The Boring PartsFederalLocal · USLocal · Canada
Sewickley, PA

Sewickley public meetings in 2024

56 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Tue Dec 10, 2024

Borough Council

Council to set 2025 real estate tax millage at 6.25 mills and adopt budget

The Sewickley Borough Council will vote on setting the 2025 real estate tax millage rate at 6.25 mills and adopting the 2025 proposed municipal budget. Other actions include approving a police pension contribution waiver, updating civil service rules, and authorizing a structural assessment of the Hoey's Run Culvert. The meeting also includes public comment, introduction of a new police patch, and several other motions.

budgettaxespensionpolicecivil-serviceparkingparksinfrastructure
✓ Decided: Council adopts 2025 budget, sets 6.25 mill tax rate

The council approved the 2025 municipal budget and set the real estate tax millage at 6.25 mills. It also approved a police pension contribution waiver for 2017-2018, updated civil service rules, and authorized several projects including a culvert assessment and bids for park and parking lot work. A ground lease amendment for the Village Theater Company was tabled.

Tue Dec 3, 2024

Shade Tree Commission

Shade Tree Commission to review tree removal, planting, and applications at 3 properties

The Sewickley Shade Tree Commission will meet to discuss the fall/winter tree removal and planting programs, and review tree work applications at 703 Harbaugh Street, 121 River Avenue, and 330 Frederick Avenue. The commission will also consider a landscape plan for 328 Beaver Street/327 Duquesne Way requested by the Planning Commission. Additionally, they will discuss changes to the tree ordinance and a list of licensed tree experts.

shade-tree-commissiontree-removaltree-plantingtree-permitslandscape-planordinancesewickley
Mon Dec 2, 2024

Historic Review Commission

Historic Review Commission to review local ordinances

The Historic Review Commission is meeting to review several sections of the borough's ordinances, including definitions and criteria for exterior work applications. The body will also discuss the Herbst House and the commission's webpage.

historic-preservationordinance-reviewzoningsewickley
Tue Nov 26, 2024

Borough Workshop

Sewickley Council to discuss 2025 millage draft resolution

Borough Council will review a draft resolution for the 2025 millage and discuss parking policies and a theater lease agreement. The meeting includes reports on capital improvements and traffic study findings from Gateway Engineers.

taxesparkingtrafficordinancesleasing
Tue Nov 12, 2024

Borough Council

Council to decide on emergency culvert repairs, $2.2M in grants, park smoking ban

The Sewickley Borough Council will vote on resolutions to ratify emergency repairs to Hoey's Run culvert (damaged by a sinkhole at 357 Ferry Street) without bidding, and to apply for three Local Share Account grants totaling $2,197,600.13 for WWTP UV upgrades, Crescent Phase 2 slope repairs, and 2025 sewer repairs. Two ordinances are proposed: one prohibiting smoking in borough parks (Ordinance 1391) and another setting rates and rules for borough-owned EV charging stations (Ordinance 1392). Other items include a Certificate of Historic Appropriateness for a fence at 340 Walnut Street, final payments for grant projects, and advertising the 2025 proposed budget.

emergency-repairsculvertsinkholegrantsparkssmoking-banev-charginghistoric-preservation
Tue Nov 5, 2024

Zoning Hearing Board

Zoning board to hear variances for daycare and restaurant loading in Sewickley

The Zoning Hearing Board will hold hearings on two variance applications. Case 24-11 seeks variances to operate a daycare-nursery in a dwelling at 618 Locust Place, including a reduced buffer yard. Case 24-12 seeks a variance to waive off-street loading space for a proposed restaurant at 524 Locust Place.

zoningvariancesdaycarerestaurantland-usesewickley
Tue Nov 5, 2024

Shade Tree Commission

Shade Tree Commission to review fall/winter tree work and applications at 220 Bank St and 328 Beaver St

The Sewickley Shade Tree Commission will approve October meeting minutes, hear the borough arborist's report on fall/winter tree removal, planting, and maintenance programs, and consider tree work applications for 220 Bank Street and 328 Beaver Street/327 Duquesne Way (where a $350 payment has been received for a new tree). Old business includes proposed changes to the tree ordinance and a list of licensed tree experts.

shade-treesewickleytree-removaltree-plantingtree-maintenancepermitsordinancetree-commission
Mon Nov 4, 2024

Historic Review Commission

HRC to discuss Keystone preservation grant and historic district ordinance review

