The Boring PartsFederalLocal · USLocal · Canada
Orleans, MA

Orleans public meetings in 2025

447 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Thu Dec 18, 2025

Recreation Advisory Committee

Recreation Committee to review park renovation and annual report contributions

The Orleans Recreation Advisory Committee will meet to approve November minutes, hear a director's report on Eldredge Park renovation, and review staff updates. The committee will also vote on its contribution to the Town of Orleans Annual Report.

recreationparkscommitteetown-meetingeldredge-parkannual-report
Thu Dec 18, 2025

Board of Health

Show cause hearings on sewer connection orders for 5 North Cottage

The Orleans Board of Health will hold continued show‑cause hearings for properties ordered to connect to the municipal sewer system, including 5 North Cottage. The agenda also includes a sewer deferral request for 18 Old Colony Way, a hearing request for 63 Old Field Road, a variance request for 51 Beach Road, and a testing reduction request for 14 Prides Path. Additional administrative items such as residential kitchen permits and temporary food service establishments will be reviewed.

sewerhealthpermitshearingsvariance
✓ Decided: Board approves bedroom and pool fencing variances, plus permits and deferrals

The Orleans Board of Health continued the Phase 1 show‑cause hearings to Jan 15, 2026 and extended the hearing for 5 North Cottage to the same date. It approved a sewer deferral for 18 Old Colony Way, variances for 63 Old Field Road and 51 Beach Road, reduced testing frequency for the I/A system at 14 Prides Path, and granted residential kitchen and temporary food service permits. All actions were adopted by voice vote of 5‑0‑0.

Thu Dec 18, 2025

Community Preservation Committee

Committee reviews FY27 grant applications for housing, parks, and historic sites

The Orleans Community Preservation Committee will review grant applications for the Fiscal Year 2027 budget. The meeting includes presentations from the Affordable Housing Trust, Veterans Park Memorial, Civil War Monument, NW Schoolhouse, and Academy Playhouse. The committee will also discuss finances and approve minutes from the previous meeting.

budgethousingconservationparkshistoric-sitesgrant-applicationsorleans
✓ Decided: CPC funds $300K for Affordable Housing Trust, supports multiple projects

The Community Preservation Committee discussed FY27 grant applications and reached consensus on funding several projects, including $300,000 for the Affordable Housing Trust, $25,000 for the CHO project, and support for the Veteran's Park memorial, Putnam Farm, and Academy shutters. The NW Schoolhouse was partially funded, while the Civil War Monument and other items had favorable support but no final decisions were made. The committee also approved the December 11, 2025 minutes unanimously.

Thu Dec 18, 2025

Human Services Advisory Committee

Human Services Advisory Committee reviews service applications

The committee will review applications for human services programs, receive an update on applications received, and discuss a request to increase an organization’s request. No formal decisions are noted; the meeting focuses on ongoing review and future issues.

human-servicesapplicationsreviewpublic-meeting
✓ Decided: HSAC approved Dec. 4 minutes and adjourned; no grant approvals

The Human Services Advisory Committee unanimously approved the minutes from the December 4, 2025 meeting. No grant applications were approved, denied, or otherwise acted upon. The committee then unanimously adjourned the meeting.

Thu Dec 18, 2025

Marine & Fresh Water Quality Committee

Committee will vote on its reorganization at Dec 18 meeting

The Marine & Fresh Water Quality Committee will discuss the 2025 State of the Waters report and review the November 24, 2025 meeting minutes. It will receive updates on Pilgrim Lake water quality after alum treatment, the Wastewater Management Advisory Committee, and the Winter Farmer’s Market booth. The meeting will conclude with a vote on the committee’s reorganization and a period for public comment.

water-qualitycommitteereorganizationreportspublic-comment
Wed Dec 17, 2025

Select Board

Board to consider Verizon pole installation request at 19 Ruggles Road

The Select Board will hold a public pole hearing to discuss and vote on NBC LLC's request, on behalf of Verizon New England, to install an overhead wire system from an existing pole to a new building at 19 Ruggles Road. The board will also vote on conservation restrictions for the properties at 137 Skaket Beach Road and 40 Payson Lane. Additional items include approval of annual license renewals for 2026 and routine approvals of recent board minutes and interview appointments.

pole-installationtelecommunicationsconservationlicensesboard-minutesinterviews
✓ Decided: Board approves conservation restrictions for two properties and appoints new members

The Select Board approved conservation restrictions for the parcels at 137 Skaket Beach Road and 40 Payson Lane. It also appointed Michael Abbott to the Cultural Council, Derek Bolduc to the Shellfish & Waterways Committee, and elevated Andrew Miao to a regular member of the Old Kings Highway Committee. The public hearing on the Ruggles Road utility pole request was continued to January 7, 2026. Routine items such as the consent agenda license renewals and past meeting minutes were also approved.

Wed Dec 17, 2025

Select Board

Select Board will review and discuss Section F of its policies

The Orleans Select Board will hold a workshop meeting on December 17, 2025. Board members will review and discuss the town’s Select Board policies, focusing on Section F. No formal actions or votes are listed on the agenda.

governancepolicyboardmeeting
Wed Dec 17, 2025

Zoning Board of Appeals

ZBA to hear special permit request for new home and garage at 5 Spinnaker Trail

The Zoning Board of Appeals will review a request for a special permit regarding building coverage limits. The board will also review meeting minutes from November 5 and November 19, 2025.

zoningspecial-permitresidential-construction
Wed Dec 17, 2025

Board of Water & Sewer Commissioners

Board to vote on sending Watershed Management Plan to public hearing

The Board of Water & Sewer Commissioners will discuss and vote on scheduling a public hearing for the Watershed Management Plan. The board will also review abatement requests and license renewals for drain layers.

water-managementsewerwatershedlicensingpublic-hearing
Tue Dec 16, 2025

Affordable Housing Trust Fund Board

Board will consider a confidential purchase or lease of property on Monument Road

The Affordable Housing Trust Fund Board will meet on Dec. 16, 2025 in the Nauset Room at Orleans Town Hall and via Zoom. An executive session is scheduled to discuss the purchase, exchange, or lease of real property on Monument Road. The board will also review proposals and a purchase‑sale agreement for a 4‑unit housing project at 22 Old Tote Road, and provide updates on several ongoing development projects.

affordable-housingproperty-purchasedevelopmentcommunity-preservationcontract
✓ Decided: Board approved taking title of 22 Old Tote Road property

The Affordable Housing Trust Fund Board entered executive session to discuss a real‑property transaction and then reconvened in open session. The board voted unanimously to take title of 22 Old Tote Road. It also unanimously approved renewing the management services contract for the Old Colony Way condominium and approved the minutes from the previous meetings before adjourning.

Tue Dec 16, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to vote on artist presentations

The Marion Craine Gallery Exhibition Committee will meet to review artist presentations and a membership application. The board will also review the gallery schedule and receive financial and director reports.

libraryartsgalleryorleans
Tue Dec 16, 2025

Conservation Commission

Conservation Commission reviews sewer project and land use permits

The Orleans Conservation Commission will review permits for a wastewater sewer project in the Lakes and Ponds area and several land development proposals. The agenda also includes administrative reviews and a vote on funding for a Putnam Farm agricultural barn.

sewerconservationzoningwetlandsfundingpublic-worksagriculture
✓ Decided: Commission unanimously approved major sewer project and multiple local developments

The Conservation Commission approved the Phase 3 Lakes and Ponds sewer project with special time‑of‑year and shrub conditions. It also approved three residential projects (75 Areys Lane, 8 Kescayogansett Rd, and 184 Quanset Rd) and a Certificate of Compliance for 60 Captain Linnell Rd with a $4,000 surety. Additionally, the commission authorized up to $45,000 for the Putnam Farm Agricultural Barn and struck an invalid order for the 75 Areys Lane project.

Mon Dec 15, 2025

Orleans School Committee

School Committee reviews MCAS results, special ed audits, and FY27 budget

The Orleans School Committee will hear reports on the latest MCAS results, special‑education audit findings and preschool program status. Administrators will also present the FY27 budget review, the FY26 monthly financial report, and a summary of the recent MASC conference. The meeting includes routine items such as approval of the November 13 minutes and scheduling of future meetings.

educationtestingspecial-educationpreschoolbudgetfinanceconference
Mon Dec 15, 2025

Cultural Council

Orleans Cultural Council to vote on 2026 grant support

The Cultural Council will review grant submissions and vote on which grants to support for 2026. The body will also discuss potential partnerships and programs for the upcoming year.

grantsartsculturecommunity-programming
✓ Decided: OCC meetings will move to the first Monday of each month starting 2026

The council approved the November 2025 meeting minutes. It adopted a new schedule for future meetings to be held the first Monday of each month at 5:30 pm beginning in 2026. A motion to adjourn was made, seconded, and passed, ending the meeting.

Thu Dec 11, 2025

Community Preservation Committee

Community Preservation Committee to hear FY27 grant presentations

The Community Preservation Committee will receive presentations from FY27 grant applicants. The meeting includes reviews of requests for historic preservation, open space, recreation, and housing projects.

grantshistoric-preservationhousingopen-spacerecreation
✓ Decided: Committee unanimously approved prior meeting minutes

The Community Preservation Committee approved the minutes from the December 4, 2025 meeting with an 8‑0‑0 vote. The committee then adjourned the December 11, 2025 meeting, also by an 8‑0‑0 vote. No other actions were taken.

Thu Dec 11, 2025

Architectural Review Committee

Architectural Review Committee to review signage and roofing applications

The Architectural Review Committee will consider two applications for property modifications. The committee also plans to discuss its future functioning with Select Board member Mefford Runyon.

architectural-reviewsignagezoningtown-governance
✓ Decided: ARC waived site plan requirement and approved Homegrown Boutique signs

The Architectural Review Committee unanimously waived the site‑plan requirement for Homegrown Boutique’s new signs and approved the three sign designs with downward‑facing lighting. It also approved Cape Associates’ roof replacement application, conditional on a later site‑plan submission. The meeting was then adjourned.

Thu Dec 11, 2025

Energy & Climate Action Committee

Committee to vote on Climate Action Roadmap recommendation

The Energy and Climate Action Committee will vote on a recommendation to the Select Board regarding the Climate Action Roadmap. Members will also review the Municipal Decarbonization Plan and prepare for a citizen forum on January 15.

climate-actiondecarbonizationenergy-codeenvironment
✓ Decided: Committee approved recommending the Select Board start the Climate Action Roadmap now

The committee unanimously passed a motion to submit a recommendation to the Select Board directing town staff to begin the Climate Action Roadmap procurement without waiting for grant funding. It also unanimously approved the minutes from the November 6, December 13, and November 20, 2025 meetings. The discussion on speakers for the Jan 15, 2026 Citizens Forum was tabled and the forum will be rescheduled. The meeting was adjourned by unanimous vote.

Wed Dec 10, 2025

Transportation and Bikeways Advisory Committee

Committee reviews crosswalk policy and road safety data

The Transportation and Bikeways Advisory Committee will review the town's crosswalk policy and discuss speed data for Barley Neck Road. Members will also address pedestrian crossing light issues at Old Colony and Main Street.

transportationbikewayspedestrian-safetytraffic-dataroads
✓ Decided: Committee unanimously approves crosswalk policy

The Transportation and Bikeways Advisory Committee approved the revised crosswalk policy by unanimous vote. The committee also approved the minutes from the November 12 meeting, again unanimously with one abstention. The pedestrian crossing light at Old Colony and Main Street was confirmed to be operating correctly and no further action was required. The meeting set agenda items for the January 5 session, including updates on the crosswalk policy, field survey, and a Beach Road community meeting.

Tue Dec 9, 2025

Economic Development Committee

Economic Development Committee reviews updates and prepares for special town meeting

The committee will review the November 7, 2025 meeting minutes, receive a staff update from Amanda Converse, discuss the upcoming Special Town Meeting, and examine the Economic Development Committee Data Dashboard. It will also address any new business and set the date for the next meeting.

economic-developmentmeetingupdatesspecial-town-meetingdata-dashboard
Tue Dec 9, 2025

Board of Assessors

Board reviews multiple tax abatements and commitments

The Orleans Board of Assessors will discuss reports on MV abatements, boat excise abatements, and real estate exemptions. It will also consider the In Lieu of Taxes report and various commitment items. Afterward, the board will enter an executive session to discuss real estate exemptions and deferrals confidentially.

tax-abatementsreal-estateexciseboard-of-assessorsmeeting
✓ Decided: Board approved $72,458.63 in real estate tax exemptions for FY2026

The Board of Assessors approved 63 real estate tax exemptions totaling S72,458.63 and a $3,029.55 tax deferral. It also accepted Julie Lee's resignation and approved a $54,431.19 payment in lieu of taxes for four Orleans Housing Authority properties. Several vehicle and boat excise abatements were unanimously approved, and the meeting was adjourned by a 2‑0 vote.

Tue Dec 9, 2025

Cultural District Committee

Cultural District Committee to discuss events and meeting schedule

The Cultural District Committee will review reports on current projects and events. The body is also discussing a change to its meeting time.

artsculturecommunity-events
✓ Decided: Committee changed monthly meeting time to 5:30‑7 pm on the fourth Tuesday

The Cultural District Committee approved the October 2025 minutes and the Treasurer's report, both unanimously. The board voted to accept the Solstice event flyer and public‑relations plan. Members also approved moving the regular meeting to 5:30‑7 pm on the fourth Tuesday of each month, with a unanimous vote.

Tue Dec 9, 2025

Cultural Council

Orleans Cultural Council to review grant cycle and future arts programming

The Cultural Council will review the status of current grants and set deadlines for the next cycle. Members will discuss the JOY Holiday Structure and plan for 2026 programs including art shows and murals.

grantsartsculturecommunity-programming
Tue Dec 9, 2025

Conservation Commission

Conservation Commission reviews sewer expansion and residential projects

The Conservation Commission is holding an on-site meeting to review Notices of Intent for three projects. These include a municipal sewer expansion and two private residential developments. All projects involve work within protected resource areas or the Pleasant Bay ACEC.

conservationsewerzoningenvironmentresidential-development
Thu Dec 4, 2025

Board of Health

Board of Health to hold sewer connection show cause hearings

The Board of Health will conduct show cause hearings for properties ordered to connect to the municipal sewer. The board will also review variance and testing reduction requests for specific residential addresses.

sewerpublic-healthvariancespermits
✓ Decided: Board approved a 140‑foot fence variance for 18 Sparrowhawk Road (5‑0‑0)

The Board continued show‑cause hearings for 8 Old Tote Road and 34 Route 6A, moving them to Jan 15 2026 (5‑0‑0 each). It approved a 140‑foot fence variance for 18 Sparrowhawk Road to allow a larger pool enclosure (5‑0‑0). Several license renewals—including Body Art, Hotels, and Swimming Pools—were approved (5‑0‑0 votes). The Board also continued a 17A testing request for 14 Prides Path I/A to Dec 18 2026 (5‑0‑0) and adjourned the meeting.

Thu Dec 4, 2025

Community Preservation Committee

Committee will discuss and possibly vote on out‑of‑town community housing initiatives

The Orleans Community Preservation Committee will review FY25/FY26 finances, including active and closed projects. Members will discuss and may vote on community housing initiatives that are located outside Orleans. The committee will consider FY27 grant applications and allocations totaling $1,440,318.84 for a range of historic, recreational, and housing projects. Updates on ongoing projects and a legal review will also be presented.

housinggrantsfinancecommunity-preservationprojects
✓ Decided: CPC sets aside $1 M for Eldredge renovation and closes several accounts

The committee voted 9‑0‑0 to close six account codes and return any balances to the CPC reserve fund. It also voted 9‑0‑0 to set aside $1 million to reduce bonding for the Eldredge Park renovation. A separate 9‑0‑0 vote declined funding for three Pennrose affordable‑housing grant applications totaling $300,000, and the committee confirmed that non‑strikethrough projects in Item 7 remain active. Minutes from the November 6 meeting were approved (8‑0‑1) and the meeting adjourned at 6 p.m.

Thu Dec 4, 2025

Human Services Advisory Committee

Human Services Advisory Committee to review funding applications

The committee will discuss the status of received applications and whether to increase specific organization requests. Members will also continue reviewing applications and a draft of the annual report.

human-servicesgrantsannual-reportcommunity-funding
✓ Decided: Committee unanimously approved the annual report and adjourned the meeting

The Human Services Advisory Committee approved the November 20, 2025 meeting minutes by unanimous vote. The committee also approved the HSAC report for inclusion in the Annual Town Report, again unanimously. The meeting was then adjourned by unanimous vote. No other applications were acted upon.

Wed Dec 3, 2025

Housing Authority

Orleans Housing Authority to approve certifications and oil tank completion documents

The Orleans Housing Authority will meet to approve fiscal year end certifications, a report on tenant accounts receivable, and documents regarding oil tank replacements. The board will also vote on authorizing the chair to sign financial assistance contracts.

housingbudgetoil-tankcontractscertificationsmeetings
Wed Dec 3, 2025

Historical Commission

Public hearing on Notice of Intent for 15 Main Street demolition delay

The Orleans Historical Commission will hold a public hearing on a Notice of Intent concerning 15 Main Street. The commission will receive updates on the Form B project, the archaeology project, and the public education initiative. Members will review the draft Annual Town Report and consider the Demolition Delay Bylaw. The meeting will conclude with scheduling the next session.

historical-preservationdemolitionpublic-hearingprojectstown-report
✓ Decided: Commission approved demolition of 15 Main Street building

The Orleans Historical Commission approved the November 12, 2025 meeting minutes. It opened a public hearing on the Notice of Intent for 15 Main Street and voted to allow the building's demolition. The hearing was then closed and the commission adjourned.

Wed Dec 3, 2025

Select Board

Select Board to hold hearings on property tax classification and shellfish regulations

The Select Board will hold public hearings regarding FY26 property tax classification options and amendments to shellfish grant regulations. The board will also consider a grant expansion for Derek Bolduc in Little Pleasant Bay and a license transfer for Nauset Beach Camp #10.

taxesshellfishlicensingeconomic-developmentit-security
✓ Decided: Select Board adopts new environmental policy and archives licensed premises policy

The board agreed to replace the existing recycling policy with a broader environmental stewardship policy. It approved revisions to the Conservation Restrictions and Designer Selection Procedures policies and decided to archive the Licensed Premises Accessible to the Public policy. The board also noted several other policies as outdated and directed further review or revision.

Wed Dec 3, 2025

Select Board

Orleans Select Board to review board policies

The Select Board will hold a workshop meeting to review and discuss Select Board Policies. The discussion will focus on Section D and potentially Section E.

town-policygovernanceselect-board
Wed Dec 3, 2025

Council on Aging

Board discusses FY26 goals, budget review, and community partnership updates

The Orleans Council on Aging board will hear a chair’s report on improving relationships with town bodies, a select board liaison update, and a Friends of Orleans COA report. It will review the October 2025 monthly budget summary. The board will also discuss establishing a workgroup to implement FY26 goals and priorities.

council-on-agingbudgetsenior-servicescommunityplanning
✓ Decided: Board unanimously adjourned the meeting

The Orleans Council on Aging met on December 3, 2025 with a quorum. No public comment or financial reports were presented. Carol Hackett formally assumed the Friends of the Orleans Council on Aging liaison role. The motion to adjourn was passed 6‑0‑0.

