Library, Friends of the Library, Family YMCA of the Desert, and Desert Recreation District. No action items are scheduled for discussion.

parksrecreationcommittee-meetingreportsminutes
Administrative Conference Room, City Hall
Tue Apr 2, 2024 · 6:00 PM

Planning Commission

Commission to recommend new residential design standards to City Council

The Planning Commission will consider adopting Resolution No. 2863, recommending the City Council approve a zoning ordinance amendment to add Chapter 25.42 (Objective Design Standards) to the Palm Desert Municipal Code. The standards would apply to residential and mixed-use projects. The Commission will also consider finding the project exempt from CEQA review. The rest of the agenda is routine, including approval of the March 19, 2024 minutes and informational reports.

Council Chamber, City Hall
Tue Apr 2, 2024 · 3:00 PM

Public Affairs Marketing Panel

Palm Desert marketing panel to review tourism campaign, 2024-25 budget priorities

The Palm Desert Marketing Committee is meeting to receive a status update on the Fiscal Year 2023/2024 tourism campaign and to provide feedback on proposed marketing budget priorities for Fiscal Year 2024/2025. The agenda also includes routine items such as approving the December 5, 2023 meeting minutes and hearing non-agenda public comments.

marketingtourismbudgetpublic-commentsminutes
Administrative Conference Room, City Hall
Thu Mar 28, 2024 · 3:30 PM

Palm Desert City Council - Regular Meeting

Council to consider $1.5M grant for I-10 properties hit by Tropical Storm Hilary

The Palm Desert City Council, Successor Agency, and Housing Authority will meet jointly to discuss closed-session real estate negotiations and labor talks, then consider a $1.5 million emergency grant program for commercial property owners and HOAs along Interstate 10 affected by Tropical Storm Hilary. Other action items include replacing a bronze plaque at the Desert Holocaust Memorial and placing a Peace Pole at the Community Rose Garden. The consent calendar includes a zone change at 73600 Alessandro Drive, a new library architect contract for up to $514,865, and a $624,527 CNG street sweeper purchase.

zoningbudgetpublic-safetyparkslibrarystreetshousing
Council Chamber, City Hall
Thu Mar 28, 2024 · 3:00 PM

Palm Desert City Council - Study Session

Council to discuss library advisory committee and animal services contract

The Palm Desert City Council will hold a study session to discuss two topics: the potential formation of a Library Advisory Committee and a 501(c)(3) Foundation, and an update on the Animal Services Contract with Riverside County Animal Services. No formal action will be taken at this meeting.

libraryanimal-servicescontractadvisory-committeefoundation
Council Chamber, City Hall
Wed Mar 27, 2024 · 9:00 AM

Historic Preservation Committee

Committee to recommend 2024/25 work plan to City Council

The Cultural Resources Preservation Committee will consider recommending a draft work plan for fiscal year 2024/2025 to the City Council. The agenda also includes approval of the January 24, 2024 meeting minutes and a consent calendar. No public hearings or action items other than the work plan are scheduled.

historic-preservationwork-planminutespublic-comment
Administrative Conference Room, City Hall
Tue Mar 26, 2024 · 10:00 AM

Finance Committee

Finance Committee to review January and February 2024 financial reports

The Palm Desert Finance Committee will meet to receive and file routine financial reports for January and February 2024. Items include the General Fund financial reports, Parkview Office Complex financial and vacancy reports, Desert Willow Golf Resort financial reports, and the City Treasurer's investment reports. The committee will also consider approving the minutes from the January 22, 2024 meeting. No major policy decisions or new business are on the agenda.

financefinancial-reportsinvestmentgolf-resortparkview-officegeneral-fundpalm-desert
Administrative Conference Room, City Hall
Thu Mar 21, 2024 · 8:00 AM

El Paseo Parking and Business Improvement District Board

El Paseo Parking and Business Improvement District Board meeting, March 21, 2024

The agenda contains only procedural boilerplate and no substantive items for discussion or decision.

parkingbusiness-improvement-districtprocedural
Administrative Conference Room, City Hall
Tue Mar 19, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider 384-unit apartment project and street vacation

The Palm Desert Planning Commission will hold public hearings on two large apartment developments and a street vacation. They will also receive an update on a cannabis facility's conditional use permit revocation.

planning-commissionhousingapartmentsstreet-vacationcannabisland-usepublic-hearing
Council Chamber, City Hall
Thu Mar 14, 2024 · 3:00 PM