The Historic Review Commission will discuss a Keystone preservation planning grant as new business and continue review of the historic district ordinance as old business. They will also approve minutes from the September and October 2024 meetings. The public is invited for informal guidance on historic construction.

historic-preservationplanning-granthistoric-district-ordinancepublic-engagementsewickley
Tue Oct 22, 2024

Borough Workshop

Council to discuss 2025 budget, millage rate, and new ordinances

Sewickley Borough Council holds a workshop meeting to discuss the 2025 budget and millage rate, a proposed smoking ban in parks, an EV charging ordinance, and other items. The meeting includes committee reports and updates on the Ferry Sinkhole and Walnut Green ribbon cutting.

budgetmillage-ratesmoking-banev-chargingparksfire-safetysinkhole
Tue Oct 8, 2024

Borough Council

Council to vote on Route 65 corridor improvement agreement

The council will vote on resolutions including an intergovernmental cooperation agreement for the Route 65 corridor and approve sewer repair contracts totaling over $260,000. They will also set 2025 pension obligations, consider naming a park 'Walnut Green,' and decide on several street closure requests for events.

intergovernmentalroadssewerbudgetpoliceparksevents
Mon Oct 7, 2024

Historic Review Commission

Historic Review Commission to review fence construction at 340 Walnut Street

The Historic Review Commission will meet to discuss a new fence and gate proposal at 340 Walnut Street. The body will also receive updates on the CLG grant and the Herbst House.

historic-preservationzoningfencingordinance-review
Tue Oct 1, 2024

Shade Tree Commission

Shade Tree Commission to review fall tree removal and planting programs

The Sewickley Shade Tree Commission will discuss the Borough Arborist's report covering the 2024 summer/fall tree removal program, fall tree planting program, and fall maintenance program. They will also consider tree work applications for specific properties and revisit the tree ordinance and licensed tree experts list.

shade-treearboristtree-removaltree-plantingpermitstree-ordinancepublic-works
Tue Sep 24, 2024

Borough Workshop

Sewickley Council to discuss 2025 budget and local infrastructure

The Borough Council is holding a workshop to review the 2025 budget and various community updates. Discussions include maintenance on Broad Street and several new park and street amenities.

budgetinfrastructureparkstransportationplanning
Tue Sep 10, 2024

Borough Council

Sewickley Council to consider nearly $1 million in sewer and wastewater grants

The Borough Council will vote on two grant requests for sewer repairs and wastewater plant upgrades. The meeting includes a public hearing regarding a mixed-use application for 436 Beaver Street and several requests for street closures for block parties and events.

sewersgrantszoningroadspublic-events
Mon Sep 9, 2024

Historic Review Commission

HRC reviews garage construction at 330 Frederick Avenue

The Historic Review Commission will consider a proposal for a two-car detached garage and fencing at 330 Frederick Avenue in the R-1A zoning district and HRC district #3. They will also discuss updates on the CLG Grant, historic district ordinance review, Herbst House, and preservation of bridge finials. The meeting includes approval of minutes from previous months and public engagement opportunities.

historic-preservationsewickleyzoninggrantsordinance-reviewarchitecture
Wed Sep 4, 2024

Planning Commission

Planning Commission to decide on 640 Canterbury Lane subdivision

The Planning Commission will hold a public hearing for a subdivision application at 640 Canterbury Lane, filed by LSSE Engineering on behalf of Henry Sullivan. Following the hearing, the commission will vote to recommend, not recommend, or table the application. Old business includes a discussion of zoning ordinances.

planningsubdivisionzoningpublic-hearing
Tue Sep 3, 2024

Shade Tree Commission

Shade Tree Commission to discuss tree ordinance and applications for tree work

The Commission will hear the Borough Arborist’s report on the 2024 summer/fall tree removal program, spring tree planting and maintenance programs. It will consider applications for tree work at four residential addresses. The Commission will also revisit a tree ordinance (Ordinance No. 1342) and maintain a list of licensed tree experts.

shade-tree-commissiontree-removaltree-plantingtree-ordinancearboristsewickley
✓ Decided: Shade Tree Commission approves four tree removal applications

The Sewickley Shade Tree Commission approved four tree removal applications, including two private removals and two borough tree removals, and discussed updates to the Shade Tree Ordinance. The Arborist Report was unanimously approved, and no other substantive decisions were made.