Tue Dec 2, 2025

Snow Library Board of Trustees

Board to vote on FY2027 Snow Library Action Plan and EV charging stations

The Snow Library Board of Trustees will consider several agenda items, including approval of the October 7, 2025 meeting minutes and reports from the chair, financial officer, and library director. Trustees will vote on the draft of the 2025-2050 Orleans Comprehensive Plan, the FY2027 Snow Library Action Plan, and the installation of electric vehicle charging stations in the library parking lot. Additional votes will address early closures of the library on December 24 and December 31, 2025.

libraryplanningfacilitiesbudgetcommunity
Tue Dec 2, 2025

Conservation Commission

Commission to vote on supporting Orleans Conservation Trust walking‑trails guide redesign

The Conservation Commission will review certificates of compliance for several property owners who performed reconstruction, landscaping, and invasive‑plant management within coastal buffer zones. It will also discuss and vote on a request from the Orleans Conservation Trust to support the CPC application to redesign and update the Orleans Walking Trails Guide, possibly adding the Commission as a co‑applicant. The meeting includes public comment, chairman’s business, and approval of prior meeting minutes.

conservationcoastalcertificateswalking-trailsenvironment
✓ Decided: Commission approved four Certificates of Compliance and co‑applicant support

The Conservation Commission unanimously approved Certificates of Compliance for properties at 63 Kenneth Lane, 112 Areys Lane, 30 & 40 Payson Lane, and 60 Captain Linnell Road, each with specific ongoing conditions. It also approved supporting the Orleans Conservation Trust’s walking‑trails guide application as a co‑applicant. The board adopted the minutes from the October 7, 2025 meeting and adjourned the hearing.

Tue Nov 25, 2025

Veterans Committee

Veterans Committee to discuss Korean War design and monument presentation

The Veterans Committee will review follow-up actions from the Veterans Day service and receive construction updates on electric and sound systems. The body will also discuss a design for the Korean War and hear a presentation from Crosby Monuments.

veterans-affairsmonumentspublic-works
Mon Nov 24, 2025

Cultural Council

Cultural Council to review 2026 grant requests and holiday structure funding

The Orleans Cultural Council will review grant requests for 2026 and discuss various community programs. The body will vote on whether to fund a holiday structure for the Village Green and determine the funding amount.

grantsarts-and-culturecommunity-eventspublic-funding
✓ Decided: Council approved $5,000 to fund Village Green holiday lobster buoy structure

The council approved a $5,000 grant to fund the Village Green holiday lobster buoy structure, passing the motion unanimously. The October 2025 meeting minutes were approved. Discussion of existing cultural projects such as murals and park movies was postponed to the February meeting.

Mon Nov 24, 2025

Marine & Fresh Water Quality Committee

Committee will discuss next steps for Orleans 2050 Comprehensive Plan

The Marine and Fresh Water Quality Committee will review the October 27, 2025 meeting minutes and discuss next steps for the Orleans 2050 Comprehensive Plan. It will receive updates from the Wastewater Management Advisory Committee, the Community that CARES Collaboration, and the Winter Farmer’s Market Committee. The committee will also hear reports and discuss water quality and management programs for Pilgrim Lake, Cedar Pond, and Baker Pond, and will consider a public‑hearing support statement for the Orleans Pesticide Reduction HRP. The meeting concludes with announcements, public comment, and adjournment.

comprehensive-planwater-qualitywastewaterpesticide-reductionpond-managementpublic-hearing
✓ Decided: Committee unanimously voted to resubmit Baker Pond alum treatment request for spring 2026

The committee approved the October 27, 2025 minutes by unanimous roll‑call vote. Two agenda items—Winter Farmer’s Market Committee Booth and the Pilgrim Lake Herring Run—were postponed to future meetings. Members agreed to post a video about alum treatment on the town’s water quality website. A motion to resubmit the Baker Pond alum treatment request at the spring 2026 Town Meeting passed unanimously.

Thu Nov 20, 2025

Recreation Advisory Committee

Recreation Advisory Committee to discuss Eldredge Park renovation

The committee will meet to determine next steps for the Eldredge Park Renovation Project. Members will also review the Recreation Director's report and discuss future recreation programming.

recreationparkseldredge-parkprogramming
Thu Nov 20, 2025

Board of Health

Board reviews show‑cause hearings for three properties ordered to connect to sewer

The Board of Health will hold continued show‑cause hearings for three properties ordered to connect to the municipal sewer at 5 North Cottage Street, 8 Old Tote Road, and 34 Route 6A. It will also consider deferral requests for 157 Route 6A (David & Carolyn Delgizzi) and for 86 A, 86 B, and 88 Route 6A (Margaret Dodge). Additional items include variance requests for 47 Nauset Heights Road, 21 Pleasant View Drive, and 5 Spinnaker Trail, approval of temporary food permits for Cape Cod Charcuterie, and adoption of the 2026 agenda.

sewerdeferralvariancefood-permitsagenda
✓ Decided: Board of Health approves variances and extends multiple sewer hearings

The Orleans Board of Health approved a variance for 47 Nauset Heights Road and a pool‑area variance for 21 Pleasant View Drive, each by a 4‑0‑0 voice vote. It also voted to continue show‑cause hearings for several Phase 1 sewer‑connection properties, setting new dates in December, March and May. All motions passed unanimously.

Thu Nov 20, 2025

Energy & Climate Action Committee

Energy & Climate Action Committee to hold heat pump training

The committee will meet to coordinate the Energy Navigator Program. The session includes a training presentation on heat pumps by Steve Burke of Rise Engineering.

energyclimateheat-pumpstraining
✓ Decided: Energy & Climate Action Committee adjourned the meeting unanimously

The committee held a special meeting on November 20, 2025 to review the Energy Navigators program and hear a heat‑pump specialist. Attendees introduced themselves and discussed outreach successes at the farmers market and senior center. No policy actions or approvals were made; the only formal action was a motion to adjourn, which passed unanimously.

Thu Nov 20, 2025

Human Services Advisory Committee

Committee will begin reviewing human services applications

The Orleans Human Services Advisory Committee will receive an update on applications received, approve the minutes from the previous meeting, and start its review of new applications. Public comments and questions are invited throughout the meeting.

human-servicesapplicationspublic-commentadvisory-committee
✓ Decided: Committee approved prior meeting minutes and assigned members to upcoming tasks

The Human Services Advisory Committee unanimously approved the November 6, 2025 meeting minutes. No funding requests were voted on. Members were assigned to review specific organizations at the next meeting. The meeting was adjourned unanimously.

Wed Nov 19, 2025

Open Space Committee

Open Space Committee to discuss property purchase and review minutes

The Orleans Open Space Committee will hold a meeting to discuss a possible property purchase in executive session and approve minutes from October. The next meeting is scheduled for January 21, 2026.

open-spacepropertycpcminutesmeeting
✓ Decided: OSC approved drafting a letter of support for OCT’s Cedar Pond land acquisition

The committee voted unanimously to enter and later adjourn an executive session. Members approved a motion for the Open Space Committee to draft a letter of support for the Orleans Conservation Trust’s Cedar Pond application. The minutes from the October 15, 2025 meeting were also approved unanimously, and the meeting was adjourned.

Wed Nov 19, 2025

Select Board

Select Board to vote on residential tax exemptions and property acquisition

The Select Board will vote on a residential tax exemption program and the designation of 56 Eldredge Park Way as Unique Real Property. The board will also consider seasonal closure requests for two restaurants and a one-day alcohol license. Other business includes a Special Town Meeting recap and Town Manager reports.

taxeslicensingreal-estaterestaurantstown-management
Wed Nov 19, 2025

Zoning Board of Appeals

ZBA to hear request for walk-in freezer units at 5 Old Colony Way

The Zoning Board of Appeals will meet to review previous meeting minutes and consider a special permit or variance application. The board will discuss the placement of accessory buildings at a specific property in the VC district.

zoningspecial-permitvarianceaccessory-building
✓ Decided: Zoning Board unanimously approves variance for 5 Old Colony Way

The board approved the October 15, 2025 meeting minutes by a 5‑0 vote and noted that no minutes were submitted for November 5, 2025. Public comment on the variance request for 5 Old Colony Way was opened and then closed, each by a 5‑0 vote. The board then approved the requested variance for the property at 5 Old Colony Way with a unanimous 5‑0 vote.

Wed Nov 19, 2025

Board of Water & Sewer Commissioners

Board of Water & Sewer Commissioners to discuss Watershed Management Plan

The Board will meet to discuss and potentially vote on a Watershed Management Plan. The agenda also includes discussions regarding pending litigation in Case # 2472CV00509 and updates on wastewater and water department operations.

water-managementsewerlitigationwatershedinfrastructure
✓ Decided: Board approved settlement reducing betterment to $15,000

The Board entered executive session and voted 7-0-0 to accept a settlement judgment that lowers the betterment payment from $38,080.62 to $15,000. It also approved a standby request for 51 Gibson Road and abated $57.75. The Board committed $55,641.10 in sewer receivables and $1,532,753.44 in water and sewer rate receivables for October 2025. Finally, it denied the sewer abatement request for 117 Route 6A, all votes 7-0-0.

Tue Nov 18, 2025

Snow Library Board of Trustees

Second presentation by artist Guy Laszlow Trudeau will be voted on

The exhibition committee will consider a second presentation by artist Guy Laszlow Trudeau and vote on it. The committee will also review minutes from the October 21, 2025 meeting, receive a financial report and a library director’s report from Tavi Prugno, and review the gallery schedule presented by Tom Genereux. Additional agenda items include public comment, old and new business, and adjournment.

libraryartsexhibitionfinancemeeting
✓ Decided: Board approved artist Guy Trudeau’s gallery work

The Snow Library Board approved artist Guy Trudeau’s work for the gallery. The board also approved the minutes from the September 16 meeting. Both motions were passed with all members in favor. The meeting was adjourned at 5:25 pm.

Tue Nov 18, 2025

Fourth of July Committee

Committee will approve minutes from the September 22 meeting

The Orleans Fourth of July Parade Committee will meet to approve the minutes of its September 22, 2025 meeting, consider any open positions, and address any new business items. The agenda also includes scheduling the next meeting and adjournment. No specific proposals or contracts are listed.

paradecommitteeproceduralminutes
✓ Decided: Committee sets next meeting for Jan 20 after skipping December session

The committee postponed voting on the September 22 minutes to a later meeting because a quorum was not present. It decided to skip a December meeting and schedule the next meeting for January 20. The motion to adjourn was passed unanimously.

Tue Nov 18, 2025

Conservation Commission

Commission reviews two development amendment proposals on Pleasant View and Towhee Lane

The Orleans Conservation Commission will consider two continuation items. The first is a proposed amendment to the Order of Conditions for DEP #54-2638 submitted by Eastward MBT, LLC for a dry‑laid block patio and planting adjustments within a 100‑foot buffer of a bordering vegetated wetland at 21 Pleasant View Drive. The second is a proposal from Crawford Land Management for 65 Towhee Lane to reconstruct a single‑family dwelling, renovate an existing boathouse, and conduct site‑improvement and land‑management work on coastal beach, bank, salt marsh, and areas subject to coastal storm flowage within the Pleasant Bay ACEC. The commission will also hear public comment and review minutes from the Kents Point public hearing held on August 27, 2025.

zoningland-usewetlandscoastalpublic-hearing
✓ Decided: Conservation Commission approves two development projects, adding conditions

The commission unanimously approved the amended Order of Conditions for 21 Pleasant View Drive. It also unanimously approved the project at 65 Towhee Lane with standard and special conditions. No public comments were received during the meeting.

Mon Nov 17, 2025

Select Board

Select Board meeting will address routine procedural items

The Orleans Select Board will hold its regular meeting on November 17, 2025. The agenda lists only standard procedural items: Call to Order, Any other Town Meeting Action, and Adjourn. No specific decisions, proposals, or discussions are detailed in the agenda.

governmentproceduresmeeting
Thu Nov 13, 2025

Orleans School Committee

Orleans School Committee to review FY26 budget updates and enrollment

The Orleans School Committee will meet to receive updates on FY26 grants and budgets from Assistant Superintendent Vicky Saldana. The body will also review the FY26 monthly financial report and 2025-2026 enrollment figures.

educationbudgetenrollmentschool-committee
Thu Nov 13, 2025

Finance Committee

Finance Committee will approve prior meeting minutes and set speaking assignments

The Orleans Finance Committee will vote to approve the minutes from the October 30, 2025 meeting. The committee will assign speaking roles for the pro and con sides of four articles that received split votes. Additional agenda items include announcements, liaison reports, and scheduling of future meetings.

financeminutesschedulepublic-comment
✓ Decided: Finance Committee appointed a new ex‑officio member to the Wastewater Advisory Committee

The committee approved the minutes from its October meetings with vote totals of 7‑0‑0, 5‑0‑2, and 7‑0‑0. Members were assigned as ex‑officio liaisons to various town boards, including Chris Kanaga to the Wastewater Management Advisory Committee. The meeting was formally adjourned by an 8‑0‑0 vote.

Thu Nov 13, 2025

Energy & Climate Action Committee

Energy committee to discuss roles on energy code and review decarbonization plan

The Orleans Energy and Climate Action Committee will meet to discuss its roles regarding a specialized energy code, review the Municipal Decarbonization Plan, and approve minutes from a previous meeting.

energyclimatetown-meetingzoningpublic-hearing
✓ Decided: Committee approved October 9 minutes and adjourned the meeting

The Energy & Climate Action Committee unanimously approved the minutes from the October 9, 2025 meeting. The committee also unanimously moved to adjourn the November 13, 2025 meeting. No other actions or votes were recorded; updates on solar projects, EV chargers, the decarbonization plan, and an Eversource presentation were informational.

Wed Nov 12, 2025

Historical District Study Committee

Historical District Study Committee to discuss 15 Main Street and CPC grant

The committee will review a Notice of Intent for 15 Main Street and a request to amend a Community Preservation Committee (CPC) grant for the Academy of Performing Arts. Members will also receive updates on the Form B and archaeology projects.

historic-preservationcpc-grantspublic-hearingsarchaeology
Wed Nov 12, 2025

Select Board

Open house special town meeting for residents to discuss anticipated topics

The Select Board announced a special town meeting open house on November 12, 2025 at 4:00 p.m. in the Nauset Room of Town Hall. The agenda lists a call to order, a warrant article titled “Open House,” and adjournment, and notes that discussion items are anticipated but not guaranteed. The Select Board may attend, but the meeting is not a regular Select Board meeting.

open-housespecial-town-meetingpublic-engagement
Wed Nov 12, 2025

Board of Assessors

Board reviews abatements and FY26 property values

The Board of Assessors will discuss the MV abatements report, the boat abatements report, and betterment payoff warrants. They will also consider FY26 property values and new growth. Minutes from the previous meeting will be approved. An executive session will be held to discuss real estate abatements confidentially.

property-taxabatementsfinanceassessmentsexecutive-session
✓ Decided: Board authorized members to stamp signatures on future sewer betterment payoff warrants

The Board unanimously approved boat and motor vehicle excise abatements totaling $2,444.17 and wrote off uncollectible taxes for 2019 MV excise, 2020 boat excise, and 2020 personal property tax. It signed four sewer betterment payoff warrants and granted all three members authority to stamp their signatures on future sewer betterment payoff requests. Minutes from the October 14 meeting were approved, and the Board entered executive session unanimously to consider abatement and exemption applications.

Wed Nov 12, 2025

Transportation and Bikeways Advisory Committee

Committee reviews Beach Road feasibility study and plans December agenda

The Transportation and Bikeways Advisory Committee will hear a presentation on the Beach Road feasibility study by VHB. A workshop with the committee and VHB will follow, after which the public may comment. The committee will also consider approving the minutes from the October 8 meeting and will plan the agenda for December.

transportationbikewaysplanningpublic-commentminutes
✓ Decided: Committee unanimously approves October 8 meeting minutes

The committee approved the minutes from the October 8 meeting by unanimous vote. The meeting was then adjourned unanimously. No substantive policy decisions were made, but a public forum for the Beach Road feasibility study was scheduled for the January‑March timeframe.

Fri Nov 7, 2025

Economic Development Committee

Economic Development Committee to discuss November 17 Special Town Meeting Warrant

The Economic Development Committee will meet to review staff updates and the Special Town Meeting Warrant scheduled for November 17. The session includes a period for public comment and the approval of previous meeting minutes.

economic-developmenttown-meetinglocal-government
✓ Decided: EDC unanimously backs Downtown Housing Overlay District (Article 2)

The committee approved the minutes from the October 14, 2025 meeting by a 4‑0‑0 vote. After discussion, members voted 5‑0 to formally support Article 2, the Downtown Housing Overlay District, at the upcoming Special Town Meeting. The meeting was then adjourned by unanimous consent.

Thu Nov 6, 2025

Community Preservation Committee

Committee will discuss grant applications and outlook for the upcoming grant season.

The Community Preservation Committee will provide updates on projects underway, discuss received and anticipated grant applications and the outlook for the grant season, and approve the minutes from the October 2, 2025 meeting. Public comment will be accepted before the meeting adjourns.

grantscommunity-preservationminutespublic-commentprojects
✓ Decided: Approved $8,860 Academy shutter grant shift and billed OHC website invoice

The committee voted to bill the Orleans Historic Commission website invoice to the FY26 grant for public education. It also approved repurposing $8,860 of the Academy preservation grant for shutters, pending OHC approval and compliance with standards. The minutes from the October 2, 2025 meeting were approved, and the meeting was adjourned.

Thu Nov 6, 2025

Energy & Climate Action Committee

Committee will hear presentation and public comment on the Specialized Energy Code

The Energy & Climate Action Committee will hold a presentation on the Specialized Energy Code by the Department of Energy Resources. After the presentation, the public will have an opportunity to comment and ask questions about the code. No formal decisions are scheduled for this meeting.

energyclimate-actionspecialized-energy-codepublic-commentorleans
✓ Decided: Committee adjourned the meeting unanimously

The Energy & Climate Action Committee held a special meeting to gather public input on the Specialized Energy Code. The committee heard a presentation from Massachusetts Department of Energy Resources staff and comments from several residents. The meeting was adjourned at 8:15 p.m. by a unanimous motion.

Thu Nov 6, 2025

Human Services Advisory Committee

Committee will assign received applications and discuss outreach plans

The Human Services Advisory Committee will review and assign applications it has received. It will provide an update on a letter sent to nonprofits. The committee will discuss ideas for public relations, outreach, and inclusion of its work in the Orleans Comprehensive Plan. Additional procedural items and future business will also be noted.

human-servicesoutreachnonprofitscomprehensive-plantown-meeting
✓ Decided: HSAC approves minutes and assigns outreach actions for FY2027 funding

The committee unanimously approved the October 9, 2025 meeting minutes. Members were assigned to specific nonprofit applicants and agreed to call each organization to encourage FY2027 funding applications. The committee decided a review checklist was unnecessary and will invite Pleasant Bay Community Boating to meet on November 20. Susan will ask the Planning Board chair to include HSAC work in the Orleans Comprehensive Plan, and Meff will explore removing HSAC from the town budget cycle.

Wed Nov 5, 2025

Council on Aging

Board votes to approve minutes from the October 15, 2025 meeting

The Orleans Council on Aging Board will vote to approve the minutes from its October 15, 2025 meeting. It will discuss reports from the town’s representative to the Board of Elder Services of Cape Cod and the Islands, review the September 2025 budget summary and FY27 budget update, and consider a new action plan to improve relationships with town multi‑member bodies. Additional updates include a SNAP crisis briefing and FY26 board goals.

council-on-agingbudgetsenior-servicescommunity-outreachboard-meeting
✓ Decided: COA Board unanimously approved October meeting minutes

The board voted to approve the October 15, 2025 meeting minutes with a 6‑yes, 0‑no, 0‑abstain vote. The meeting was then adjourned unanimously. No other formal actions or votes were recorded.

Wed Nov 5, 2025

Zoning Board of Appeals

Zoning Board to hear home occupation sign and home addition permit requests

The Orleans Zoning Board of Appeals will meet to review meeting minutes and consider two special permit applications: a home occupation sign at 89 Nickerson Rd and home additions at 17 Deer Run.

zoningspecial-permithome-occupationbuilding-additionsorleans
✓ Decided: Zoning Board unanimously approves two special permits for a home‑occupation sign and a dwelling addition

The Orleans Zoning Board of Appeals approved a Special Permit for a sign at 89 Nickerson Road and a Special Permit for an addition to the dwelling at 17 Deer Run. Both approvals were voted unanimously 5‑0. The sign permit includes placement approval by the Building Commissioner, and the dwelling addition will exceed 4,000 sq ft of building coverage.