Palm Desert City Council - Study Session

Study session on El Paseo crosswalks and dog park parking

The Palm Desert City Council will hold a study session to review traffic assessment studies for raised mid-block crossings on El Paseo and parking options at the University Dog Park. No action will be taken at this meeting.

trafficparkingparkspedestrian-safetystudy-session
Council Chamber, City Hall
Thu Mar 14, 2024 · 3:30 PM

Palm Desert City Council - Regular Meeting

Council to consider $1.8M in park improvements, new library furniture, and zoning changes

The Palm Desert City Council will hold a joint regular meeting with the Successor Agency and Housing Authority. Key decisions include appropriating $1.8 million from facility reserves for park and facility improvements, authorizing up to $650,000 for new library furniture, and introducing zoning changes for a property on Alessandro Drive and new objective design standards for residential and mixed-use projects.

budgetzoningparkslibraryhousingpublic-worksdesign-standards
Council Chamber, City Hall
Tue Mar 12, 2024 · 3:30 PM

Public Safety Committee

Fire Station 102 project update presented to committee

The Palm Desert Public Safety Committee will receive a presentation on the Fire Station 102 project. The consent calendar includes approval of February 2024 meeting minutes and receiving monthly reports from specialized units, fire, code compliance, emergency services, Citizen on Patrol, and ALPR. No action items are listed.

public-safetyfire-stationpolicecode-complianceemergency-services
Administrative Conference Room, City Hall
Tue Mar 5, 2024 · 6:00 PM

Planning Commission

Planning Commission to vote on pad elevation revision for 332-home project

The Palm Desert Planning Commission will hold a public hearing and consider adopting a resolution to approve a revision to approved pad elevations for Tentative Tract Map 38434, a 332 single-family home development on 93.56 acres south of Gerald Ford Drive and west of Portola Road in the Refuge Specific Plan area. The consent calendar includes approval of the February 20, 2024 meeting minutes. No other action items are listed.

planning-commissionpublic-hearingresidential-developmentpad-elevationtentative-tract-maprefuge-specific-plan
Administrative Conference Room, City Hall
Tue Mar 5, 2024 · 8:30 AM

Parks and Recreation Committee

Committee to hear updates from parks, library, and recreation partners

The Parks and Recreation Committee will receive informational updates from partner organizations including the Palm Desert Aquatic Center, First Tee, Friends of the Desert Mountains, the Palm Desert Library, and the YMCA. The committee will also hear reports on park projects such as Cahuilla Hills Park design and Hovley Soccer Park. No action items or decisions are scheduled; the meeting is primarily for discussion and updates.

parksrecreationlibrarycommunity-updatespalm-desert
Administrative Conference Room, City Hall
Wed Feb 28, 2024 · 9:00 AM

Historic Preservation Committee

Historic Preservation Committee meets Feb. 28, 2024

The agenda contains only procedural boilerplate and no substantive items for discussion or decision.

historic-preservationprocedural
Administrative Conference Room, City Hall
Tue Feb 20, 2024 · 6:00 PM

Planning Commission

Planning Commission to hear 5 public hearing items including zoning change, condos, storage, wedding chapel

The Palm Desert Planning Commission will hold public hearings on five items: an 18-month time extension for a 32-unit condominium project at Gerald Ford Dr and Shepherd Ln; a precise plan to revise a pad elevation at 178 Tekis Place; a recommendation to the City Council to rezone 73600 Alessandro Drive to Downtown Edge; a precise plan for a 61,788 sq ft personal storage facility at 75220 Merle Drive; and a use determination and conditional use permit for a wedding chapel at 72221 Highway 111. The meeting also includes a consent calendar to approve the February 6, 2024 minutes and non-agenda public comments.

zoninghousingland-usepublic-hearingplanning-commission
Administrative Conference Room, City Hall
Thu Feb 15, 2024 · 3:00 PM

Palm Desert City Council - Study Session

Council reviews Article 34 authority and visitor services

This is a study session only; no action will be taken. The council will receive a presentation on the City's authority under Article 34 of the California Constitution and its status. They will also receive a presentation on Palm Desert Visitor Services.

study-sessionconstitutional-authorityvisitor-services
Council Chamber, City Hall
Thu Feb 15, 2024 · 3:30 PM