Tue Sep 3, 2024

Zoning Hearing Board

Zoning board to hear two variance requests for 615 Harbaugh and 605 Murray streets

The Sewickley Zoning Hearing Board will hold hearings on two variance applications. The first seeks to allow a two-family dwelling at 615 Harbaugh Street with no off-street parking, and the second requests multiple setbacks, coverage, and parking variances for a new single-family home at 605 Murray Street.

zoningvarianceshousingparkingsetbacksSewickley
Tue Aug 27, 2024

Borough Workshop

Sewickley Council considers street closure for September 7 block party

The Borough Council will hold a workshop to discuss a traffic study and an intergovernmental agreement for Route 65. The body will also consider a motion to close streets for a block party and discuss the naming of the theater lawn park.

trafficpublic-safetyroadscommunity-eventsparks
✓ Decided: Council approves Nevin Street block party closure for Sept. 7

The council approved a street closure for a block party on September 7, 2024, from 4:30 PM to 9:00 PM, covering the corners of Nevin and Hill and Nevin and Centennial. The motion passed unanimously. Other items discussed included sidewalk maintenance concerns, a traffic study, an intergovernmental agreement for Route 65, and the demolition of Cole Funeral Home, but no formal action was taken on these.

Tue Aug 13, 2024

Borough Council

Council to fill Ward 1 vacancy, approve $70,684 for Lindsay Theater Plaza

The council will consider appointing a new member to fill the Ward 1 council seat, approve a $70,684.20 payment for the Lindsay Theater Plaza project, and vote on several street closure requests for community events. Monthly reports from departments and public comment periods are also scheduled.

council-vacancypublic-worksstreet-closurescommunity-eventstheater-plazabudgetparkssewickley
✓ Decided: Council appoints Linda Solecki to fill Ward 1 vacancy

Sewickley Borough Council appointed Linda Solecki to fill the Ward 1 council seat vacancy by a 4-3 vote, subject to Borough Code. The council also approved a $70,684.20 payment for the Lindsay Theater Plaza Project and authorized several street closures for community events. No ordinances or resolutions were enacted.

Wed Aug 7, 2024

Planning Commission

Planning Commission reviews subdivision and mixed-use applications

The Planning Commission will consider a land subdivision application and a conditional use application for a mixed-use building. The body will also discuss zoning ordinances and the comprehensive plan.

zoningland-usesubdivisionmixed-useplanning
Tue Aug 6, 2024

Zoning Hearing Board

Sewickley Zoning Board to hear variances for 605 Centennial Ave and 330 Frederick Ave

The Zoning Hearing Board will hold hearings on two variance applications. One seeks variances to build a covered patio 16 feet from the rear lot line and a parking pad 0 feet from a side lot line at 605 Centennial Avenue. The other seeks variances to construct a two-car garage in the front yard and 0 feet from the front lot line at 330 Frederick Avenue. No other business is on the agenda.

zoningvariancespublic-hearingssewickleyproperty-developmentparkingsetbacks
Mon Aug 5, 2024

Historic Review Commission

Commission to review historic district ordinance and CLG grant update

The Sewickley Historic Review Commission will hold a regular meeting with roll call, approval of June 3, 2024 minutes, and old business items including a CLG grant update, historic district ordinance review, Herbst House, and preservation of bridge finials. No new business is listed. The meeting is open to property owners seeking informal guidance on historically accurate construction.

historic-reviewcommissiongrantshistoric-districtordinancepreservationbridge-finialsherbst-house
Tue Jul 23, 2024

Borough Workshop

Sewickley Council to discuss property sales and road procedures

Borough Council will hold a workshop to review committee reports and manager updates. The body will discuss several new business items including property sales and park regulations.

property-saleroadsparkspedestrian-safetygovernment-administration
✓ Decided: Sewickley Council workshop covers projects, no votes taken

The Sewickley Borough Council held a workshop meeting on July 23, 2024, discussing various topics including Hoey's Run, a performance grant, Maple Park, project status updates, and several old and new business items. No formal decisions or votes were taken during the workshop; the only action was a unanimous vote to adjourn.