Wed Nov 5, 2025

Select Board

Select Board will review FY27 budget policy and discuss Town Manager evaluation

The Orleans Select Board meeting on November 5, 2025 will consider the FY27 budget policy statement and the accompanying budget schedule. The board will also receive a report on the Town Manager’s evaluation and discuss a new evaluation instrument. Committee interviews with the Cultural District, Energy and Climate Action, and Transportation & Bikeways committees are scheduled. The meeting includes standard items such as public comment and announcements.

budgettown-manager-evaluationcommittee-interviewsgovernancepublic-comment
✓ Decided: Board adopts FY27 budget schedule and policy unanimously

The Select Board unanimously approved the FY27 budget schedule and policy. It also appointed John Dugan as an associate member of the Energy & Climate Action Committee and Bob McDonald as a regular member of the Transportation & Bikeways Committee, each for a term ending June 30, 2028. All three actions passed with a 4‑0‑0 vote.

Tue Nov 4, 2025

Affordable Housing Trust Fund Board

Board will discuss the Specialized Energy Code's impact on affordable housing

The Affordable Housing Trust Fund Board will meet via Zoom on November 4, 2025. The board will discuss the Specialized Energy Code and its potential impacts on affordable housing. It will also discuss warrant articles and the board’s position on them. No formal decisions are indicated in the agenda.

affordable-housingenergy-codewarrant-articleshousing-policyboard-meeting
✓ Decided: Board rejects support for Specialized Energy Code (2-4-2 vote)

The Affordable Housing Trust Fund Board considered a motion to support the Specialized Energy Code and voted it down 2-4-2. The board then unanimously approved support for Warrant Articles 2, 4, and 5. The meeting was adjourned by unanimous vote.

Tue Nov 4, 2025

Snow Library Board of Trustees

Board will vote on the FY2027 Action Plan for Snow Library

The Snow Library Board of Trustees will consider several routine items, including approval of the October 7, 2025 meeting minutes and reports on finances, exterior vegetation, and library operations. Trustees will vote on the FY2027 Action Plan and on a temporary early closing of the library at 5 pm on Wednesday, November 26, 2025. The meeting also includes a report from the Friends Representative before adjournment.

librarybudgetoperationscommunitymeeting
Tue Nov 4, 2025

Conservation Commission

Commission reviews coastal project amendments and a new conservation restriction

The Orleans Conservation Commission will discuss several amendment requests for coastal development projects, including changes to a patio, deck, and stairs at multiple parcels. It will also consider a certificate of compliance for site regrading and invasive‑species removal. Finally, the commission will review and vote on a proposed conservation restriction at 137 Skaket Beach Road.

coastal-developmentland-useconservationwetlandsstorm-flowage
✓ Decided: Conservation Commission approved a new conservation restriction at Skaket Beach

The Orleans Conservation Commission approved a conservation restriction for 137 Skaket Beach Road (5-0-0). It also approved the 3 Shore View Drive deck project with a pre‑construction meeting condition (7-0-0) and granted certificates and permits for Kents Point stairs, 10 Howard Way compliance, and a certificate of compliance. Two pending projects were continued to a hearing on November 18, 2025.

Thu Oct 30, 2025

Finance Committee

Finance Committee to vote on warrant articles for November Town Meeting

The Finance Committee will discuss and vote on warrant articles for the November 17, 2025, Town Meeting. The committee will also review its Code of Conduct.

financetown-meetinggovernment-oversight
Tue Oct 28, 2025

Cultural District Committee

Cultural District Committee will review minutes and discuss upcoming arts events

The committee will vote to approve the September 2025 meeting minutes. It will hear the treasurer’s report and an update on the MCC grant. Members will discuss planned events such as Pop‑Up Practices, the Solstice celebration, and Arts Week, as well as the committee website.

cultural-districtartsgrantsevents
✓ Decided: Committee unanimously supports Solstice labyrinth design with white tape and extra lighting

The Cultural District Committee approved the September 2025 minutes by unanimous vote. It also unanimously supported the proposed Solstice star‑labyrinth design, specifying white tape, additional lighting, and a five‑path star layout. The meeting was adjourned unanimously.

Tue Oct 28, 2025

Veterans Committee

Veterans Committee discusses upcoming Veterans Day service and monument updates

The Orleans Veterans Committee will receive an update on the construction meeting held on October 20, 2025. Members will discuss plans for the upcoming Veterans Day service, including agenda items and speakers. The committee will also review recent discussions about a statue on Monument Road. A motion to close the meeting will be considered.

veteranseventsconstructionmonumentsmeetings
Tue Oct 28, 2025

Conservation Commission

Amended Order of Conditions for Eastward MBT’s project at 21 Pleasant View Dr.

The Conservation Commission will consider an amendment to the Order of Conditions for a development by Eastward MBT, LLC at 21 Pleasant View Dr. The amendment proposes adding a dry‑laid block patio adjacent to the approved swimming pool and adjusting the locations of approved plantings. The work is planned within the 100‑foot buffer zone of a bordering vegetated wetland. Additional items may be discussed beyond those listed.

zoningenvironmentwetlandsdevelopmentconservation
Mon Oct 27, 2025

Marine & Fresh Water Quality Committee

Committee discusses Baker Pond management and pesticide reduction

The Marine and Fresh Water Quality Committee will review water quality monitoring closeouts for freshwater lakes, ponds, and estuaries. The body will discuss the Baker Pond Management Plan's Fall Town Meeting Warrant proposal and a support statement for the Orleans Pesticide Reduction HRP.

water-qualityenvironmentpesticideslake-managementmonitoring
✓ Decided: Committee approved September 22 meeting minutes unanimously

The Marine & Fresh Water Quality Committee unanimously approved the September 22 regular meeting minutes and the September 22 special meeting minutes (both 6-0-0). No new policies or contracts were adopted; members discussed monitoring updates, erosion issues, and upcoming projects.

Thu Oct 23, 2025

Housing Authority

Vote to approve Bad Debt write‑off at Orleans Housing Authority meeting

The Orleans Housing Authority will discuss its budget and director's report, review an old laundry room contract, and consider several new business items. Items include certificates of completion for septic work at the Meetinghouse, a CFA amendment, and votes on a Bad Debt write‑off, a Fair Market Housing Plan, and other projects. The board will also review the 2025 annual report, approve vouchers, and set the next meeting date.

housingfinancecertificatesdebtplanning
Thu Oct 23, 2025

Architectural Review Committee

Committee to discuss Downtown Housing Overlay District amendment

The Architectural Review Committee will review two property applications and discuss a proposed amendment to the Downtown Housing Overlay District. The body will consider a motion regarding its opinion of the zoning bylaw amendment.

zoninghousingarchitectural-reviewsigns
✓ Decided: ARC formed a working group to draft its position on the Downtown Housing Overlay amendment

The committee approved a vinyl siding replacement for 45 S. Orleans Rd. (4‑0‑0). It also approved the September 11 and October 9, 2025 meeting minutes (each 4‑0‑0). A motion to create a working group to summarize the ARC’s stance on the Downtown Housing Overlay District amendment passed unanimously (4‑0‑0). A prior recommendation to the Planning Board was withdrawn by unanimous agreement.

Wed Oct 22, 2025

Select Board

Select Board to vote on housing overlay district and pesticide bill

The Select Board will vote to request an official opinion on housing criteria and amend a purchase agreement. They will also discuss supporting a pesticide reduction bill at a public hearing.

housingzoningpesticidestown-meetingenvironmentselect-board
✓ Decided: Select Board approved amendment to 22 Old Tote Road purchase agreement

The board approved an amendment to the 22 Old Tote Road Purchase & Sale Agreement, setting a new closing date of Dec. 31, 2025 (vote 3‑0‑1). It also voted unanimously to request an official opinion on the Downtown Housing Overlay District eligibility (4‑0‑0). Additionally, the board approved a letter of support for the Orleans Pesticide Reduction Home Rule Petition (Bill H.995) (4‑0‑0).

Tue Oct 21, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to vote on gallery exhibits and plaque wording

The Marion Craine Gallery Exhibition Committee will review artist presentations and exhibit applications. The board is also deciding on the wording for the Bobi Eldridge memorial plaque and the status of an annual Lower Cape Pride exhibit.

libraryartsgallerypublic-exhibits
✓ Decided: Committee approved annual Lower Cape Pride exhibit each June

The board unanimously approved the September 2025 minutes. It also approved Susan Karchmer and Rachael Sokolowski to exhibit in January and February, and adopted an annual Lower Cape Pride exhibit every June. The meeting was adjourned unanimously at 5:25 pm.

Tue Oct 21, 2025

Veterans Committee

Veterans Committee to discuss monument designs and construction updates

The Memorial Day/Veteran’s Day Committee is meeting to review construction updates and monument designs. The session includes presentations from Crosby Monuments and Site One.

veterans-affairsmonumentspublic-works
Tue Oct 21, 2025

Affordable Housing Trust Fund Board

Board will vote on applying for a FY27 Community Preservation Committee grant

The Affordable Housing Trust Fund Board will consider a grant application to the FY27 Community Preservation Committee. It will also approve an amendment to the purchase and sale agreement for 22 Old Tote Road rental housing and set a timeline for related proposals. Discussions will cover the Stretch Code's impact on affordable housing and a notice of funding availability carried over from the previous meeting.

affordable-housinggrantsrental-housingzoningtax-exemptioncommunity-preservation
✓ Decided: AHTB approved applying for $700,000 FY27 grant to fund affordable housing

The board voted unanimously (6-0-0) to have staff apply to the Community Preservation Committee for a FY27 grant of $600,000 for a housing unit and $100,000 for gap funding. It also unanimously approved an amendment to the purchase and sale agreement for 22 Old Tote Road and accepted the Notice of Funding Availability as presented. All motions were carried with a 6-0-0 vote.

Tue Oct 21, 2025

Conservation Commission

Conservation Commission to review Kents Point Land Management Plan

The Conservation Commission will review several project applications and a request for a revised plan. The body will also discuss and possibly vote on changes to the Kents Point Land Management Plan.

conservationzoningland-managementenvironmental-review
✓ Decided: Commission approved bulkhead rehab at 13 Old County Rd with conditions

The Conservation Commission unanimously approved the bulkhead rehabilitation project at 13 Old County Rd, attaching findings and standard conditions plus special DMF letter requirements. It also approved a revised plan at 20 Seacrest Dr with stone delineators and no mulch (5‑2‑0), a restoration at 20 Cheney Rd, a like‑for‑like gravel driveway replacement at 16 High Tide Ln, and a Certificate of Compliance for a septic system at 26 Gibson Rd. Additionally, the commission adopted changes to the Kents Point Land Management Plan to seasonally restrict parking from June 15 to September 15, establishing a one‑year pilot and monitoring program.

Mon Oct 20, 2025

Orleans School Committee

Fire/Rescue station update and security briefing top agenda items

The Orleans School Committee will hear a security update from Chief MacDonald and a fire/rescue station update from Select Board Chair Kevin Galligan. The committee will also discuss the NPS religious exemption curriculum opt‑out, review administrators’ reports, and consider the FY27 budget timeline. A recurring item to declare a surplus will be addressed.

school-committeesecurityfire-rescuecurriculumbudgetsurplus
Thu Oct 16, 2025

Board of Health

Board will hold show cause hearings for five properties ordered to connect to sewer

The Orleans Board of Health will conduct continued show cause hearings for properties under an order to connect to the municipal sewer, including 5 North Cottage Street, 89 Old Colony Way, 8Old Tote Road, 34Route 6A, and 63 Route 6A. The board will also discuss the upcoming Orleans Municipal Sewer Project Phase 2. Additional agenda items include public comment, temporary food permit approvals for Surfside Seafood, Cape Cod Charcuterie, and Beach Patrol Taco’s N Stuff, a health agent report, and administrative matters.

sewerpublic-healthpermitswater-infrastructuremunicipal
✓ Decided: Board postpones multiple Phase 1 sewer hearings to November 2025

The Orleans Board of Health voted to continue five Phase 1 sewer connection hearings until November 6 or November 20, 2025. It also moved the deferral request for 157 Route 6A to November 20. The Board approved three temporary food permits and appointed a burial agent, then adjourned.

Wed Oct 15, 2025

Board of Water & Sewer Commissioners

Public hearing on the Watershed Management Plan scheduled for Oct. 15

The Orleans Board of Water & Sewer Commissioners will hold a hybrid meeting on October 15, 2025. The agenda includes a public hearing on the Watershed Management Plan, a FOG variance request for the Orleans Whole Foods Store, and an additional allocated flow project for 43 Route 6A. Several water abatement requests are also listed, along with departmental reports on wastewater and drought conditions.

watershedfog-variancewater-abatementsewerdrought
✓ Decided: Board approves Whole Foods grease‑tank variance and extra wastewater flow

The Orleans Water & Sewer Board voted unanimously to approve a variance allowing Orleans Whole Foods to pump its external grease tank every four months instead of three. It also approved an additional wastewater flow of 66 gallons per day for 43 Route 6A. Several financial commitments and water charge abatements were authorized, and a request for a water‑leak abatement was denied.

Wed Oct 15, 2025

Open Space Committee

Open Space Committee meeting to discuss GIS lesson and CPC update

The Open Space Committee will hold its October 15 meeting to hear an online GIS lesson presented by John Jannell, receive a CPC update from Hardie, and consider approval of the August meeting minutes. The agenda also includes routine items such as call to order, chair business, scheduling the next meeting, and adjournment.

open-spacegiscpcminutesmeeting
✓ Decided: Open Space Committee approved prior minutes and adjourned the meeting

The committee approved the minutes from the September 17, 2025 meeting after a motion and second, with all members voting in favor. A motion to adjourn was made and seconded, and all members present voted to approve the adjournment. The next meeting was tentatively set for November 19, 2025.

Wed Oct 15, 2025

Council on Aging

Council on Aging board to discuss FY26 goals and FY27 budget priorities

The Orleans Council on Aging board will vote to approve the minutes from the September 24, 2025 meeting. The board will then review and discuss FY26 board goals and priorities. Finally, members will discuss the process for a new draft charge and possible recommendations for FY27 budget priorities.

council-on-agingbudgetsenior-servicesboard-governance
✓ Decided: Board approved FY26 COA goals and priorities

The Orleans Council on Aging Board approved the FY26 Board Goals and Priorities with a 6‑0 vote. The board also approved the September 24, 2025 meeting minutes by a 5‑0 vote. The meeting was then adjourned unanimously.

Wed Oct 15, 2025

Zoning Board of Appeals

Board will consider two special permit applications for residential additions

The Orleans Zoning Board of Appeals will review minutes from its September 17, 2025 meeting. It will then hear two special permit requests: one for an addition at 77 Monument Rd and another for modifications at 30 Hayward Lane. The board will also address administrative items such as filing decisions within 14 days and reporting on the application review.

zoningspecial-permitsresidential-additionspublic-hearingorleans-ma
✓ Decided: Board unanimously approved two special permits for residential additions

The Orleans Zoning Board of Appeals approved a Special Permit for 77 Monument Rd and a Special Permit for 30 Hayward Lane, each with a unanimous 5‑0 vote. The board also approved the meeting minutes from September 17, 2025. No other substantive actions were taken.

Wed Oct 15, 2025

Select Board

Board will vote on the November 17, 2025 Special Town Meeting warrant

The Select Board will hold a public hearing on transferring the liquor license for Rock Harbor Grill Inc. at 18 Old Colony Way, then vote on a new common victualler license for Cat Bar, Inc. at the same address and a one‑day alcohol license for Sunset Leisure at 96 Rt 6A. The board will also vote to appoint Jeremy Wiley as a student officer to the Orleans Police Department and to sign the November 17, 2025 Special Town Meeting warrant. Additional agenda items include committee interviews and resignations, a presentation on the Specialized Energy Code, and discussion of warrant articles for the special town meeting.

liquor-licensepolicespecial-town-meetingcommitteesenergy-code
✓ Decided: Select Board approved land acquisition for new fire‑rescue station costing $91.35 M

The board approved moving forward with a purchase‑and‑sale agreement to buy a 0.82‑acre parcel from Dr. Monfette for $1,350,000 to expand the fire‑rescue station and also approved a $91.35 million land acquisition for the fire‑rescue station project. It approved the transfer of the Rock Harbor Grill liquor license to Cat Bar, a new annual common victualler license for Cat Bar, and a one‑day liquor license for Sunset Leisure. Additional actions included appointing Jeremy Wiley as a student officer, appointing Joel Porten to the Transportation & Bikeways Committee, and supporting multiple Special Town Meeting warrant articles on zoning, the Specialized Energy Code, affordable‑housing tax exemption, community‑impact fee, and a capital improvement fund. All votes were unanimous (4‑0‑0) except the affordable‑housing tax exemption which passed 3‑0‑0.

Tue Oct 14, 2025

Economic Development Committee

Annual Small Business Survey results presented to Orleans EDC

The Economic Development Committee will review the September 9, 2025 meeting minutes and receive a staff update from Economic Development Coordinator Amanda Converse. An intern will present the results of the town’s Annual Small Business Survey. The committee will consider the Special Town Meeting Warrant scheduled for November 17 and address any new business items.

economic-developmentsmall-businesstown-meetingsurveyupdates
✓ Decided: EDC scheduled a virtual meeting on Nov. 7 to review the Downtown Housing Overlay District warrant

The committee unanimously approved the September 9, 2025 meeting minutes (vote 4‑0‑0). It also scheduled a special virtual meeting for Friday, November 7 at 9:00 a.m. to review the final Downtown Housing Overlay District warrant and consider an EDC endorsement. No other substantive actions were taken.

Tue Oct 14, 2025

Board of Assessors

Board will discuss real estate abatements and Chapter 61 applications in executive session

The Orleans Board of Assessors will review reports on motor vehicle abatements, motor vehicle excise commitments, and boat excise commitments. It will also approve the meeting minutes and examine the monthly sales report. An executive session will be held to discuss real estate abatements and Chapter 61 applications, which are confidential matters.

assessorsabatementsexcisefinanceexecutive-session
✓ Decided: Board approved $200,000 overlay surplus release for FY2026 budget

The Board unanimously approved 16 motor vehicle excise tax abatements totaling $7,926.92 and released $200,000 of overlay surplus for the FY2026 budget. It also unanimously authorized the Assessor to sign FY2026 tax recap sheets and approved boat and motor vehicle excise commitments for FY2026 and 2025. The minutes of the September 9 session were approved, and the board voted 2‑0 to adjourn and enter executive session.

Tue Oct 14, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee reviews proposed shellfish grant regulation changes and clam presence

The Shellfish & Waterways Improvement Advisory Committee will review proposed changes to shellfish grant regulations. Members will discuss whether manila clams are present in Orleans and Eastham waters. The meeting includes a public comment period and a report from Natural Resources Manager, Harbormaster, and Shellfish Constable Nate Sears.

shellfishwater-qualityfisheriespublic-commentnatural-resources
✓ Decided: Committee unanimously approved the Shellfish Grant Regulations

The advisory committee approved the meeting minutes without changes. The committee unanimously approved the Shellfish Grant Regulations after discussion. The meeting was then unanimously adjourned.

Tue Oct 14, 2025

Cultural Council

Council will discuss 2026 grant cycle deadlines and upcoming cultural projects

The Orleans Cultural Council will approve the September meeting minutes and hear the treasurer's report, which includes a grant update and the FY25 budget submission. Members will discuss the 2026 grant cycle, including deadlines for requests. The council will also follow up on a mural project, movies in the park, and consider holiday decorations through the Recreation Department.

culturalgrantsbudgetartsrecreation
✓ Decided: Council approves September minutes and votes to fund holiday display

The Orleans Cultural Council approved the September meeting minutes. A unanimous vote approved financial assistance for a new holiday display on the Village Green, though the exact amount will be set at a later meeting. No other formal actions were taken.