Palm Desert City Council - Regular Meeting

Council to adopt mid-year budget adjustments and issue special tax bonds

The Palm Desert City Council will consider mid-year budget adjustments for fiscal year 2023-24 and a resolution authorizing the issuance of University Park Community Facilities District No. 2021-1 Special Tax Bonds, Series 2024. The consent calendar includes approval of a five-year automated license plate recognition software subscription with Flock Safety, a three-year lease for Indian Wells Fire Station No. 55, and a contract for auditing services totaling $89,082 for the first year. The council will also adopt ordinances eliminating ranked-choice voting and establishing a municipal library.

budgetfinancepublic-safetyhousingzoning
Council Chamber, City Hall
Wed Feb 7, 2024 · 12:00 PM

Palm Desert City Council - Study Session

Council reviews 2023 goals, sets 2024 priorities in study session

The Palm Desert City Council, Successor Agency, and Housing Authority hold a joint study session to review progress on 2023 goals and provide input for 2024 goals. No action will be taken. The session also includes a closed session to evaluate the City Manager's performance.

city-councilgoalsperformance-evaluationstudy-session
Council Chamber, City Hall
Tue Feb 6, 2024 · 6:00 PM

Planning Commission

Planning Commission to consider new fire station, subdivision, and design standards

The Palm Desert Planning Commission will hold public hearings on three items: a tentative parcel map to split a parcel at 49425 JFK Trail into two lots and a retention lot; a conditional use permit and precise plan for an 11,380-square-foot fire station at 75665 Gerald Ford Drive; and a recommendation to the City Council to adopt objective design standards for residential and mixed-use projects. The commission will also consider approving the January 4, 2024 meeting minutes and receive informational reports.

planning-commissionzoningfire-stationsubdivisiondesign-standardspublic-hearing
Council Chamber, City Hall
Thu Jan 25, 2024 · 2:30 PM

Palm Desert City Council - Study Session

Council to review roles, new laws, and farmers' market update

This is a study session only; no formal action will be taken. The City Council will receive presentations on council roles and new laws (including the Levine Act) and an update on Palm Desert Farmers' Markets. A traffic assessment item was removed at staff's request.

city-councilstudy-sessionelectionsfarmers-markettraffic
Council Chamber, City Hall
Tue Jan 16, 2024 · 6:00 PM

Planning Commission

Planning Commission to recommend new residential design standards

The Planning Commission will consider recommending that the City Council adopt Residential and Mixed-Use Objective Design Standards and amend Title 25 of the Municipal Code. The item is the only substantive action on the agenda; the rest is procedural.

zoningdesign-standardshousingplanning-commission
Council Chamber, City Hall
Thu Jan 11, 2024 · 3:30 PM

Palm Desert City Council - Regular Meeting

Council to consider adopting new district map and cannabis rules

The Palm Desert City Council will hold a public hearing to adopt a new city council election district boundaries map (Map 109 Renumbered B) and introduce an ordinance for by-district elections. The council will also discuss and provide direction on updating zoning and business regulations for cannabis manufacturing businesses, including options to limit such businesses. Other action items include awarding a $948,920 contract for a Vision Zero strategy and approving a second amendment to a development agreement with Desert Wave Ventures, LLC.

redistrictingcannabiszoningvision-zerodevelopment-agreementpublic-hearingbudget
Council Chamber, City Hall
Thu Jan 11, 2024 · 2:30 PM

Palm Desert City Council - Study Session

Council to review library services and broadband feasibility study

This is a study session only; no action will be taken. The council will receive information on the progress of municipal library services and next steps, and provide feedback on the Palm Desert Broadband Feasibility and Master Plan Study.

librarybroadbandstudy-sessionpalm-desert
Council Chamber, City Hall
Thu Jan 4, 2024 · 6:00 PM

Planning Commission

Planning Commission to revoke one cannabis permit, modify another

The Palm Desert Planning Commission is holding a special meeting to conduct public hearings on two cannabis-related conditional use permits. They will consider revoking a permit for a manufacturing, delivery, and distribution business at 75-080 Saint Charles Place, and modifying another permit at 77-700 Enfield Lane to remove manufacturing and allow only distribution.

planning-commissioncannabisconditional-use-permitpublic-hearingpalm-desert
Council Chamber, City Hall
Tue Jan 2, 2024 · 6:00 PM

Planning Commission

Palm Desert Planning Commission meeting cancelled for January 2, 2024

This meeting of the Palm Desert Planning Commission was cancelled. The agenda consists only of procedural items with no substantive business scheduled.

cancelledplanning-commissionpalm-desert
Council Chamber, City Hall