Tue Jul 9, 2024

Borough Council

Council considers sewer repairs, road paving, and a $60,570 grant payment

The Sewickley Borough Council will consider several infrastructure updates and financial motions. Items include authorizing sewer repair bid preparations and adding Hopkins Street to the 2024 paving program. The council will also address a block party request and a grant payment.

infrastructureroadsbudgetpublic-works
Tue Jul 2, 2024

Shade Tree Commission

Shade Tree Commission to review tree work applications and seasonal programs

The commission will consider several applications for tree work at various residential addresses. The Borough Arborist will also present reports on 2024 tree removal, planting, and maintenance programs.

treesmaintenancearboriculturepublic-works
Tue Jul 2, 2024

Zoning Hearing Board

Appeal regarding travel agency use and parking at 348 A Beaver Street

The Zoning Hearing Board will hear an appeal from Olsen-O’Leary Associates, Inc. regarding a denied occupancy permit for 348 A Beaver Street. The applicant seeks to operate a travel agency in the building's basement or ground floor. They are also requesting variances related to professional office location and off-street parking requirements.

zoningbusinessparkingland-use
Tue Jun 25, 2024

Borough Workshop

Sewickley Borough Council workshop discusses sanitary repairs and pedestrian safety

The Sewickley Borough Council will hold a workshop meeting to review several municipal topics. Discussions include engineer-suggested sanitary repairs, pedestrian safety improvements, and speed enforcement. The agenda also includes committee reports and an update on GIS activation.

sewickleysanitary-repairspedestrian-safetycouncil-vacancymunicipal-updates
Wed Jun 12, 2024

Zoning Hearing Board

Variance request for driveway and garage changes at 317 Ferry Street

The Sewickley Zoning Hearing Board will consider Case 24-04 regarding property at 317 Ferry Street. The applicant is seeking variances related to driveway setbacks, garage door orientation, and the number of permitted driveways.

zoningdrivewayvariancehousing
Tue Jun 11, 2024

Borough Council

Sewickley Council considers $17,000 payment for Cochran manhole replacement

The Borough Council will consider a motion for a $17,000 payment to Protocal, LLC for sanitary manhole replacement on Cochran. They will also discuss authorizing new custodial services for pension plans and review monthly department reports.

budgetinfrastructurepolicepensionspublic-works
Tue Jun 4, 2024

Shade Tree Commission

Shade Tree Commission reviews spring tree programs and six property maintenance requests

The Sewickley Shade Tree Commission will review the borough arborist’s spring tree removal, planting, and maintenance reports. Members will consider applications for tree work at six addresses, which determine how street and private trees are managed in those locations. The commission will also approve April meeting minutes and update its list of licensed tree experts.

tree-commissionmunicipal-servicesproperty-permitspublic-works
Mon Jun 3, 2024

Historic Review Commission

Historic Review Commission to discuss bridge finials, CLG grant, ordinance review

The Sewickley Historic Review Commission is meeting to discuss new and old business, including the preservation of bridge finials, an update on the CLG grant, a review of the historic district ordinance, and the Herbst House. The meeting will also include approval of the May 6, 2024 minutes. The commission welcomes property owners for informal, non-binding guidance on historic construction.

historic-preservationgrantsordinance-reviewbridgesherbst-house
Tue May 14, 2024

Borough Council

Council to award $625,825 road program and $93,424 theater plaza contracts

Sewickley Borough Council will vote on several resolutions and ordinances, including pension plan changes and grant authorizations for park and sewer projects. They will also consider awarding contracts for the 2024 Road Program and Lindsay Theater Plaza improvements, and decide on a certificate of appropriateness for St. Stephens Church.

contractsroadsparkspensionpublic-safetyzoning
Tue May 7, 2024

Zoning Hearing Board

Sewickley board to weigh fence height variance at 105 Beaver St.

The Sewickley Zoning Hearing Board will hold a hearing on May 7, 2024, to consider a variance request from Allan and Karen Goldstein for 105 Beaver Street. The applicants seek to exceed the 4-foot maximum fence height in the front yard, proposing a 6-foot fence with two gates (6 and 7 feet tall). No other cases are pending.

zoningvariancefencesewickley
Mon May 6, 2024

Historic Review Commission

Historic Review Commission to review roof replacement at 403 Frederick Ave

The Sewickley Historic Review Commission is meeting to consider a partial roof replacement at 403 Frederick Ave, located in historic district #3. The commission will also discuss the CLG Grant as old business and approve minutes from previous meetings.

historic-reviewroof-replacementclg-grantsewickley
Tue Apr 23, 2024

Borough Workshop

Sewickley Council workshop to discuss sewer system, grants, pension plan

The Sewickley Borough Council is holding a workshop meeting to discuss and receive updates on several items, including excessive rainfall and the sewer system, a grant opportunity, an ordinance to amend the defined contribution pension plan for general employees, and a shed at War Memorial Field. The meeting also includes committee reports, a manager's report, and an update on Summit Strategies. No formal action is scheduled except for any items from executive session.