Tue Oct 14, 2025

Conservation Commission

Repair of a 135‑foot timber bulkhead at Town Cove

The Orleans Conservation Commission will discuss two conservation projects. One proposal is to restore about one‑third of the Orleans Conservation Trust property at 20 Cheney Rd into a high‑functioning eastern sandplain grassland, including vegetation alteration and invasive species removal. The other proposal is to repair, replace, and rehabilitate an existing timber bulkhead about 135 feet long (69 feet within Orleans) at 13 Old County Rd along Town Cove, involving work on coastal bank and related marine lands.

conservationenvironmentcoastalhabitatinfrastructure
Thu Oct 9, 2025

Architectural Review Committee

ARC will review property improvement applications and a new zoning by‑law presentation.

The Architectural Review Committee will consider six scheduled applications, including siding replacement, roof replacement, solar panel installation, landscaping, and sign modifications. The committee will also hear a presentation from the Planning Department on a new zoning by‑law. Minutes from the September meetings will be approved.

zoningarchitecturesignagesolarroofing
✓ Decided: ARC approves solar panels, new signs, roof replacement and grass planting

The Architectural Review Committee approved the installation of 366 solar panels on the Seashore Park Inn roof, a grass planting project at the same site, a new sign for Idle Times Bike Shop, a new HERS Raters of Cape Cod sign, and a full roof replacement for the Seashore Park Inn. The committee also postponed review of the meeting minutes and formally adjourned the meeting.

Thu Oct 9, 2025

Finance Committee

Finance Committee will discuss minutes, a climate presentation, and upcoming warrant articles

The Orleans Finance Committee will consider approval of the September 25 meeting minutes. A presentation by John Londa of the Energy and Climate Committee will be given. Members will discuss and vote on warrant articles for the November 17 Fall STM. The committee will also review upcoming meeting dates and locations.

financeminutesclimatewarrant-articlesmeeting-schedule
✓ Decided: Finance Committee recommends funding for wastewater engineering support

The committee approved the minutes from the September 25 meeting unanimously. It voted 7‑0‑0 to recommend the Fund Wastewater Engineering Support article. A recommendation for the Downtown Housing Overlay District was initially voted 3‑3‑1 and then rescinded by a unanimous 7‑0‑0 vote. The meeting was adjourned with a 7‑0‑0 vote.

Thu Oct 9, 2025

Energy & Climate Action Committee

Committee will recommend a Climate Action Roadmap to the Select Board

The Orleans Energy & Climate Action Committee will discuss several updates and outreach efforts, and will make a recommendation to the Select Board on the town's Climate Action Roadmap. It will also consider an appointment of a representative from Eversource for grid modernization and heat‑pump rate issues. The meeting includes updates from town staff, the local climate network, and a review of liaison assignments.

climate-actionenergyboard-recommendationsoutreachappointments
✓ Decided: Committee approved September 11, 2025 meeting minutes

The Energy & Climate Action Committee approved the minutes from the September 11, 2025 meeting, noting a needed clarification on the Climate Action Plan funding reference. The motion was moved by Roger McDaniel, seconded by David Jacobson, and passed unanimously. No other substantive actions were taken at this meeting.

Thu Oct 9, 2025

Human Services Advisory Committee

Committee will review and update its review and assignment processes

The Human Services Advisory Committee will receive updates on its charge, website, shared drive, a letter to nonprofits, and multi‑member bodies orientation. It will then discuss the committee’s review process and consider how to handle assignments, interview clustering, and outreach ideas. The meeting will also address how to manage late applications and set future calendar dates.

human-servicescommitteeprocessoutreachupdates
✓ Decided: Committee set a $200,000 budget assumption for FY27

The Human Services Advisory Committee approved the June 26, 2025 meeting minutes (4‑in‑favor, 1 abstention). It adopted a $200,000 budget assumption for FY27 and agreed to begin reviewing applications as soon as they are received. Members decided to interview all new applicants, to wait for agency applications before assigning reviewers, and assigned outreach and scheduling tasks. The meeting was adjourned unanimously.

Wed Oct 8, 2025

Historical Commission

Discussion of Public Education Initiative status and next steps

The Orleans Historical Commission will vote to approve the September 10, 2025 meeting minutes and review several open items, including draft statements of work for the Form B and Archaeology projects, an external website hosting payment, and the status of a public education initiative. The commission will also consider sunsetting its Facebook account and address any new business before setting future agenda items.

historicaleducationwebsiteminutesprojects
Wed Oct 8, 2025

Transportation and Bikeways Advisory Committee

Committee to discuss speed reduction and intersection safety

The Transportation and Bikeways Advisory Committee will discuss speed reduction strategies and a dangerous intersection review. The body will also review crosswalk policy and a field survey for Main Street.

transportationbikewaysroad-safetysignageinfrastructure
✓ Decided: Committee approved new meeting schedule: first Monday 3:30‑5:00 pm

The Transportation and Bikeways Advisory Committee unanimously approved moving regular meetings to the first Monday of each month, 3:30‑5:00 pm, starting in January. The committee also agreed to award the Main Street field survey contract to VHB immediately. The crosswalk policy will be revised and forwarded to the Select Board, and no action will be taken on the Route 28/Lake Drive intersection at this time.

Wed Oct 8, 2025

Select Board

Select Board to discuss Luxury Real Estate Transfer Fee and Special Town Meeting

The Select Board will consider an amendment to its meeting agenda policy and discuss a proposed Luxury Real Estate Transfer Fee. The board may also vote on supporting warrant articles for a Special Town Meeting.

real-estatetaxestown-meetinggovernancepolicy
✓ Decided: Board unanimously approved adding Wampanoag acknowledgment to meeting agenda

The Select Board voted 4-0-0 to enter Executive Session to discuss real‑property matters. It then unanimously approved an amendment to Select Board Policy A‑3 to include a Wampanoag acknowledgment statement on the agenda. The Board discussed a proposed real‑estate transfer fee and warrant articles but took no votes. The meeting was adjourned by unanimous vote.

Tue Oct 7, 2025

Snow Library Board of Trustees

Board will discuss the FY2027 Action Plan draft and facility assessment request

The Snow Library Board of Trustees will review and discuss the FY2027 Action Plan draft. They will also consider the Orleans request for proposals (RFQ) for a comprehensive facilities assessment of town‑owned facilities. Additional items include a financial report, the library director’s report, and the Friends representative report. The meeting will conclude with adjournment.

libraryfinancefacilitiesplanningcommunity
✓ Decided: Board unanimously approved the September 2025 meeting minutes

The trustees voted to approve the September 2025 minutes, with all members in favor. A motion to adjourn the meeting was also passed unanimously. No other motions were voted on.

Tue Oct 7, 2025

Conservation Commission

Conservation Commission to review residential projects and land restoration

The Conservation Commission will hear notices of intent for residential construction and renovations. The body will also consider a restoration project for eastern sandplain grassland and a request to support an amended Conservation Restriction.

conservationzoningenvironmental-protectionland-management
✓ Decided: Commission approved 21 Little Bay Rd pool project with monitoring and fence removal

The Conservation Commission unanimously approved the 5 Captain Linnell Rd addition with conditions on plastic material handling, a no‑mow zone, and a revised storm‑water plan. It also unanimously approved the 21 Little Bay Rd pool replacement, requiring removal of a split‑rail fence, annual monitoring, tree replacement, and overseeding of the lawn. The hearings for 65 Towhee Lane and 3 Shore View Dr were each continued to November 4, 2025. All votes were 7‑0‑0.

Thu Oct 2, 2025

Board of Health

Board reviews sewer connection orders and multiple permit requests

The Orleans Board of Health will hold continued show‑cause hearings for three properties ordered to connect to the municipal sewer. It will consider a hearing request for 130 Brick Hill Road and variance requests for 39 Champlain Road and 14 Greymoor Way. The board will also review several temporary food permit applications for local events and vendors.

healthsewerpermitsvariancesfoodzoning
✓ Decided: Board of Health approves building permit and multiple variances, extends sewer hearings

The Orleans Board of Health approved a building permit for 130 Brick Hill Road and granted variances for pool fencing at 39 Champlain Road and septic capacity at 14 Greymoor Way. It also extended show‑cause hearings for Phase 1 sewer connections at several properties, moving deadlines to October 16 or December 18, 2025. All temporary food service permits and one mobile food service permit were approved, and the minutes from the May 15, 2025 meeting were adopted.

Thu Oct 2, 2025

Community Preservation Committee

Committee will vote on Eldredge Park Renovation funding application

The Orleans Community Preservation Committee will hold a public hearing on October 2, 2025, with in‑person and Zoom participation. Members will discuss letters received about the Eldredge Park Renovation and then vote on application 16 F CPC FY26 for that project. A conservation presentation by Stephen O’Grady and project updates will also be provided. The meeting will conclude with approval of the September 4, 2025 minutes.

community-preservationparkspublic-hearingconservationminutes
✓ Decided: CPC recommends $3 million Town Meeting loan for Eldredge Park renovation

The Community Preservation Committee voted to recommend that the Town Meeting borrow $3 million for the Eldredge Park Renovation project. The motion passed with a vote of 8‑0‑1. The committee also approved the minutes from September 4, 2025, closed the Select Board, and adjourned the meeting.

Thu Oct 2, 2025

Select Board

Select Board to discuss Eldredge Park Renovation project

The Orleans Select Board meeting on October 2, 2025 will discuss a Community Preservation Committee application for the Eldredge Park Renovation project. The agenda also includes a call to order and an adjournment. The meeting may address additional items not listed, as noted in the disclaimer.

parkscommunity-preservationorleanstown-meeting
Wed Oct 1, 2025

Zoning Board of Appeals

Special permits considered for home additions at 77 Monument Rd and 30 Hayward Lane

The Orleans Zoning Board of Appeals will review minutes from its September 17, 2025 meeting. It will then consider two special permit applications: one for a proposed addition to a single‑family house at 77 Monument Rd, and another for footprint, deck, and storage modifications at 30 Hayward Lane. The board may discuss additional items at the Chair's discretion.

zoningpermitshousingboardhearings
Wed Oct 1, 2025

Board of Water & Sewer Commissioners

Board conducts site visit to 350 South Orleans Rd to assess watershed

The Orleans Board of Water & Sewer Commissioners will hold a special meeting on October 1, 2025 at 1:00 PM for a site visit to 350 South Orleans Rd. The visit is intended to understand the watershed area and its current allowed uses before the scheduled public hearing on October 15, 2025. The meeting will take place at the DPW office, 40 Giddiah Hill Rd.

watersewerwatershedsite-visitpublic-hearing
Wed Oct 1, 2025

Select Board

Select Board to review Open Space and Recreation Plan and festival licenses

The Select Board will consider endorsing a draft Open Space and Recreation Plan by Weston & Sampson. The board will also vote on various licenses for the Outermost Roots and Blues Festival and determine warrant articles for a Fall Special Town Meeting.

open-spacelicensingfestivalstown-meetingwater-infrastructure
✓ Decided: Select Board unanimously approves Open Space and Recreation Plan

The Board voted 4‑0‑0 to approve the Open Space and Recreation Plan draft prepared by Weston & Sampson. It also approved several one‑day alcohol and outdoor‑entertainment licenses for the Friends of Nauset Beach festival events on October 11‑12, and a two‑day Hawkers & Peddlers license for Billingsgate Market. Additionally, the Board authorized Town Manager Kim Newman to act as the town’s representative for the Massachusetts Clean Water State Revolving Fund Phase 3 application, also by a 4‑0‑0 vote.

Tue Sep 30, 2025

Veterans Committee

Veterans Committee to discuss memorials and Veterans Day planning

The Memorial Day/Veteran’s Day Committee is meeting to discuss the Vietnam and Korean War memorials. The group will also review brick sales and begin planning for Veterans Day.

veterans-affairsmemorialspublic-artcommunity-events
Thu Sep 25, 2025

Architectural Review Committee

Walkway replacement and landscape planting at 15 Locust Rd.

The Orleans Architectural Review Committee will consider a scheduled application to replace a walkway and enhance landscape plantings at 15 Locust Rd. The committee will also vote to approve the meeting minutes from September 11, 2025. Additional matters may be discussed at the Chair's discretion.

architectural-reviewwalkwaylandscapingminutestown-meeting
✓ Decided: ARC approves 15 Locust Road walkway improvement application

The Architectural Review Committee voted to accept the application for improvements to the walkway at 15 Locust Road. The motion was moved by Ms. Marsh, seconded by Ms. McMahan, and passed unanimously with a 3‑0‑0 vote.

Thu Sep 25, 2025

Finance Committee

Finance Committee proposes canceling 10/23 meeting to attend Comprehensive Plan forum

The Finance Committee will discuss budget priorities from the September 24 joint public hearing with the Select Board and review capital planning and revenue/budget working groups. It will consider a proposal to cancel the October 23 Finance Committee meeting so members can attend the Orleans Citizens Forum Planning Board presentation of the Comprehensive Plan. The committee will also approve the minutes from the September 11 meeting and receive updates and liaison reports. Upcoming meeting dates will be confirmed.

financebudgetplanningmeetingspublic-hearing
✓ Decided: Finance Committee cancelled the October 23 meeting to attend a planning board presentation

The committee approved the minutes from the September 11 meeting by an 8‑0‑0 vote. It then decided to cancel the October 23 Finance Committee meeting so members could attend the Planning Board's Comprehensive Plan presentation. No other substantive actions were taken.

Wed Sep 24, 2025

Finance Committee

Joint public hearing on FY 26 budget priorities with the Select Board

The Finance Committee will hold a joint public hearing with the Select Board to discuss FY 26 budget priorities for upcoming fiscal years. The meeting will be hybrid, allowing in‑person attendance at the Nauset Room, Town Hall, and remote participation via Zoom. After the hearing, any other business may be considered. The meeting will adjourn at the end of the session.

budgetfinancepublic-hearingselect-boardtown-meeting
Wed Sep 24, 2025

Council on Aging

Council on Aging will vote on Eldredge Park renovation support

The Orleans Council on Aging board will review and vote on several items, including the Eldredge Park Renovation Plan. Members will discuss funding for a new COA vehicle and set priorities for the FY27 budget. The board will also consider a draft charge to submit to the Select Board and approve the minutes from the July 23 meeting.

agingbudgettransportationparksgovernance
✓ Decided: COA Board approved Eldredge Park renovation plan and adopted 2026 schedule

The board approved the minutes from the July 23, 2025 meeting. It adopted the 2026 COA Board meeting schedule. Members voted to support the Eldredge Park Renovation Plan. The board also approved a new draft charge and sent it to the Select Board for approval.

Wed Sep 24, 2025

Select Board

Board will vote on road closure for Halloween Stroll and a one‑day alcohol license

The Select Board will consider several items, including a road closure request for the Orleans Chamber of Commerce’s Halloween Stroll on Oct. 25, 3:00‑4:30 p.m., and a request for a one‑day alcohol license for Agway of Cape Cod at 20 Lots Hollow Road on Oct. 3, 2025, 4:00‑6:00 p.m. The board will also hear a presentation on a possible special town meeting article for body‑worn and in‑car video cameras, and will hold a joint public hearing with the Finance Committee on upcoming budget priorities. Additional agenda items include recognition of the Orleans Intern Program “Spirit of Massachusetts Award,” follow‑up discussion of the Residential Tax Exemption Program, and interviews for affordable‑housing and cultural‑district committee appointments.

road-closurealcohol-licensingpublic-safetybudgetzoninghousingcultural-district
Tue Sep 23, 2025

Cultural District Committee

Cultural District Committee to discuss FY26 budget and priorities

The Cultural District Committee will meet to review the FY26 budget and determine priorities for 15K in MCC funding. The body will also discuss upcoming events and website updates.

budgetartsculturecommunity-events
✓ Decided: Committee unanimously approved the August 2025 minutes

The Cultural District Committee approved the August 2025 meeting minutes by unanimous vote. No other actions were formally approved; the committee discussed upcoming events, potential Arts Week funding, and banner repairs, but deferred decisions pending budget confirmation. The meeting was adjourned unanimously and the next meeting is set for Oct. 28, 2025.

Tue Sep 23, 2025

Conservation Commission

Orleans Conservation Commission holds on-site meeting

The Orleans Conservation Commission will hold an on-site meeting at Town Hall on September 23, 2025. The agenda lists matters anticipated by the Chair, though not all items may be discussed.

conservationtown-hallon-site-meetingagenda
Mon Sep 22, 2025

Fourth of July Committee

Orleans Fourth of July Parade Committee to debrief 2025 event

The committee will meet to review the 2025 parade and discuss open positions. The meeting includes time for new business and scheduling the next session.

community-eventsparadevolunteers
✓ Decided: Parade committee adjourned unanimously after debrief and planning

The Fourth of July Parade Committee met on September 22, 2025, debriefed the 2025 parade and identified several logistical challenges. Members discussed possible assistance from the Recreation Department, including police detail, storage space, and a flatbed truck for judges. No formal approvals or denials were recorded. The meeting was adjourned by a unanimous motion.

Mon Sep 22, 2025

Marine & Fresh Water Quality Committee

Committee will discuss alum treatment recommendation for Baker Pond

The Marine and Fresh Water Quality Committee will meet on September 22, 2025 to review the Baker Pond Management Plan, including an overview and update, and to consider a recommendation to use alum treatment for Baker Pond. The meeting will also include a period for public comment before adjourning.

water-qualityenvironmentpond-managementalum-treatmentpublic-hearing
✓ Decided: Committee discussed alum treatment for Baker Pond but took no action

The Marine & Fresh Water Quality Committee met on September 22, 2025 to review the Baker Pond Management Plan and consider a short‑term alum treatment to address phosphorus. Members presented data and public comments were heard, and the committee outlined next steps for a Town Meeting article and possible funding. No formal vote, approval, denial, or other decision was recorded at this meeting.

Mon Sep 22, 2025

Marine & Fresh Water Quality Committee

Committee to discuss Baker Pond Management Plan and Town Meeting proposal

The Marine and Fresh Water Quality Committee will receive updates on water quality monitoring for local lakes, ponds, and estuaries. The body will also discuss the Baker Pond Management Plan and a related proposal for the Fall Town Meeting Warrant.

water-qualityenvironmentbaker-pondcedar-pondmonitoring
✓ Decided: Committee unanimously approved the August 25, 2025 meeting minutes

The Marine & Fresh Water Quality Committee approved the minutes from the August 25, 2025 meeting with a 4‑0‑0 vote. No other formal actions were voted on; the remainder of the meeting consisted of updates on water‑quality monitoring, wastewater management, cyanobacterial monitoring, and upcoming public outreach events.

Thu Sep 18, 2025

Board of Health

Board may vote on the Crescendo Community Engagement Project

The Orleans Board of Health will discuss a possible vote on the Crescendo Community Engagement Project. It will also hold continued show‑cause hearings for properties ordered to connect to the municipal sewer, and consider a variance request for 13‑B Standish Road. Additional items include temporary food permit approvals for several vendors and a rabies vaccination exemption request.

healthsewerzoningpermitscommunity-engagementfestival
✓ Decided: Board approves 66‑ft pool fence variance and commits $3,750 to regional engagement

The Orleans Board of Health approved a 66‑foot variance for a pool fence at 13‑B Standish Road, allowing the fence to be placed 86 feet from the pool apron with required safety features. It also voted to allocate $3,750 of opioid‑abatement funds to a Crescendo Consulting community‑engagement study with neighboring towns. Several ongoing sewer‑connection show‑cause hearings were postponed to October dates, and temporary food permits for four vendors and a rabies‑vaccination exemption for a cat were approved. All votes were unanimous voice votes.

Thu Sep 18, 2025

Recreation Advisory Committee

Town reviews 2025 Open Space and Recreation Plan update

The joint Conservation Commission and Recreation Advisory Committee will hear a presentation of the 2025 Open Space and Recreation Plan update by Town Planner George Meservey. Committee members and the public will discuss the plan and ask questions. The meeting will conclude with a vote on the proposed updates.

recreationopen-spaceplanningconservationtown-meeting
✓ Decided: Recreation Advisory Committee unanimously backs 10‑Year Open Space Plan

The committee voted to formally support the Draft Open Space and Recreation Plan presented by George Meservey. The motion passed unanimously, 5‑0. The meeting was then adjourned at 6:30 PM.