sewergrantspensionparkscapital-improvements
Tue Apr 9, 2024

Borough Council

Council to vote on eminent domain for Crescent Avenue widening

The Sewickley Borough Council is meeting to consider several resolutions, including authorizing eminent domain for property acquisition to widen and stabilize Crescent Avenue, approving emergency slope repairs on Dickson Road, and adopting pension plan documents. The council will also hear an appeal regarding a property at 860 Nevin Avenue, approve event dates and street closures, and award contracts for curb ramps and park projects.

eminent-domainroadspublic-safetycontractseventspensionszoning
Tue Apr 2, 2024

Zoning Hearing Board

Sewickley Zoning Board to hear parking variance requests for 527 Straight Street

The Sewickley Zoning Hearing Board will hold a hearing on April 2, 2024, to consider two variance requests from Daniel and Merideth Spencer for their property at 527 Straight Street. The requests seek exceptions to the borough's zoning ordinance regarding off-street parking placement and driveway width. No other cases are on the agenda.

zoningvarianceparkingdrivewaypublic-hearing
Tue Apr 2, 2024

Shade Tree Commission

Shade Tree Commission to review tree work applications and spring planting plans

The Sewickley Shade Tree Commission is meeting to approve minutes, review the arborist's report on tree removals, plantings, and maintenance, and consider applications for tree work at several properties. The commission will also discuss Earth Day activities and correspondence about borough trees.

treesshade-tree-commissionplantingmaintenanceearth-daypermits
Mon Apr 1, 2024

Historic Review Commission

Sewickley Historic Review Commission to review porch rebuild at 349 Walnut Street

The Sewickley Historic Review Commission is meeting to review a front porch rebuild at 349 Walnut Street, located in historic district #3. The commission will also discuss the CLG Grant as old business and approve minutes from the February 5, 2024 meeting.

Tue Mar 26, 2024

Borough Workshop

Sewickley Council workshop covers grants, investments, and street projects

The Sewickley Borough Council is holding a workshop meeting to discuss various topics, including a capital improvement grant opportunity, investment and actuary matters, and several community projects. The agenda includes discussions on the War Memorial Park T-ball field, borough street trees, parking lot design, a resident parking request, a Crescent Ave. resolution, and a stop sign at Blackburn and Hill. The meeting is primarily for discussion, with action items to be considered after an executive session on possible litigation.

capital-improvementgrantsparksstreetsparkingpublic-safetyinvestments
Tue Mar 12, 2024

Borough Council

Sewickley Council to vote on rental inspections, dumpster rules, and street closures

The Sewickley Borough Council will hold its regular meeting, covering routine approvals, monthly reports, and several action items. Key business includes two ordinances: one regulating dumpsters and portable storage units in public rights-of-way, and another establishing a registration and inspection program for residential rental units. The council will also consider multiple street closure requests for community events, approve payments for construction projects, and act on a police officer resignation and appointment.

zoningpublic-safetystreetsbudgethousingordinancesappointments
Wed Mar 6, 2024

Planning Commission

Planning Commission to review zoning ordinances and parking study

The Sewickley Planning Commission is meeting to discuss zoning ordinances and a parking study, including remarks from the council president. The agenda is mostly procedural, with no specific decisions or proposals detailed.

zoningparkingplanning-commission
Tue Mar 5, 2024

Shade Tree Commission

Shade Tree Commission to review tree work applications and programs

The Sewickley Shade Tree Commission is meeting to approve minutes, discuss old and new business, and hear the Borough Arborist's report on tree removal, planting, and maintenance programs. They will also review applications for tree work at two residential properties. The meeting is a regular monthly session focused on tree-related matters.

treesshade-tree-commissionsewickleypublic-meetingtree-work
Tue Feb 27, 2024

Borough Workshop

Council to discuss ordinances on dumpsters, rentals, and paving

The Sewickley Borough Council is holding a workshop meeting to discuss several ordinances, including those on dumpsters and portable storage, residential rental unit inspections, and new proposals from the Planning Commission. They will also review the 2024 paving program, a graffiti/mural summer camp proposal, stream restoration signage, and street cleaning schedule changes. No formal votes are scheduled; this is a discussion session.

ordinancesrental-housingpavingpublic-worksrecreation
Tue Feb 13, 2024

Borough Council

Council to vote on extending water authority term, approving payments and event permits

The Sewickley Borough Council is meeting to consider a resolution extending the Sewickley Water Authority's term by 50 years and renaming it, along with several motions for construction payments and event permits. They will also review routine reports and approve certificates of appropriateness for two properties on Thorn Street.