Thu Sep 18, 2025

Open Space Committee

Town presents 2025 Open Space and Recreation Plan update for discussion

The Open Space Committee, meeting jointly with the Recreation Advisory Committee and the Conservation Commission, will hear a presentation of the 2025 Open Space and Recreation Plan update from Town Planner George Meservey. The agenda includes public comment, discussion and questions, and a vote on the plan update.

open-spacerecreationplanningcommitteepublic-comment
Thu Sep 18, 2025

Conservation Commission

Commission reviews 2025 Open Space and Recreation Plan update

The Conservation Commission and Recreation Advisory Committee will hear a presentation of the Open Space and Recreation Plan Update for 2025 by Town Planner George Meservey. Members of the public may comment. The bodies will discuss the plan and hold a vote.

open-spacerecreationplanningpublic-comment
Wed Sep 17, 2025

Board of Water & Sewer Commissioners

Board of Water & Sewer Commissioners to discuss Watershed Management Plan

The Board will meet to discuss the Watershed Management Plan and reorganize the Board. The meeting includes reports on wastewater infrastructure and water department updates regarding a September drought.

water-managementsewer-infrastructurewatershed-planningutilitiespublic-works
✓ Decided: Board approved public hearing for watershed management plan on Oct 15, 2025

The Board voted 7‑0‑0 to schedule a public hearing for the watershed management plan on October 15, 2025. It also extended mandatory water‑use restrictions through December 31, 2025 with a 7‑0‑0 vote. Several financial actions were approved, including committing sewer receivables of $44,789.50 and water/ sewer rate receivables of $4,772.54 for August 2025, and issuing refunds and shut‑off letters.

Wed Sep 17, 2025

Zoning Board of Appeals

ZBA to consider special permit for additions at 9 Little Marsh Lane

The Zoning Board of Appeals will meet to review minutes from a previous meeting and continue a public hearing regarding a residential property. The board is considering a request to alter a nonconforming structure and adjust a front yard setback.

zoningspecial-permitresidential-constructionsetbacks
✓ Decided: Board unanimously approves Special Permit for 9 Little Marsh Lane

The Orleans Zoning Board of Appeals approved the September 3, 2025 meeting minutes, closed public comment on Case #2025-13, and approved a Special Permit for 9 Little Marsh Lane. The permit allows a six‑inch front‑setback increase and a second‑floor addition to the nonconforming residence. All three actions were approved by a unanimous 5‑0 vote.

Wed Sep 17, 2025

Open Space Committee

Open Space Committee will discuss updates and approve meeting minutes

The Orleans Open Space Committee will consider an update on the 22 Tonset project, hear announcements about CPC happenings, and vote to approve the August meeting minutes. The agenda also includes routine items such as public comment, chair business, and scheduling the next meeting for October 15, 2025. The meeting is set for September 17, 2025 at 9:00 AM in the Skaket Room of Orleans Town Hall, with remote access via Zoom.

open-spaceminutesplanningpublic-comment
✓ Decided: Open Space Committee approved the August 20 minutes and adjourned

The committee voted to approve the minutes from the August 20, 2025 meeting, with all members present voting in favor. A motion to adjourn the September 17 meeting was also approved by all members present. No other formal actions or votes were recorded.

Tue Sep 16, 2025

Affordable Housing Trust Fund Board

Board to discuss rental housing RFP for 22 Old Tote Road

The Affordable Housing Trust Board will review project updates and discuss a Request for Proposals for four rental housing units at 22 Old Tote Road. The board will also hear a presentation on the Specialized Stretch Code and discuss funding availability criteria.

affordable-housingrental-housingzoningstretch-codehousing-trust
✓ Decided: Board approved August minutes and adjourned the meeting

The Affordable Housing Trust Fund Board approved the minutes from the August 18, 2025 meeting with a 5-0-2 vote. The board then adjourned the September 16, 2025 meeting unanimously (7-0-0). No other substantive actions were decided.

Tue Sep 16, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to consider presentation by artist Darcy Herrington

The Marion Craine Gallery Exhibition Committee will meet to review the gallery schedule and hear a presentation from artist Darcy Herrington. The board will also review the financial and library director's reports.

libraryartsgallerypublic-meetings
✓ Decided: Committee approved the August 2025 meeting minutes

The board voted unanimously to approve the minutes from the August 2025 meeting. Library Director Tavi Prugno will email committee members suggested wording for a memorial plaque for founder Bobi Eldridge. The committee will follow up next month on artist Brian Ramsay’s submission for a future exhibit. The meeting was adjourned at 4:45 pm.

Tue Sep 16, 2025

Conservation Commission

Review of pool replacement and hardscape project at 21 Little Bay Rd

The Conservation Commission will consider a Notice of Intent to replace an existing pool and hardscape at 21 Little Bay Road, including vegetated buffer work within the 100‑foot coastal buffer and Pleasant Bay ACEC. It will also hear continuance requests for road improvements at 45 Old Field Road, a deck extension at 3 Shore View Drive, and a revised plan to replace an ornamental cherry with three tupelos at 27 Cheney Road. The meeting includes discussion of the Kents Point public hearing (8/27/25) on Land Management Plan updates. Public comment will be allowed.

conservationcoastalland-managementpublic-hearingenvironment
✓ Decided: Commission approved 45 Old Field Rd road and bank stabilization project

The Commission unanimously approved the road improvement and bank stabilization project at 45 Old Field Rd, attaching findings, standard conditions, and specific monitoring requirements. It also approved a revised planting plan for 27 Cheney Rd, replacing an ornamental cherry with three native tupelos. The Commission continued public hearings for the Little Bay Rd pool project, the Shore View Dr deck project, and set a new hearing date of October 7, 2025 for each. Additionally, the Commission directed staff to develop findings and a proposed motion for a seasonal sticker‑parking pilot at Kents Point and adjourned the meeting.

Mon Sep 15, 2025

Orleans School Committee

Orleans School Committee to discuss Special Education Stabilization Fund

The Orleans School Committee will meet to review administrator reports and the NRHS Building Project. The committee is scheduled to discuss and vote on the Special Education Stabilization Fund and approve gifts and grants.

educationbudgetspecial-educationschool-constructionpublic-finance
✓ Decided: Committee approved $124,139 transfer to Special Education Stabilization Fund

The Orleans School Committee voted to return the FY25 budget excess of $124,139 to the town and to place a warrant article to move those funds into the Special Education Stabilization Fund. The committee also accepted a $5,614 gift from the Orleans Conservation Trust, approved the 2025‑2026 PTC fundraisers, and approved the minutes from the June 9, 2025 meeting. All motions were adopted unanimously.

Thu Sep 11, 2025

Architectural Review Committee

Committee will decide on a windows, deck and chimney project at 143 Rt 6A

The Architectural Review Committee will consider two property improvement applications. One is from George Davis Inc for windows, a deck, and a chimney replacement at 143 Rt 6A. The other is a continued application from Idle Times Bike Shop for a window replacement at 29 Main Street. The committee will also approve the minutes from the August 28, 2025 meeting and may discuss any other matters the chair raises.

architectural-reviewbuilding-permitsconstructiontown-meetingorleans
✓ Decided: ARC approved deck, chimney work at 143 Route 6A and modified window plan for Idle Times

The Architectural Review Committee approved George Davis Inc.'s application to replace the deck, railing, and chimney at 143 Route 6A with a 4‑0‑0 vote. The committee also approved Idle Times' submission A2 for 29 Main Street, adding specific window framing, mullion, color, plantings, and lighting modifications, also by a 4‑0‑0 vote. Minutes from the August 28, 2025 meeting were approved, and the meeting was adjourned.

Thu Sep 11, 2025

Finance Committee

Finance Committee to discuss subcommittees and FY27 budget policy

The Orleans Finance Committee will meet to discuss the formation of subcommittees for capital planning and revenue/budget, review meeting schedules, and hold a joint meeting with the Select Board regarding the FY27 Budget Policy.

financebudgetsubcommitteesselect-boardbroadbandmeeting-schedule
✓ Decided: Finance Committee approved August minutes and adjourned the meeting

The Orleans Finance Committee unanimously approved the minutes from the August 28, 2025 meeting. The committee discussed the formation of working groups and received updates on various town projects, but no further actions were taken. The meeting was then adjourned by an 8‑0‑0 vote.

Thu Sep 11, 2025

Energy & Climate Action Committee

Committee considers appointment with RevEnergy LLC for energy monitoring

The Energy & Climate Action Committee will hear public comment, consider an appointment with Tom Boudreau of RevEnergy LLC on energy monitoring, receive updates from the Assistant Town Manager and local climate groups, review the Comprehensive Plan before its draft release, and vote to approve minutes from the August 14 and August 21 meetings.

energyclimateplanningpublic-commentminutestown-government
✓ Decided: ECAC approves meeting minutes and proceeds with up to $100K Climate Action Plan

The committee approved the minutes from the August 14, 2025 meeting. It decided to move forward with the Climate Action Plan, authorizing up to $100,000 in spending without further approvals. The sole solar‑project bidder was deemed acceptable and a contract is being finalized, and the EV‑charger package has been resubmitted to Eversource pending response.

Wed Sep 10, 2025

Historical Commission

Commission will vote to approve minutes from June, July, and August 2025 meetings

The Orleans Historical Commission will consider several routine items. Commissioners will vote to approve the meeting minutes from the June 11, July 9, and August 13, 2025 sessions. They will also discuss updates on signage, the CPC projects budget, open Form Bs, and the town’s marketing and branding initiative. New business includes reviewing the regular meeting time and setting the next meeting for October 8, 2025.

historical-commissionminutessignagebudgetmarketingmeetings
✓ Decided: Commission approves multiple RFPs and shifts meeting time to 3 pm

The Orleans Historical Commission approved the minutes from June, July and August 2025 (3‑0‑0). It voted to issue a request for proposals for archaeological services (3‑0‑0) and for updating about 28 Form Bs at an estimated $40,000 (3‑0‑0). The commission also moved its regular meeting time to 3:00 pm, pending room availability (3‑0‑0).

Wed Sep 10, 2025

Transportation and Bikeways Advisory Committee

Committee will decide on prioritizing the Old Colony sidewalk project

The Orleans Transportation and Bikeways Advisory Committee will discuss safety improvements on Barley Neck Road, Nauset Heights Road, and the bike crossing at West Road and Salty Ridge Road. They will review a draft crosswalk policy and consider a field survey warrant for Main Street. A key decision will be whether to continue pursuing the Old Colony sidewalk project as a priority.

transportationbikewayssafetysidewalkscrosswalksplanning
✓ Decided: Committee postpones $350K Old Colony engineering to FY‑29 and $3M construction to FY‑31

The committee approved Stephanie Gaskill as clerk by unanimous vote. It voted unanimously to defer the $350,000 FY‑26 engineering and design budget for the Old Colony project to FY‑29 and to shift the $3 million construction budget to FY‑31. A warrant article to fund a Main Street field survey was also approved unanimously. Minutes of the August 13 community meeting and the adjournment motion were each approved unanimously.

Wed Sep 10, 2025

Select Board

Board to discuss next steps for Eldredge Park renovation funding

The Select Board will interview candidates for several town committees and consider resignations. It will review updates to the Rental Registration Program and discuss possible next steps for the town's CPC application to fund the FY26 Eldredge Park Renovation project. The board will also update a warrant article for the Fall Special Town Meeting, vote on amendments to Select Board Policies, and approve recent meeting minutes.

parksbudgetcommitteespoliciesappointments
Wed Sep 10, 2025

Select Board

Select Board to discuss non-union personnel strategy and Finance Director contract

The board will hold an executive‑session strategy meeting on upcoming negotiations with non‑union personnel. It will then vote on whether to consider the Finance Director’s contract. Finally, the board will review Select Board Policies Sections C and D.

personnelcontractspolicy-reviewselect-boardgovernance
Tue Sep 9, 2025

Economic Development Committee

Discussion of wastewater management advisory committee's sewer project correspondence

The Orleans Economic Development Committee will review the minutes from its June 10, 2025 meeting. It will receive a staff update from Economic Development Coordinator Amanda Converse and a zoning update from the Planning Department. The committee will discuss correspondence from the Wastewater Management Advisory Committee regarding a sewer project. The meeting also includes public comment, membership updates, and scheduling of the next meeting.

economic-developmentsewerzoningpublic-commentstaff-update
✓ Decided: EDC approved June 10 minutes unanimously and adjourned the meeting

The Economic Development Committee approved the minutes from the June 10, 2025 meeting by a 4‑0 vote. The meeting was then adjourned at 10:22 a.m. after a motion by David Currier. No other actions were decided.

Tue Sep 9, 2025

Board of Assessors

Board of Assessors will discuss MV Abatements report and sales data

The Orleans Board of Assessors will review and approve the meeting minutes. It will consider the Monthly Sales Report and the MV Abatements Report. The board will then enter an executive session to discuss abatements, exemptions, and Chapter 61 applications under confidentiality requirements.

assessorsabatementssalesbudgetexecutive-session
✓ Decided: Board unanimously approved 21 motor vehicle tax abatements totaling $1,993.55

The Board of Assessors unanimously approved 21 motor vehicle excise tax abatements that total $1,993.55. The assessors also approved the minutes from the August 12 open session. The meeting was called to order at 4:05 p.m. and adjourned at 4:15 p.m.

Tue Sep 9, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee will discuss the Pleasant Bay eel grass study

The Shellfish & Waterways Improvement Advisory Committee will review the August 2025 minutes, hear a presentation on the Pleasant Bay eel grass study from Holly K. Plaisted, receive a report from Natural Resources Manager, Harbormaster, and Shellfish Constable Nate Sears, and open the floor for public comments and announcements. No formal decisions are indicated on the agenda.

environmentwaterwaysshellfishpublic-comment
✓ Decided: Committee unanimously adjourned after accepting minutes

The Shellfish & Waterways Improvement Advisory Committee accepted the prior meeting's minutes. After reports on eelgrass, shellfish closures, and ongoing projects, the members voted unanimously to adjourn the meeting.

Tue Sep 9, 2025

Cultural Council

Council will discuss grant opportunities for the town

The Orleans Cultural Council will open with a call to order and review the previous meeting minutes. Members will discuss grants and brainstorm ideas for 2026. The meeting will conclude with an adjournment. Items listed are anticipated topics and may be adjusted as permitted by law.

culturalgrantsplanningcommunitymeeting
✓ Decided: Council approved the May meeting minutes

The Cultural Council approved the minutes from the May meeting. The council received notice that it will receive $5,700 from the Mass Cultural Council for the next grant cycle. Action items were assigned: Ellen Snyder‑Grenier will write and submit an article about grant applications and contact teachers about blackout dates; Heather Morin will update the members list and website with term limits; Brian Smith will email agenda copies to members before meetings; each member will review project ideas and report back at the October meeting.

Tue Sep 9, 2025

Conservation Commission

Conservation Commission holds on-site meeting in Orleans

The Orleans Conservation Commission will hold an on-site meeting at Town Hall to discuss a Notice of Intent for a property at 21 Little Bay Rd. The proposal involves replacing an existing pool and hardscape with new features, installing a vegetated buffer along a Coastal Bank, and managing invasive plants.

conservationenvironmentcoastal-bankinvasive-plantsnotice-of-intent
Thu Sep 4, 2025

Community Preservation Committee

Committee to consider funding for Eldredge Park Renovation

The Community Preservation Committee will review a new funding application for the Eldredge Park Renovation. The body will also receive a presentation from the Recreation Department and Recreation Advisory Committee and review financial updates on existing projects.

parkshousinghistoric-preservationbudget
✓ Decided: CPC defers Eldredge Park renovation decision to Oct 2 meeting

The committee unanimously approved the August 7, 2025 minutes and then adjourned the meeting. A motion to bond $2.5 million for the Eldredge Park Renovation was withdrawn. The committee decided to continue discussion of the renovation at the October 2, 2025 meeting.

Wed Sep 3, 2025

Zoning Board of Appeals

ZBA to hear special permit request for 9 Little Marsh Lane

The Zoning Board of Appeals will review a request to add a second floor and garage to a home at 9 Little Marsh Lane. The board will also review decisions for two previous cases.

zoningspecial-permitresidential-constructionsetbacks
✓ Decided: Board approves minutes, amends decision language, and sets continuation date

The Zoning Board of Appeals unanimously approved the August 20, 2025 meeting minutes. It also unanimously amended the language of the decision for Case #2025-08/14 Hayward Lane. Finally, the board unanimously approved a continuation of the Little Marsh Lane special permit case to September 17, 2025.

Tue Sep 2, 2025

Snow Library Board of Trustees

Snow Library Board to vote on temporary affordable housing model

The Snow Library Board of Trustees will meet to discuss physical plant priorities and parking restrictions at 56 Main Street. The board is scheduled to vote on a temporary affordable housing model on library property to advertise a Lifelong Learning (LTL) course.

libraryaffordable-housingparkingpublic-facilities
✓ Decided: Board approves prior meeting minutes and elects new Friends officers

The trustees approved the July 1 2025 meeting minutes unanimously. They elected Gerry Grenier as vice‑president of the Friends of Snow Library and Linda Reed as member‑at‑large, each by board vote. The board then moved to adjourn the meeting, which passed unanimously. No other motions were decided.

Tue Sep 2, 2025

Conservation Commission

Conservation Commission reviews coastal bank and wetland projects

The Orleans Conservation Commission is meeting to review requests for determinations, revised plans, and certificates of compliance for residential and commercial properties. The body will evaluate work involving coastal banks, beaches, and wetland resource areas.

conservationcoastal-bankwetlandszoningenvironmental-review
✓ Decided: Conservation Commission unanimously approved multiple coastal and property projects

The Orleans Conservation Commission approved a positive determination for 158 Tonset Rd, a revised plan for 48 Horseshoe Ln with a hand‑installation condition for a sauna, certificates of compliance for 21 Tanglewood Terrace and 16 Hayward Ln, and the project at 1 Ruggles Rd. All motions passed with a 7‑0‑0 vote.

Thu Aug 28, 2025

Architectural Review Committee

Architectural Review Committee to review window replacement at 29 Main Street

The Architectural Review Committee will meet to consider a scheduled application and approve previous meeting minutes. The primary item for review is a request regarding a local business.

architectural-reviewbusiness-permitsmain-street
✓ Decided: Committee continued review of 29 Main St window project to Sep 11

The Architectural Review Committee unanimously approved the minutes from the August 14 meeting. The committee also unanimously voted to adjourn the August 28 meeting. Members asked the applicant to submit revised drawings to address window asymmetry and directed that the matter be continued to the September 11, 2025 meeting.

Thu Aug 28, 2025

Finance Committee

Orleans Finance Committee to discuss liaison assignments and fiscal management

The Finance Committee will meet to appoint liaison assignments and discuss Select Board goals regarding fiscal management. The meeting also includes updates from liaisons and the establishment of a September meeting schedule.

financebudgetgovernment-administration
✓ Decided: Finance Committee unanimously approved the August 7 meeting minutes

The Orleans Finance Committee approved the minutes from the August 7, 2025 meeting by a 7‑0 vote. The committee discussed liaison assignments for various town departments and committees. It set three upcoming meeting dates in September, confirming a preferred start time of 5:30 pm. The meeting was adjourned with a unanimous 7‑0 vote.

Thu Aug 28, 2025

Select Board

Select Board and Nauset Regional School Committee to discuss district property

The Orleans Select Board and Nauset Regional School Committee are holding a joint meeting. The body will discuss Nauset Regional School District property.

schoolspropertyjoint-meeting
Wed Aug 27, 2025

Conservation Commission

Conservation Commission to vote on Kent’s Point parking plan changes

The Orleans Conservation Commission will hold a public hearing on proposed changes to the Kent’s Point Land Management Plan, specifically regarding a sticker parking requirement. The meeting may also discuss other items as permitted by law, but only the parking plan is formally listed for action.

conservationparkingland-managementpublic-hearingkent's-point
✓ Decided: Commission closed public hearing, allowing written comments until Sep 9 2025

The Conservation Commission voted 7‑0‑0 to close the public hearing on the Kent’s Point Land Management Plan, but will accept written public comments through September 9, 2025. A second unanimous vote 7‑0‑0 adjourned the meeting. No substantive action on the proposed sticker‑parking requirement was taken at this meeting.