water-authoritypaymentsconstructioneventscertificates-of-appropriatenessstreet-closures
Wed Feb 7, 2024

Planning Commission

Planning Commission to discuss zoning ordinances and parking study

The Sewickley Planning Commission is meeting to discuss proposed new ordinances for council, zoning ordinances, and a parking study. The agenda includes approval of the previous meeting's minutes and standard procedural items.

zoningparkingordinancesplanning-commission
Tue Feb 6, 2024

Shade Tree Commission

Shade Tree Commission to review tree work applications and 2024 programs

The Sewickley Shade Tree Commission is meeting to approve minutes, hear the Borough Arborist's report on 2024 tree removal, planting, maintenance, and inspection programs, and review applications for tree work at four properties. The commission will also acknowledge donations received in memory of Dr. Bruce Coleman.

treesshade-tree-commissionsewickleypublic-worksmaintenance
Tue Feb 6, 2024

Zoning Hearing Board

Sewickley Zoning Board to hear variance request for garage at 713 Orchard Terrace

The Sewickley Zoning Hearing Board will hold a public hearing on February 6, 2024, to consider a variance request from Swallow Point Ventures, LLC for the property at 713 Orchard Terrace. The applicant seeks variances to build a private garage in the front yard, with doors facing a principal street, and to relax setback requirements on a nonconforming lot. The board will also discuss rules for providing public notice of hearings.

zoningvariancegaragepublic-hearingsewickley
Mon Feb 5, 2024

Historic Review Commission

Historic Review Commission meets February 5, 2024

The commission will conduct reorganization to appoint a Chairperson and Secretary. The meeting includes discussion of pergola design changes at 302 Thorn St. and a new exterior door installation at 345 Thorn St.

historic-preservationzoningsewickley
Tue Jan 23, 2024

Borough Workshop

Sewickley Council to discuss dog park, rental inspections, paving

The Sewickley Borough Council is holding a workshop meeting to discuss several new ordinances and programs, including a dog park, dumpster and portable storage regulations, residential rental unit inspections, and the 2024 paving program. The meeting is primarily for discussion, with action items to be considered later.

ordinancesdog-parkrental-inspectionspavingpublic-works
Tue Jan 9, 2024

Borough Council

Sewickley Council reorganizes, appoints officials for 2024

The Sewickley Borough Council is holding its annual reorganization meeting to swear in newly elected council members and elect council leadership. The council will also vote on appointments for borough manager, treasurer, solicitor, engineer, official newspaper, depositories, and board/commission members.

councilappointmentsreorganizationsewickley
Tue Jan 9, 2024

Borough Council

Council to vote on conditional use for second-floor club at 428-430 Beaver St

The Sewickley Borough Council will hold a public hearing and vote on a conditional use application for a mixed-use and business/private club on the second floor of 428-430 Beaver Street, as recommended by the Planning Commission. The agenda also includes routine approvals of minutes, bills, and monthly reports, plus motions to approve the borough manager's employment agreement and appoint council representatives to the Quaker Valley Council of Governments.

zoningpublic-hearingbusinessemploymentcouncil-of-governmentsbudget
Mon Jan 8, 2024

Historic Review Commission

Sewickley Historic Review Commission meets January 8, 2024

The Commission will conduct reorganization to appoint a Chairperson and Secretary. The agenda includes a review of a new exterior door installation at 345 Thorn St. and discussions regarding a CLG Grant.

historic-reviewreorganizationzoninggrants
Wed Jan 3, 2024

Planning Commission

Planning Commission to vote on Beaver St. conditional use application

The Sewickley Planning Commission will hold a public meeting and vote on a conditional use application for 428-430 Beaver St., which proposes a business office, private club, and mixed use on the second floor. The commission will also discuss zoning ordinances and a parking study, and will reorganize by appointing officers for the year.

zoningplanning-commissionconditional-useparkingbeaver-street
Tue Jan 2, 2024

Shade Tree Commission

Shade Tree Commission to elect officers, review dental practice landscape plan

The Sewickley Shade Tree Commission will hold its January 2, 2024 meeting, starting with approval of December minutes and election of officers. They will review a landscape plan application for a future dental practice at 77 Chadwick St, and discuss the borough arborist's report, a tree work application for 304 Peebles Street, and donations in memory of Dr. Bruce Coleman.

shade-treelandscape-plantree-workofficers-electiondonations