Tue Aug 26, 2025

Housing Authority

Orleans Housing Authority to interview candidates for Executive Director

The Orleans Housing Authority will hold a regular meeting to discuss routine business including financial reports, old and new business. The most consequential item is the scheduled interviews for the Executive Director position.

housingexecutive-directorfire-alarmhandicap-accessfinancial-report
Tue Aug 26, 2025

Conservation Commission

Conservation Commission to review coastal bank delineation request at Town Hall

The Orleans Conservation Commission will hold an on-site meeting on August 26, 2025, to review a Request for Determination regarding a coastal bank delineation at 158 Tonset Rd. The request was filed by Jonathan Geithner et al and is represented by J.M. O’Reilly & Associates.

coastal-bankzoningconservationtown-hall
Tue Aug 26, 2025

Cultural District Committee

Cultural District Committee to discuss FY 26 budget and upcoming events

The Cultural District Committee will review the FY 26 budget and coordinate several community projects. The body is discussing logistics for events including Arts Week and the Orleans Block Party. Members will also seek to set a date to update the strategic plan.

artsculturebudgetcommunity-eventsstrategic-planning
✓ Decided: Committee unanimously approves FY26 budget and Pop‑Up Practices expenses

The Cultural District Committee unanimously approved the July 22, 2025 minutes, the FY26 budget allocating about $6,670 for Solstice and Arts Week, and the projected expenses of $5,246.64 for the Pop‑Up Practices series. The Orleans Block Party was noted as cancelled, and new banners will be installed for the Solstice event. The meeting adjourned unanimously and set the next meeting for September 23, 2025.

Tue Aug 26, 2025

Veterans Committee

Veterans Committee to discuss war memorials and markers

The Veterans Committee will review designs for a Vietnam memorial and an Indigenous marker. The body will also discuss the approval of a podium reflecting the War of 1812 and provide updates on construction and brick sales.

veterans-affairsmemorialspublic-arttown-maintenance
Mon Aug 25, 2025

Marine & Fresh Water Quality Committee

Marine and Fresh Water Quality Committee reviews 2025 water monitoring plans

The Orleans Marine and Fresh Water Quality Committee meets to discuss freshwater and estuary water quality monitoring updates for 2025, including planning for Pleasant Bay, Nauset Estuary, and Cedar Pond. The committee will also review final reports, management plans, and educational outreach activities.

water-qualitymonitoringfreshwaterestuarymanagement-plans
✓ Decided: Committee approved July 29 minutes with unanimous vote

The Marine & Fresh Water Quality Committee approved the July 29, 2025 meeting minutes with a 6‑0‑1 vote (Carol abstained). The committee confirmed the reappointments of Carolyn Auty as Vice Chair, Rich Levy as Chair through CY 2025, and Bob Mullin as Clerk through CY 2025, leaving one seat vacant. Members discussed volunteer recruitment, pond and estuary monitoring updates, and plans for an alum treatment at Baker Pond pending town approval. The committee also noted actions to improve web‑page postings of open positions and water‑quality data.

Thu Aug 21, 2025

Board of Health

Board of Health to hold sewer connection hearings and review variance requests

The Board of Health will conduct show cause hearings for properties ordered to connect to the municipal sewer. The board will also consider waiver and variance requests for several residential addresses and review a Short Term Rental Program presentation.

sewerpublic-healthshort-term-rentalszoning-variancesfood-permits
✓ Decided: Board grants one‑year continuance for 167A Route 6A sewer connection

The Orleans Board of Health continued show‑cause hearings for several Phase 1 sewer properties, voting to postpone each case to the October 2 or September 18 meetings. It approved a one‑year continuance for 167A Route 6A to explore easement and alternative‑system options. The board also approved waivers for Title 5 inspections at 21 Little Bay Road and 22 Pilgrim Lake Terrace. All votes were unanimous voice votes (5‑0‑0).

Thu Aug 21, 2025

Energy & Climate Action Committee

Energy and Climate Action Committee meets to review Energy Navigator after soft opening

The Orleans Energy and Climate Action Committee will meet to review the Energy Navigator program after its soft opening. The meeting is procedural with no substantive decisions scheduled.

energyclimateprocedural
✓ Decided: Energy & Climate Action Committee adjourned meeting with no substantive actions

The committee met on August 21, 2025, reviewed contributions to the Energy Navigator program, and then moved to adjourn. A motion to adjourn was made by John Londa, seconded by Roger McDaniel, and approved. No other decisions were taken.

Wed Aug 20, 2025

Zoning Board of Appeals

Zoning Board reviews two special permits for accessory dwellings and pool reconstruction

The Orleans Zoning Board of Appeals will hold a public hearing to review two special permit applications. One involves Happy Clam LLC proposing an accessory dwelling/garage at 14 Hayward Lane. The other concerns Jason Andrew Beard and Amy Beard’s plans to reconstruct a dwelling, add a pool, and modify setbacks at 62 Countryside Drive.

zoningspecial-permitaccessory-dwellingpool-reconstructionpublic-hearing
✓ Decided: Board approves special permit for Happy Clam LLC with tree‑planting condition

The Zoning Board of Appeals approved the minutes from the August 6 meeting (5‑0). It approved a special permit for Happy Clam LLC at 14 Hayward Lane, requiring the planting of 6‑foot mature trees along the driveway before a Certificate of Occupancy (vote 4‑1). The board also approved a special permit for Jason and Amy Beard’s project at 62 Countryside Drive (5‑0). Finally, Matt Cole was appointed as the board’s representative to the Zoning Bylaw Task Force (5‑0).

Wed Aug 20, 2025

Open Space Committee

Open Space Committee to vote on committee leadership roles

The Open Space Committee will meet to elect a Chair, Vice-chair, Clerk, and CPC representative. The body will also receive an update on priority parcels.

open-spacegovernanceland-use
✓ Decided: Open Space Committee appoints new chair and officers

The committee voted to appoint Lynn O'Connell as Chair, David Herrick as Vice Chair, Christopher Keating as Clerk, and Hardie Truesdale as liaison to the CPC. The minutes from the June 25, 2025 meeting were approved. The meeting was then adjourned.

Wed Aug 20, 2025

Board of Water & Sewer Commissioners

Board holds public hearing on Phase 3 utility easements

The Board of Water & Sewer Commissioners will hold a public hearing regarding proposed easements for the Phase 3 Lakes and Ponds Area Sanitary Sewer and Pump Station Project. The board will also review water and sewer department reports and discuss a flow request for Nauset Farms.

sewerwaterutility-easementsinfrastructurepublic-hearing
✓ Decided: Board commits $901,510.37 for July water and sewer receivables

The Board recommended that the Select Board execute utility easement orders and a pump station easement. It directed staff to reconcile the commission charter and affirmed prior votes. The Board approved financial commitments totaling $964,689.37 for July water and sewer receivables and approved several minutes and abatement actions. The meeting adjourned at 2:16 p.m.

Wed Aug 20, 2025

Select Board

Select Board to vote on easements, pump station agreement, and Verizon/Eversource pole hearings

The Orleans Select Board will meet to decide on Phase 3 easements, a pump station agreement with 101-105 Finlay Road, and public hearings for Verizon and Eversource pole replacements in Rock Harbor. They will also discuss supporting a seasonal communities designation effort with neighboring towns and appoint committee representatives.

zoningutilitiestaxesappointmentspublic-hearing
Tue Aug 19, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to vote on artist presentations

The Marion Craine Gallery Exhibition Committee will meet to review artist presentations and gallery scheduling. The board will also discuss a future exhibition for Lower Cape Pride in June 2026.

libraryartsexhibitionspublic-culture
✓ Decided: Committee approved November exhibition of artist Julie Brooks

The Marion Craine Gallery Committee approved two artist exhibitions—Julie Brooks for November and Derrick Roese for October—by unanimous vote. The board also approved the minutes from the July 15, 2025 meeting, a June 2026 exhibition by the Outercape Pride group, and a memorial plaque for founder Bobi Eldridge. All motions passed with all members in favor.

Tue Aug 19, 2025

Conservation Commission

Conservation Commission to hear public on farm barn and coastal work permits

The Orleans Conservation Commission will open a public hearing on a proposed agricultural barn at Putnam Farm and review multiple requests for determinations and notices of intent for coastal work. All items involve construction or site changes within 100-foot buffer zones to sensitive coastal resources.

coastal-bankconservation-commissionfarm-structurepublic-hearingwetlands
✓ Decided: Commission approves west‑side barn location at Putnam Farm (4‑3 vote)

The Orleans Conservation Commission voted 4‑3 to approve alternative 2, the west‑side barn site closest to the wetland at Putnam Farm. The commission also approved a negative determination for the Putnam Farm project, approved the garage/ADU and farm shed at 128 Monument Rd with conditions, and approved the pool and shed project at 317 S Orleans Rd with a contractor‑change condition. All public hearings were formally closed by unanimous motions.

Mon Aug 18, 2025

Affordable Housing Trust Fund Board

Affordable Housing Trust Board to review project updates and rental housing

The Affordable Housing Trust Board will discuss updates on several housing projects and the development of four rental units at 22 Old Tote Road. The board will also review funding availability criteria and the current trust balance.

affordable-housingrental-housingcommunity-developmenthousing-trust
✓ Decided: Board approved July 15 minutes and adjourned the meeting

The Affordable Housing Trust Fund Board approved the minutes from the July 15, 2025 meeting with a 5‑0 vote. The board then adjourned the August 18 meeting at 4:02 pm, also by a 5‑0 vote. No other motions were adopted.

Thu Aug 14, 2025

Architectural Review Committee

Architectural Review Committee to review two exterior renovation applications

The Orleans Architectural Review Committee will meet in person and remotely to review two exterior renovation applications. The committee will also approve meeting minutes from July 24, 2025, and discuss any matters arising during the meeting.

architectural-reviewrenovationszoningtown-hallpublic-meeting
✓ Decided: ARC approves multiple renovation projects for Academy and 41 Main Street

The ARC retroactively approved the prior restoration (siding, roof, fire escape, windows) at the Academy of Performing Arts, passing 3-1-0. The committee also approved the Academy’s roof shingle repair, vinyl siding replacement, and chimney removal, with a unanimous 4-0-0 vote. New windows and doors for 41 Main Street were approved unanimously (4-0-0). The July 24, 2025 minutes were approved (3-0-1) and the meeting was adjourned unanimously (4-0-0).

Thu Aug 14, 2025

Energy & Climate Action Committee

Energy committee reviews climate goals and liaison assignments

The Orleans Energy and Climate Action Committee will hear updates on climate impacts, the Orleans Climate Action Network, and a Buildings to Monitor report. Members will also review 2025 goal sheets and vote on July meeting minutes.

climate-actionenergy-committeegoalsliaisonspublic-meeting
✓ Decided: Andy O’Neill appointed ECAC representative for solar bid evaluation

The committee voted to appoint Andy O’Neill as the ECAC member for participation on the solar bid evaluation, with the motion carried after a vote in favor and O’Neill abstaining. The minutes of the July 10, 2025 meeting were approved, with one abstention. The meeting was then unanimously adjourned. No other substantive actions were decided.

Wed Aug 13, 2025

Historical Commission

Historical Commission to reorganize and set future goals

The Orleans Historical Commission will reorganize by electing officers and appointing a representative to the FY26 Community Preservation Committee. Members will discuss future commission goals and review updates to the Local Comprehensive Plan’s historic preservation section.

historical-preservationlocal-governmentcommission-reorganizationcommunity-preservationpublic-meeting
✓ Decided: Commission elects new Chair and Vice Chair, approves website funding

The Orleans Historical Commission elected Ed Marcarelli as Chair and Bill Wibel as Vice Chair, each vote passing 3‑aye, 0‑no, 1‑abstain. The commission also agreed to retain its external website and fund the associated bill using the CPC grant. The meeting was adjourned by a 5‑0‑0 vote.

Wed Aug 13, 2025

Transportation and Bikeways Advisory Committee

Transportation committee to discuss safety requests and walkable Main Street planning

The Orleans Transportation and Bikeways Advisory Committee will review several resident requests for safety improvements and signage. The committee will also receive a status report on the 'Envisioning A Walkable Main Street' planning project.

transportationbikewaysroad-safetypedestrian-planningsignage
✓ Decided: Committee approves July 9 minutes and adjourns meeting

The Transportation and Bikeways Advisory Committee approved the July 9 meeting minutes, with a unanimous vote and abstentions from three members. A motion to adjourn the August 13 meeting was also unanimously approved. No other formal decisions or votes were recorded; the committee discussed several future actions and agenda items.

Wed Aug 13, 2025

Select Board

Select Board to consider real property at 8 Cardinal Lane

The Select Board will meet to discuss the potential purchase, exchange, sale, lease, or value of real property at 8 Cardinal Lane. The board will also address town election worker appointments and a specific board policy section.

real-estateelectionspolicyschools
Wed Aug 13, 2025

Select Board

Select Board to review board policies

The Select Board will hold a workshop meeting to review and discuss specific sections of the Select Board Policies. The agenda focuses on Section B and potentially Section C.

governancepolicyadministration
Tue Aug 12, 2025

Board of Assessors

Board of Assessors to review vehicle and boat tax abatements

The Orleans Board of Assessors will meet on August 12, 2025, at 4:00 pm in the Assessors Office at 19 School Rd to discuss motor vehicle and boat tax abatements, review minutes, and sales reports. An executive session will follow to address real estate abatement applications confidentially.

taxesabatementsexecutive-sessionassessorsprocedural
✓ Decided: Board approved FY2026 Environmental Protection Fund Tax assessment of $182,938

The Board unanimously approved 19 motor‑vehicle tax abatements for 2025 totaling $2,101.68 and 3 abatements for 2024 totaling $732.66. It also unanimously signed off on FY2026 assessments for the Environmental Protection Fund Tax ($182,938) and the Barnstable County Tax ($170,629). Additionally, the Board approved the 2025 Motor Vehicle Commitment #4 covering 323 bills for $71,063.23 and approved the minutes from the July 8 sessions.

Tue Aug 12, 2025

Shellfish & Waterways Improvement Advisory Committee

Shellfish & Waterways Committee to discuss commercial striped bass fishery

The Shellfish and Waterways Improvement Advisory Committee will meet to elect officers and review previous minutes. The committee will also receive a report from Nate Sears and discuss updates regarding the commercial striped bass fishery.

shellfishwaterwayscommercial-fishingstriped-bass
✓ Decided: Committee elected new officers and unanimously adjourned the meeting

The Shellfish & Waterways Improvement Advisory Committee elected Kyle Von Iderstein as Recording Secretary, Bob as Vice President, and Craig Poosikian as Chair. All three accepted their positions. The board then voted unanimously to adjourn the meeting. No other formal actions were decided at this session.

Tue Aug 12, 2025

Conservation Commission

Conservation Commission to hear agricultural barn proposal at Putnam Farm

The Orleans Conservation Commission will hold an on-site meeting to review multiple land-use requests, including a public hearing for an agricultural barn at Putnam Farm. Several proposals involve work within protected buffer zones near coastal banks, salt marshes, and cranberry bogs.

conservationzoningcoastal-bankagriculturepublic-hearing
Thu Aug 7, 2025

Finance Committee

Orleans Finance Committee to reorganize and elect leadership

The Finance Committee will meet to vote for a Chair, Vice Chair, and Clerk. The body will also introduce new members and a new Select Board Liaison.

governmentfinance-committeeappointments
✓ Decided: Finance Committee appoints new chair, vice chair and clerk, and approves minutes

The committee approved the amended minutes from July 10, 2025 by an 8‑0 vote. It then appointed Elaine Baird as Chair, Nick Athanassiou as Vice Chair, and David Abel as Clerk, each confirmed by unanimous 8‑0 votes. No other substantive actions were taken.

Thu Aug 7, 2025

Community Preservation Committee

Community Preservation Committee to review FY25 close and FY26 launch

The committee will discuss the Comprehensive Plan update and the transition from the FY25 to FY26 budget cycle. Members will review grant highlights and invoicing procedures.

budgetgrantsplanningcommunity-preservation
✓ Decided: Committee elected new chair, vice chair and clerk unanimously

The Community Preservation Committee elected Ms. Francolini as Chair, Ms. Gaskill as Vice Chair, and Mr. Lipman as Clerk, each receiving an 8-0-0 vote. The committee also approved a $4,350 payment of dues to the Community Preservation Coalition with an 8-0-0 vote. Minutes from the June 5, 2025 meeting were approved, and the meeting was adjourned unanimously.

Wed Aug 6, 2025

Select Board

Select Board to vote on updated Comprehensive Emergency Management Plan

The Select Board will consider a vote to accept an updated Comprehensive Emergency Management Plan presented by Chief Deering and Intern Reagen Kerecz. The board will also discuss repairs for the Monument Road Civil War statue and a request for a Town Meeting Article from the Energy and Climate Action Committee.

emergency-managementpublic-worksclimateappointmentspublic-health
Wed Aug 6, 2025

Select Board

Select Board to review board policies

The Select Board will hold a workshop meeting to review and discuss Select Board Policies. The agenda specifies a focus on Section A and Section B if time permits.

governancepolicyadministration
Wed Aug 6, 2025

Zoning Board of Appeals

ZBA to hear special permit requests for building coverage and setbacks

The Zoning Board of Appeals will hold a public hearing to consider two special permit applications. Both cases involve requests to exceed building coverage limits on residential properties.

zoningspecial-permitsbuilding-coverageresidential
✓ Decided: Board approves special permit for 12 Deacons Way addition

The Zoning Board of Appeals approved the July 30, 2025 meeting minutes. It voted to continue Case #2025-09 to the August 20, 2025 meeting. It also approved a Special Permit for a 624‑sq‑ft addition at 12 Deacons Way. All three actions passed unanimously with a 5‑0 vote.

Wed Aug 6, 2025

Board of Water & Sewer Commissioners

Board to consider Phase 3 Lakes and Ponds sewer easements

The Board of Water & Sewer Commissioners will meet to discuss proposed easements for the Phase 3 Lakes and Ponds Area Sanitary Sewer and Pump Station Project. The board may vote to send these easements to a public hearing on August 20.

sewerinfrastructureeasementspublic-works
✓ Decided: Board approved sending Phase 3 easement proposal to public hearing

The Board voted unanimously to forward the proposed Phase 3 easements for the Lakes and Ponds Area Sewer Collection System to a public hearing on August 20, 2025. The motion passed 6‑0‑0. The meeting was then adjourned by a unanimous vote. Board membership updates were noted, with Tim Counihan becoming a full member and Lynn Bruneau an associate member.

Tue Aug 5, 2025

Conservation Commission

Conservation Commission to review residential additions and fish passage project

The Orleans Conservation Commission will review requests for determinations regarding residential construction and town investigatory work. The body will also consider continuations for home modifications and a certificate of compliance for completed site work.

conservationzoningenvironmentresidential-constructioninfrastructure
✓ Decided: Conservation Commission approved four projects and a compliance certificate

The commission unanimously approved the projects at 124 Hopkins Lane and 30 Hayward Lane, each with specific conditions, and issued a Certificate of Compliance for 8 Kescayogansett Road with a hand‑pulling invasive‑control condition. It also approved negative determinations for the projects at 118 Freeman Lane and 0 Herring Brook Way. All motions passed with a 7‑0‑0 vote.

Thu Jul 31, 2025

Energy & Climate Action Committee

Energy & Climate Action Committee to review Energy Navigator program

The Energy and Climate Action Committee will meet to receive an update on the Energy Navigator coaching program.

energyclimate-actioncoaching-program
Wed Jul 30, 2025

Select Board

Select Board to vote on Special Town Meeting for November 17, 2025

The Select Board will vote to call a Special Town Meeting and set the dates for the warrant opening and closing. The board will also review the Eldredge Park Renovation Plan and consider temporary licenses for local businesses.

town-meetinglicensingparksappointmentsgovernance
Wed Jul 30, 2025

Recreation Advisory Committee

Recreation Advisory Committee and Select Board to review Eldredge Park plan

The Recreation Advisory Committee and the Orleans Select Board are holding a joint meeting. The session focuses on the presentation and discussion of the Draft Eldredge Park Renovation Plan.

parksrecreationplanningeldredge-park
✓ Decided: Recreation Advisory Committee adjourned meeting unanimously

The committee discussed design elements, costs, and community benefits for the Eldredge Park project but made no formal approvals or policy changes. The only formal action was a motion to adjourn, which passed unanimously (7-0-0). No other decisions were recorded.

Wed Jul 30, 2025

Zoning Board of Appeals

ZBA to hear special permit requests for building coverage at two properties

The Zoning Board of Appeals will consider special permits for two properties seeking to exceed building coverage limits. The board will also discuss zoning bylaw changes and elect its officers.

zoningspecial-permitshousingland-use
✓ Decided: Board elected new chair, vice chair and secretary for next year

The Zoning Board approved the July 2 and July 16 meeting minutes (5‑0). It accepted the withdrawal of the Biggers special permit application without prejudice (4‑0) and postponed the Happy Clam case to August 20, 2025 (5‑0). The Board also elected Gerald Mulligan as chair, Austin Higgins as vice chair, and a secretary as clerk for the next calendar year (each 4‑0). No zoning bylaw changes were decided.

Tue Jul 29, 2025

Veterans Committee

Veterans Committee to discuss Vietnam and Indigenous memorials

The Veterans Committee will discuss design ideas for a Vietnam memorial and an Indigenous marker. The body will also review updates on construction and the refurbishment of a Coast Guard Bell.

veterans-affairsmemorialspublic-arttown-administration
Tue Jul 29, 2025

Marine & Fresh Water Quality Committee

Marine & Fresh Water Quality Committee to discuss pond management and water monitoring

The committee will review water quality monitoring for freshwater lakes, ponds, Pleasant Bay, and Nauset Estuary. Members will discuss the Cedar Pond Management Monitoring Program final report and next steps for the Baker Pond Management Plan.

water-qualityenvironmentpondsmonitoring
✓ Decided: Committee elected new Vice Chair and confirmed leadership through 2025

The committee voted unanimously to nominate Carolyn Auty as Vice Chair. They also voted unanimously to keep Richard Levy as Chair and Bob as Clerk through calendar year 2025. The June 23, 2025 meeting minutes were approved by a 5‑0‑1 vote, with Ed Hafner abstaining.

Thu Jul 24, 2025

Architectural Review Committee

Architectural Review Committee to review 6 Rte 6A application

The Architectural Review Committee will meet to consider a scheduled application for a property at 6 Rte 6A. The committee will also review meeting minutes from July 10, 2025.

architectural-reviewbuilding-permitszoning
✓ Decided: ARC approves skylight replacement at 6 Route 6A and keeps policy unchanged

The committee approved Gibson Realty's application to replace skylights and reroof 6 Route 6A. A motion to leave the ARC application policy unchanged was also carried. The minutes from July 10, 2025 were approved, and the committee agreed that a building permit should not be issued without ARC review. The meeting was then adjourned.

Wed Jul 23, 2025

Housing Authority

Orleans Housing Authority to award oil tank replacement contract

The Orleans Housing Authority will meet to review financial and director reports and appoint officers. The body will consider awarding a contract for oil tank replacement and approve completion certificates for project 224076.

housingcontractsmaintenanceappointments
Wed Jul 23, 2025

Select Board

Select Board to review FY26 goals and Rock Harbor Wharf status

The Select Board will receive an update on the status of Rock Harbor Wharf. The board will also hold a workshop to review its goals for fiscal year 2026.

town-managementharborplanning
Wed Jul 23, 2025

Council on Aging

Orleans Council on Aging to hold annual reorganization and elect FY26 officers

The Council on Aging Board will conduct its annual reorganization, including the election of officers for FY26. The board will also discuss goals and priorities for the upcoming fiscal year.

senior-servicesboard-governancebudgetit-infrastructure
✓ Decided: COA Board voted to move meetings to Town Hall for public remote participation

The board elected Denise Dunlap as Chair and Mark Kaminsky as Vice Chair by a unanimous 4‑0‑0 vote. A motion to approve the June 25 minutes failed after a quorum question was raised. The board approved moving future meetings to Town Hall to allow remote public participation, also by a 4‑0‑0 vote. The meeting was adjourned with a 4‑0‑0 vote.

Tue Jul 22, 2025

Cultural District Committee

Cultural District Committee to discuss FY 26 Budget

The Cultural District Committee will meet to review the FY 26 Budget and the Treasurer's report. The body will also seek volunteers for upcoming local events.

budgetculturecommunity-eventsvolunteers
✓ Decided: Committee unanimously approved June minutes and adjourned

The Cultural District Committee accepted the June 2025 minutes with a unanimous vote. The meeting was then adjourned by unanimous approval. No other motions were recorded as decided during this session.

Tue Jul 22, 2025

Conservation Commission

Conservation Commission to discuss barn location at Putnam Farm

The Conservation Commission is holding an on-site meeting to discuss a proposed location for a barn at Putnam Farm. The meeting includes discussions with stakeholders and members of the public.

conservationland-useputnam-farm
Thu Jul 17, 2025

Board of Health

Board of Health to hold sewer connection hearings and variance requests

The Board of Health will conduct show cause hearings for properties ordered to connect to the municipal sewer. The board will also review variance requests and discuss tobacco and nicotine product regulations.

sewerpublic-healthzoning-variancestobacco-regulationfood-service
✓ Decided: Board extended sewer hearings, approved food permits and several septic variances

The Orleans Board of Health granted an indefinite stay on the sewer hookup requirement for 15 Cottage Street and extended show‑cause hearings for multiple properties to August 21 or September 18, 2025. It approved the Sharkcuterie food‑services establishment retroactively and authorized temporary food permits for First Friday events with an allergen‑warning condition. The board also approved a septic‑system upgrade at 7 Little Cove Road and a setback variance for the septic system at 1 Namskaket Road.

Wed Jul 16, 2025

Zoning Board of Appeals

ZBA to review apartment and commercial project at 17 Nells Way

The Zoning Board of Appeals will hold public hearings regarding special permits and variances for residential and commercial properties. The board is reviewing requests for building coverage limits and land use amendments.

zoninghousingcommercial-developmentliquor-licensespecial-permits
✓ Decided: Zoning Board approved Orleans Plaza special permit and other motions

The board unanimously approved a special permit amendment for Orleans Plaza, LLC to construct 29 apartments and 12,000 sq ft of commercial space, contingent on meeting all Site Plan Review requirements. The board also approved the withdrawal without prejudice of a liquor‑license variance petition filed by Michelle Lamy. Additionally, the board approved a special hearing scheduled for July 30, 2025.

Wed Jul 16, 2025

Board of Water & Sewer Commissioners

Board of Water & Sewer Commissioners to meet July 16

The Board of Water & Sewer Commissioners will meet to reorganize the board and review department reports. The meeting includes updates on wastewater infrastructure and water rates.

water-ratessewerinfrastructuredrought
✓ Decided: Virginia Farber elected Chair and Robert Rich elected Vice Chair

The Board unanimously approved Virginia Farber as Chair and Robert Rich as Vice Chair. It also approved the June 25, 2025 meeting minutes, and committed June sewer receivables of $83,667.10 and water receivables of $8,947.00. The meeting was adjourned by a unanimous vote.

Tue Jul 15, 2025

Affordable Housing Trust Fund Board

Affordable Housing Trust Board to review project updates and 22 Old Tote Road

The Affordable Housing Trust Board will discuss updates for several housing projects and the purchase and sale agreement for 22 Old Tote Road. The board will also receive reports on the current trust balance and the rental assistance program.

affordable-housingreal-estatezoningcommunity-development
✓ Decided: Board approved June 17 minutes and adjourned the meeting

The Affordable Housing Trust Board voted to approve the minutes from the June 17, 2025 meeting with a 5‑0‑2 vote. The board then adjourned the July 15 meeting unanimously (7‑0‑0). No other substantive actions were decided.

Tue Jul 15, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to vote on artist presentations

The Marion Craine Gallery Exhibition Committee will review presentations from two artists and discuss gallery operations. The board will also vote on the use of wall stickers for art displays and exhibit confirmation forms.

artslibrarygallerypublic-exhibits
✓ Decided: Board approved December exhibit, new label process, and eliminated form

The board approved the minutes from the June 17 meeting. It approved artist Doug Fraser’s exhibit scheduled for December 2. It adopted a new removable label process for art displays. It voted to eliminate the exhibit confirmation form. All motions passed unanimously.

Tue Jul 15, 2025

Fourth of July Committee

Orleans 4th of July Parade Committee to hold 2025 debrief

The committee will meet to discuss the 2025 parade and review open positions. The meeting is scheduled for July 15, 2025.

community-eventsparadevolunteers
Tue Jul 15, 2025

Conservation Commission

Conservation Commission to review residential projects and ACEC guidance

The Conservation Commission will consider project applications for properties on Hopkins Ln and Hayward Ln. The body will also discuss project review guidance for the ACEC and assign Conservation Property Stewards.

conservationzoningwetlandsland-managementacec
✓ Decided: Commission voted to continue the public hearing to Aug 5, 2025

The Conservation Commission approved a motion to continue the public hearing to August 5, 2025, with a unanimous 6‑0‑0 vote. Later the same day, a motion to adjourn the public hearing also passed unanimously (6‑0‑0). The meeting was adjourned at 9:43 a.m.

Thu Jul 10, 2025

Finance Committee

Finance Committee to discuss year-end transfers

The Finance Committee will meet to review and potentially approve year-end transfers. The meeting also includes a review of the meeting schedule and liaison reports.

financebudgettown-administration
✓ Decided: Finance Committee approved two year‑end transfers totaling $4,350.61

The Orleans Finance Committee unanimously approved the minutes from the June 26 meeting. It also approved two year‑end transfers: $3,988.02 for Veterans’ Benefits and $362.59 for the Zoning Board of Appeals, each passing with a 7‑0‑0 vote.

Thu Jul 10, 2025

Architectural Review Committee

Architectural Review Committee to review access ramp at 31 Main Street

The Architectural Review Committee will meet to review a scheduled application and approve previous meeting minutes.

architectural-reviewaccessibilitymain-street
✓ Decided: ARC approves access ramp for 31 Main Street

The Architectural Review Committee approved the application for an access ramp at 31 Main Street, urging the applicant to consider an alternative door that matches the historic façade. The motion passed unanimously with a 5-0-0 vote. The committee also approved the minutes from the June 26, 2025 meeting and adjourned the session.

Thu Jul 10, 2025

Energy & Climate Action Committee

Committee to vote on Specialized Energy Code recommendation for fall town meeting

The Energy and Climate Action Committee will meet to discuss climate change impacts and the Orleans Climate Action Network. The body will vote on recommending a Specialized Energy Code/Warrant Article for the fall town meeting and review 2025 goal sheets.

climate-actionenergy-codetown-meetingenvironmental-policy
✓ Decided: ECAC unanimously recommended a warrant article to adopt the Specialized Energy Code

The committee voted unanimously to submit an amended letter to the Select Board recommending a warrant article for adopting the Specialized Energy Code, with an effective date of July 1, 2026. The minutes from the June 10, 2025 meeting were also approved unanimously. The committee appointed David Jacobson as Orleans’ representative to the Cape Light Compact and as liaison to the New Fire Station Advisory Committee. The meeting was adjourned unanimously.

Wed Jul 9, 2025

Historical Commission

Orleans Historical Commission to elect officers and discuss future goals

The Orleans Historical Commission will meet to elect its officers and discuss the direction and goals of the commission. The meeting includes a report from the sub-committee on public education.

historical-commissiontown-governancepublic-education
✓ Decided: Commission elected Francis Mustaro as Acting Chair

The Orleans Historical Commission met on July 9, 2025. Members elected Francis Mustaro as Acting Chair by a unanimous 5‑0 vote. The meeting was adjourned at 5:10 p.m. by a 3‑0 vote. No other substantive actions were taken.

Wed Jul 9, 2025

Select Board

Select Board to vote on FY25 year-end budget transfers

The Select Board will vote on FY25 year-end budget transfers and the appointment of two police student officers. The board will also consider the value of real property at 8 Cardinal Lane in executive session.

budgetreal-estatepoliceappointmentswastewater
Wed Jul 9, 2025

Transportation and Bikeways Advisory Committee

Committee discusses road safety and Main Street planning

The Transportation and Bikeways Advisory Committee will discuss safety recommendations for several town roads. The body is also planning an August community meeting focused on Main Street conditions and field survey questions.

transportationbikewaysroad-safetycrosswalksplanning
✓ Decided: Peter Ryder appointed chair of Transportation and Bikeways Committee

The committee approved the June 11 minutes unanimously. It deferred the crosswalk policy to the August meeting. Leadership was reorganized: Peter Ryder will become chair beginning in September and Scott MacDonald will chair the August meeting. The meeting was then adjourned unanimously.

Tue Jul 8, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee to discuss restrictions on Family Permit Areas

The Shellfish and Waterways Improvement Advisory Committee will meet to discuss whether Family Permit Areas should remain restricted to commercial permit holders. The meeting also includes a report from the Natural Resources Manager, Harbormaster, and Shellfish Constable.

shellfishingwaterwayspermitsenvironment
✓ Decided: Committee unanimously adjourned and set next steps for bulkhead bid

The committee made and seconded a motion to change “hell” to “he’ll” in the June minutes, though no vote result was recorded. Nate Sears agreed to consult counsel about possible violations of family permit area regulations. The group planned to issue a bid for the Goose Hummock Bulkhead within a week. The meeting was adjourned by a unanimous vote.

Tue Jul 8, 2025

Board of Assessors

Board of Assessors to review motor vehicle and boat abatement reports

The Board of Assessors will meet to review monthly sales and abatement reports for motor vehicles and boats. The board will also enter an executive session to discuss real estate abatement applications and Chapter 61 applications.

assessorstax-abatementsreal-estatemotor-vehicles
✓ Decided: Board approved 21 motor vehicle tax abatements totaling $3,555.35

The Board unanimously approved 21 motor vehicle excise tax abatements totaling $3,555.35. It also unanimously approved the minutes from the June 10, 2025 meeting. A motion to enter executive session to discuss exemption and abatement applications was made, seconded, and approved unanimously (3‑0).

Tue Jul 8, 2025

Conservation Commission

Conservation Commission to review dwelling modifications at 30 Hayward Ln

The Conservation Commission is holding an on-site meeting to continue the Notice of Intent process for a residential project. The body will review proposed changes to a dwelling and the addition of a deck.

conservationresidential-developmentcoastal-zonepleasant-bay
Wed Jul 2, 2025

Zoning Board of Appeals

ZBA to hear special permit requests for residential projects on Hayward Lane and Countryside Drive

The Zoning Board of Appeals will review two special permit applications for residential construction. Both requests involve projects that would result in total site coverage exceeding 4,000 square feet.

zoningspecial-permitsresidential-constructionland-use
✓ Decided: Board granted a continuation for the 62 Countryside Drive special permit request

The Zoning Board of Appeals approved the minutes from the April, May, and June 2025 meetings by a 5‑0 vote. It granted a continuation for the Happy Clam LLC special permit at 14 Hayward Lane to July 16, 2025 by a 3‑0 vote. It also granted a continuation for the Beard family special permit at 62 Countryside Drive to August 6, 2025 by a 4‑0 vote.

Tue Jul 1, 2025

Snow Library Board of Trustees

Snow Library Board of Trustees to meet July 1

The Snow Library Board of Trustees will meet to review reports from the Chair, Library Director, and Friends Representative. The board will also consider a vote to approve the minutes from the June 4, 2025 meeting.

libraryboard-of-trusteesorleans
✓ Decided: Board awarded carpet replacement contract to Capital Carpet and Flooring Specialists

The trustees approved the June 4 minutes (4‑0) and awarded a contract to Capital Carpet and Flooring Specialists, Inc. to replace carpet in several library areas within 90 days of June 30, 2025. New policies and forms were posted on the library website, and the four desktop computers in the Children’s area were removed while a Chromebook replacement is pending.

Tue Jul 1, 2025

Conservation Commission

Conservation Commission to vote on sticker parking at Kents Point

The Conservation Commission will review several residential project applications involving wetlands and coastal areas. The body will also discuss and vote on updating the Land Management Plan to implement sticker parking at Kents Point.

conservationzoningparkingwetlandscoastal-management
✓ Decided: Commission directs working group to amend Kents Point LMP for sticker parking

The Conservation Commission voted unanimously to direct the working group to change the Kents Point Local Master Plan to implement sticker parking. The commission also approved the meeting minutes and elected Drusy Henson as commission chair, both by unanimous vote. Nominations for the chair position were opened during the meeting.

Mon Jun 30, 2025

Select Board

Select Board to review FY26 liaison assignments and policy

The Select Board will hold a workshop meeting to review the Select Board Liaison Program policy. The board will also review liaison assignments for fiscal year 2026.

government-administrationpolicy-reviewtown-management
Thu Jun 26, 2025

Finance Committee

Finance Committee to review year-end transfer requests

The Finance Committee will meet to review and approve year-end transfer requests. The body will also meet with Gail Briere and OES committee members regarding the Elementary School.

financeelementary-schoolfire-rescuebudget
✓ Decided: Finance Committee approved $17,605 police reserve fund transfer

The committee unanimously approved the minutes from the May 22 meeting. It then approved a $17,605 reserve‑fund transfer for a new police biometric and license‑plate reader, and also approved the year‑end transfer requests listed in the June 25 letter. The meeting was adjourned after an 8‑0‑0 vote.

Thu Jun 26, 2025

Architectural Review Committee

Architectural Review Committee to review new signs for Grady Consulting LLC

The Architectural Review Committee will meet to consider a request for new business signs. The committee will also review meeting minutes from June 12, 2025.

signagebusinessarchitectural-review
✓ Decided: ARC approved Grady Consulting sign and kept current leadership

The Architectural Review Committee approved the sign application for Grady Consulting LLC at 56 Main Street with a 4-0 vote. The committee also voted to keep Stephen Salley as Chair and Tom Coleman as Vice Chair, again 4-0. Minutes from the June 12 meeting were approved unanimously.

Thu Jun 26, 2025

Human Services Advisory Committee

Human Services Advisory Committee to review funding applications

The committee will discuss the use of unspent FY 26 funds and review a funding application from Big Brothers Big Sisters of Cape Cod & The Islands. Members will also review the FY27 funding application and the committee's charge for an upcoming Select Board meeting.

human-servicesfundinggrantsbudget
✓ Decided: HSAC approved $2,000 BB&BS grant and FY 2027 application form

The committee unanimously approved the June 12, 2025 minutes, the $2,000 grant to Big Brothers and Big Sisters, and the revised FY 2027 grant application form. It also unanimously accepted the schedule to post the application information on September 8 and begin reviews on October 1, with submissions due by October 31. The meeting was adjourned unanimously at 11:55 AM.

Wed Jun 25, 2025

Council on Aging

Orleans Council on Aging to discuss purchase of new vehicle

The Council on Aging Board will review the May 2025 budget summary and a budget transfer request for FY25. Members will discuss the purchase of a new COA vehicle and the Dementia Friendly Designation. The board will also receive updates on a Title III grant for tech support and a telephone replacement project.

seniorsbudgettransportationgrantspublic-health
Wed Jun 25, 2025

Select Board

Select Board to consider FY25 year-end budget transfers

The Select Board will meet to discuss and potentially vote on FY25 year-end budget transfers. The board is also conducting interviews for at-large members of the Fire-Rescue Station Building Committee and reviewing various town policies.

budgetappointmentspublic-safetytown-policyadministration
Wed Jun 25, 2025

Open Space Committee

Orleans Open Space Committee meets June 25 to review priority parcels and reappointments

The Orleans Open Space Committee will convene on June 25 at 9:00 AM in the Skaket Room at Town Hall to conduct routine business including public comment, committee reappointments, and an update on priority parcels. The meeting will also include a report from the Conservation Commission and approval of May’s minutes.

open-spaceconservationtown-committeepublic-meetingprocedural
✓ Decided: Committee approved drafting a letter to the Select Board requesting reconsideration

The Open Space Committee voted to draft a letter to the Select Board asking that the recent decision not to renew two members’ terms be reconsidered, and assigned Stephanie Gaskill to write the letter. The committee also approved the minutes from the May 21, 2025 meeting. A motion to adjourn the meeting was approved.

Wed Jun 25, 2025

Board of Water & Sewer Commissioners

Board of Water & Sewer Commissioners to hold public hearing on SURR changes

The Board will hold a public hearing regarding proposed changes to the SURR. The meeting includes reviews of sewer connection requests and updates on wastewater infrastructure and drought conditions.

sewerwaterpublic-hearinginfrastructurezoning
✓ Decided: Board approved amendments to sewer use rules and regulations

The Board entered an executive session and then approved a series of amendments to the sewer use rules and regulations, including date changes and revisions to privilege fee provisions. It also committed $65,995.20 in sewer receivables and $4,758.00 in water receivables for May 2025. All votes were unanimous (7‑0‑0).

Tue Jun 24, 2025

Cultural District Committee

Cultural District Committee to discuss fund distribution and FY 26 contracts

The committee is meeting to determine how to distribute remaining funds and review contracts for the 2026 fiscal year. Discussions will include marketing, social media, and sign design.

cultural-districtmarketingbudgetcontracts
✓ Decided: Committee approved FY 2026 marketing and social‑media contracts

The Cultural District Committee approved the minutes from May 27, 2025 and the Treasurer’s Report unanimously. It authorized $700 for First Fridays music, accepted a Chronicle advertisement, and assigned staff to set up a MailChimp outreach template. The committee also approved FY 2026 contracts with Ally for website and marketing work and with Candace for twice‑weekly social‑media postings. Additional items such as continuing the Fall Pop‑Ups series and a new “found art” contest were discussed but not formally decided.

Tue Jun 24, 2025

Conservation Commission

Conservation Commission reviews two residential project proposals

The Conservation Commission is holding an on-site meeting to review two Notices of Intent. The body will consider proposed work involving wetlands and coastal areas.

conservationwetlandscoastal-managementresidential-construction
Mon Jun 23, 2025

Veterans Committee

Veterans Committee to vote on Vietnam memorial location

The Veterans Committee will discuss and vote on a designated area for a Vietnam memorial. The body will also review updates on the refurbishment of a Coast Guard Bell and a Civil War soldier monument.

veterans-affairsmemorialspublic-artcommittee-governance
Mon Jun 23, 2025

Marine & Fresh Water Quality Committee

Orleans committee to discuss water quality monitoring and pond management

The Marine & Fresh Water Quality Committee will discuss water quality monitoring for 2025 lakes, ponds, and estuaries. The body will also review reports on Cedar Pond and next steps for the Baker Pond Management Plan.

water-qualityenvironmental-monitoringponds-and-lakeswastewater-management
✓ Decided: Bob reappointed to WMAC; minutes approved; Cedar Pond report tabled

The committee voted 4‑0‑0 to reappoint Bob as the Marine & Fresh Water Quality Committee representative to the Wastewater Management Advisory Committee. The same vote approved the revised May 27, 2025 meeting minutes. The Cedar Pond Management Monitoring Program annual technical report was postponed (tabled) for discussion at the next meeting.

Wed Jun 18, 2025

Select Board

Orleans Select Board to hold hearings on water rates and utility pole installation

The Select Board will conduct public hearings regarding a proposed FY26 water rate increase and utility pole installations on Ruggles Road. The board will also vote on intermunicipal agreements for the Adult Supportive Day Program and ARPA fund allocations.

utilitieswater-ratesbudgetlicensingreal-estate
Wed Jun 18, 2025

Zoning Board of Appeals

Zoning Board to review special permit for accessory structure at 14 Hayward Lane

The Zoning Board of Appeals will hold a public hearing to consider a special permit application. The board will also review meeting minutes from April and May 2025.

zoningspecial-permithousingland-use
Tue Jun 17, 2025

Affordable Housing Trust Fund Board

Board to consider funding and expansion of Rental Assistance Program

The Affordable Housing Trust Board will discuss project updates and rental housing opportunities. The board may vote on funding for the third year of the Rental Assistance Program and its expansion beyond 10 participants.

affordable-housingrental-assistancehousing-developmentgrants
✓ Decided: Board approved $50,000 expansion of Rental Assistance Program

The Affordable Housing Trust Board voted unanimously to allocate up to $50,000 to expand the Rental Assistance Program for additional households. It also approved the Request for Proposals for 22 Old Tote Road, appointed Ms. Mathison as Chair and Mr. Jurkowski as Vice Chair, and authorized a $7,000 payment to HAC for annual monitoring. The board approved the May 19 minutes and adjourned the meeting.

Tue Jun 17, 2025

Fourth of July Committee

Fourth of July Committee reviews 2025 timeline, parade, and budget

The committee is meeting to review the 2025 timeline and parade plans. Members will also review the 2025 budget and approve necessary purchases.

fourth-of-julybudgetparadeplanning
Tue Jun 17, 2025

Snow Library Board of Trustees

Snow Library Marion Craine Gallery Committee to review exhibit schedule

The Marion Craine Gallery Committee will meet to review the gallery schedule and receive financial and director reports. The board will also vote on the approval of minutes from the May 20, 2025 meeting.

libraryartsgalleryorleans
✓ Decided: Board unanimously approved May minutes and adjourned the meeting

The committee approved the May 2025 meeting minutes with a 4‑0 vote. A motion to adjourn was also passed unanimously (4‑0). The board announced a carpet replacement project in the gallery slated for July to September and noted the departure of a part‑time employee.

Tue Jun 17, 2025

Conservation Commission

Conservation Commission to review dock, bulkhead, and driveway projects

The Orleans Conservation Commission will review requests for determinations and continuations regarding residential property modifications. The body will also discuss a proposed policy recommendation for Kents Point access.

conservationzoningwetlandscoastal-managementenvironment
✓ Decided: Conservation Commission unanimously approved eight actions, including several project permits

The Orleans Conservation Commission voted unanimously on multiple items. It approved the dock repair at 36 Crystal Lake Drive with a negative determination and a width condition, approved projects at 22 Indian Fort Hill Rd, 19 Whippoorwill Ln, and 12 Deacon’s Wy with special conditions, continued the hearing for the 27 Cheney Rd bulkhead project to July 1, and approved a Certificate of Compliance for 45 Nichols Rd. The commission also approved the meeting minutes and adjourned the hearing.

Thu Jun 12, 2025

Architectural Review Committee

Committee to review signage for two new businesses

The Architectural Review Committee will meet to discuss new business and signage requests. The body will also review meeting minutes from May 8 and May 22, 2025.

signagebusinessarchitectural-review
✓ Decided: ARC approved new signage for Christie’s Atlantic Brokerage and Cape Cod Charcuterie

The Architectural Review Committee approved sign applications for Christie’s Atlantic Brokerage and Cape Cod Charcuterie, each with unanimous support. The committee also approved the minutes from the May 8 and May 22 meetings, with some members abstaining. A consensus was reached to deny any new signs whose lighting does not meet the lighting bylaw. The meeting was adjourned at 7:20 p.m.

Thu Jun 12, 2025

Board of Health

Board of Health to vote on Opioid Abatement Recovery Coach Program

The Board of Health will discuss and vote on a proposed Recovery Coach Program funded by the Opioid Abatement Fund. The meeting includes show cause hearings for properties ordered to connect to the municipal sewer and various business approval requests.

public-healthseweropioid-abatementbusiness-permitszoning-variances
✓ Decided: Board allocates $34,424 to opioid recovery coach program

The Orleans Board of Health voted 4‑0‑0 to allocate $34,424 from the opioid settlement to a Recovery Coach program. It also approved a 1.7‑foot variance for the pool fence at 106 Beach Road (3‑0‑0) and a waiver for 27 Long View Drive pending additional details (4‑0‑0). Additional approvals included a nomination to the Wastewater Advisory Committee, seating and setback changes for Cooke’s Seafood, and relief for two mobile food units.

Thu Jun 12, 2025

Energy & Climate Action Committee

Energy & Climate Action Committee to reorganize leadership and review 2025 goals

The committee will meet to reorganize its Chair, Vice-Chair, and Secretary positions. Members will discuss representation on the Fire Station Design/Building Committee and review 2025 goal sheets.

climate-actionenergy-codecommittee-governancepublic-works
✓ Decided: Committee unanimously approved co‑sponsorship of the Energy Navigator Coaching Program

The Energy and Climate Action Committee voted unanimously to become a co‑sponsor and co‑brand of the Energy Navigator Coaching Program being developed with Cape Light Compact, the Orleans Climate Action Network, and the Eastham committee. The committee also approved a unanimous recommendation that it be represented on the Fire‑Rescue Building Committee, naming David Jacobson as the representative. Officers for the next fiscal year were elected (John Londa chair, Hakim Janah vice‑chair, Andrew O’Neill clerk) and the minutes from the May 8 meeting were approved. The meeting was adjourned unanimously.

Thu Jun 12, 2025

Human Services Advisory Committee

Human Services Advisory Committee to review FY 2027 funding application

The committee will discuss the distribution and review process for FY 2027 funding applications. Members will also address FY26 and FY27 budgets and the allocation of any unspent funds.

budgethuman-servicesfundinggrants
✓ Decided: Committee appointed new leadership slate unanimously

The Human Services Advisory Committee approved its leadership slate for the next year, naming Susan as Chair, Fran K. as Vice Chair, and Barb as Clerk. The motion was moved by Barb, seconded by Fran M, and passed unanimously. The meeting was then adjourned by a unanimous motion.

Wed Jun 11, 2025

Historical Commission

Historical Commission to hold hearing on demolition at 124 Hopkins Lane

The Orleans Historical Commission will hold a public hearing regarding a notice of intent to demolish a significant building. The commission will also elect officers for the fiscal year starting July 1.

historic-preservationdemolitionpublic-hearinggovernment-administration
✓ Decided: Commission voted 5-0 to allow demolition at 124 Hopkins Lane

The Historical Commission approved the demolition of portions of the building at 124 Hopkins Lane by a 5‑0‑0 vote. Members also nominated Charles Ellis as the CPC Liaison, which passed 4‑0‑1 with Ellis abstaining. The minutes from the May 14 meeting were approved 5‑0‑0, and the commission adjourned at 4:51 p.m. by a unanimous 5‑0 vote.

Wed Jun 11, 2025

Recreation Advisory Committee

Recreation Advisory Committee to receive Eldredge Park project update

The Recreation Advisory Committee will meet to receive a report on the Eldredge Park project. The committee will also nominate and elect officers for the 2025-26 term.

recreationparkscommittee-governance
✓ Decided: Committee approves minutes and elects new officers

The Recreation Advisory Committee approved the May 2025 meeting minutes. The committee elected Jamie Balliett as chair, Shannon Heth as vice‑chair, and Tracy Murphy as clerk, each with unanimous votes. The meeting was then adjourned.

Wed Jun 11, 2025

Transportation and Bikeways Advisory Committee

Committee reviews Main Street graphics and crosswalk proposals

The Transportation and Bikeways Advisory Committee will review reports on Main Street graphics, sewer project data, and road use data. The body will also plan for an August community meeting and a focus for the October Town Meeting.

transportationbikewaysmain-streetcrosswalksinfrastructure
✓ Decided: Committee scheduled a public meeting on Main Street for Aug. 18

The committee approved the minutes from its April 9, April 28 and May 14 meetings. It agreed to seek Town Meeting funding again for a Main Street field study and to hold an open community meeting on Main Street on Aug. 18 at 4 p.m. A planning sub‑committee meeting was set for July 17, and members were tasked with contacting the Cape Cod Commission and circulating a Harwich crosswalk policy.

Tue Jun 10, 2025

Economic Development Committee

Economic Development Committee to discuss local impact grant and action plan

The Economic Development Committee will review updates from the Planning Department and the Wastewater Management Advisory Committee. The body will discuss a pilot program for the Orleans Local Impact Grant and a Summer and Fall Action Plan.

economic-developmentgrantssewerplanning
✓ Decided: Orleans launches Local Impact Grant pilot to support businesses

The committee approved the May 13, 2025 minutes (4‑0‑0) and re‑elected the current officers for FY26 (6‑0‑0). It announced the Orleans Local Impact Grant pilot program, set to launch the week of June 16. The committee also suspended July and August meetings and will draft a letter to the Select Board and Water Sewer Commission about sewer project costs.

Tue Jun 10, 2025

Board of Assessors

Board of Assessors to review motor vehicle and boat abatement reports

The Board of Assessors will meet to review monthly sales and abatement reports for motor vehicles and boats. The board will also enter an executive session to discuss real estate abatement applications.

assessorstax-abatementsreal-estatemotor-vehicles
✓ Decided: Board approved $125,769.39 motor vehicle tax commitment

The Board approved several tax abatements and a $125,769.39 motor vehicle tax commitment, and approved the prior meeting’s minutes. In executive session, the Board denied a real‑estate abatement application for 24 Old Timers Ln because it was filed late. All votes were unanimous.

Tue Jun 10, 2025

Housing Authority

Orleans Housing Authority to award Main Street egress stair replacement contract

The Orleans Housing Authority will meet to discuss an executive director search and approve updated income limits for admission. The board will also review a heating system for 15 Oak Ridge Lane and a bad debt write-off.

housingcontractsmaintenanceincome-limitsadministration
Tue Jun 10, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee to discuss aquaculture grant transfers

The Shellfish and Waterways Improvement Advisory Committee will meet to discuss the transfer of aquaculture grants. The meeting includes reports on 'Celebrate Our Waters' and updates from the Natural Resources Manager, Harbormaster, and Shellfish Constable.

aquaculturewaterwaysshellfishnatural-resourcesgrants
✓ Decided: Committee approves memorial bench for Pilgrim Lake and appoints new assistant constable

The Shellfish & Waterways Improvement Advisory Committee approved a memorial bench to be installed at Pilgrim Lake, with the motion passing unanimously. Nick Sanders was named the new assistant shellfish constable, succeeding Stephanie Sykes. The meeting was then adjourned unanimously.

Tue Jun 10, 2025

Conservation Commission

Conservation Commission to review dock and phragmites projects

The Conservation Commission is holding an on-site meeting to review two requests for determination. The body will evaluate proposed maintenance and management work within protected areas.

conservationenvironmental-permitsdockswetlands
Mon Jun 9, 2025

Orleans School Committee

Orleans School Committee to review EFY25 expenditure report

The Orleans School Committee will meet to discuss the NRHS Building Project and review the EFY25 expenditure report. The body will also consider the approval of gifts and grants.

educationbudgetschool-constructiongrants
✓ Decided: Committee elects new Chair and Vice‑Chair

The Orleans School Committee voted unanimously to appoint Sassandra Roche as Chair and Gail Briere as Vice‑Chair. Amanda Lapierre was named Secretary. Additional role assignments were made, including Ginger Marks as Warrant Authorizer and various policy and program responsibilities for each member.

Thu Jun 5, 2025

Community Preservation Committee

Community Preservation Committee to manage fiscal year transition

The committee will discuss the transition to fiscal year 2026 and notify new grant recipients. The meeting includes a debrief of town meeting warrant articles and a review of past grant giving.

grantsbudgettown-planningadministration
✓ Decided: Committee approved March 6 minutes and adjourned the meeting

The Community Preservation Committee voted to approve the minutes from the March 6, 2025 meeting. The motion passed with seven votes in favor and one abstention. The committee then moved to adjourn the meeting at approximately 5:45 p.m., which also passed with the same vote tally.

Wed Jun 4, 2025

Select Board

Select Board to vote on Town Manager, Police Chief, and Fire Chief contracts

The Select Board will vote on employment contracts for the Town Manager, Police Chief, and Fire Chief. The board is also considering 2025 ambulance rates and a utility easement for Eversource. Other business includes reviewing an Accessory Dwelling Unit Incentive Program and annual board reappointments.

contractspublic-safetybudgetzoninglicensingutilities
Wed Jun 4, 2025

Zoning Board of Appeals

ZBA to consider special permit for building coverage at 17 Sparrowhawk Rd

The Zoning Board of Appeals will hold a public hearing to discuss a special permit request for a residential project. The board will also review previous meeting minutes and decisions for two cases.

zoningspecial-permithousingbuilding-coverage
✓ Decided: Board approved continuation of Biggers special permit hearing to July 16

The Zoning Board of Appeals unanimously approved the language in the decision for Case #2025-05/Perseverance Coast, LLC. The board also unanimously approved a continuation of the special permit hearing for Rolf and Laurie Biggers (Case #2025-07) to July 16, 2025.

Wed Jun 4, 2025

Snow Library Board of Trustees

Snow Library Board of Trustees to hold organizational meeting and elect officers

The Board of Trustees will meet to elect a Chair, Vice Chair, Treasurer, and Corresponding Secretary. Members will discuss changes to the Capital Improvements Plan and new library communications efforts.

libraryelectionscapital-improvementsfundingarts
✓ Decided: Board pauses membership in Philanthropy Partners for a year

The trustees approved the May 6 minutes unanimously (6-0). They elected Jamie Balliett as chair, Mark Ziomek as vice chair, Bill Powers as treasurer, and Lindsey Goodman as secretary, each with a 6-0 vote. The board voted to pause membership in Philanthropy Partners Cape Cod and the Islands for one year. The meeting was adjourned unanimously (6-0).

Tue Jun 3, 2025

Fourth of July Committee

Orleans 4th of July Parade Committee to review 2025 timeline and budget

The committee will review the 2025 parade timeline and budget. Members will discuss and approve purchases for candy, supplies, and decorations.

public-eventsbudgetparadecommunity-celebration
Tue Jun 3, 2025

Conservation Commission

Conservation Commission to review residential construction and environmental permits

The Conservation Commission will review notices of intent and revised plans for residential projects affecting coastal banks and wetlands. The body will also consider certificates of compliance and administrative reviews for various property improvements. Additionally, the commission will discuss the Kents Point Management Plan and parking stickers.

zoningenvironmentwetlandsresidential-constructionparking
✓ Decided: Commission unanimously approved project revisions, certificates, and hearing continuations

The commission voted unanimously to continue the public hearings for the 12 Deacon’s Way and 27 Cheney Road applications to June 17, 2025. It approved revised plans for the 78 Great Oak Road dwelling project and the Lavender Hill septic‑system relocation. Certificates of compliance were issued for projects at 5 Asa’s Landing and 45 Nichols Road. The commission denied a fire‑pit project at 88 Rock Harbor Road and approved a vista‑corridor maintenance at 317 South Orleans Road with a condition prohibiting herbicide use.

Thu May 29, 2025

Human Services Advisory Committee

Human Services Advisory Committee to discuss FY 2027 funding and leadership

The committee will review the Board of Health's decision on funding a Recovery Coach position and discuss notifications for funding recipients. Members will also address the application process and timeline for FY 2027 funding and elect officers for FY26.

human-servicesfundingcommittee-governancepublic-health
✓ Decided: Committee unanimously accepted a revised committee charge

The Human Services Advisory Committee approved the May 1, 2025 minutes and unanimously accepted a revised committee charge. The board tabled discussion of using unexpended funds for emergency assistance and agreed to review the grant application process at the next meeting. Members also agreed to elect new officers for FY 26 at a future meeting.

Wed May 28, 2025

Council on Aging

Orleans Council on Aging to discuss Senior Tooter concept

The Council on Aging Board will review the April 2025 budget summary and departmental updates. The board is scheduled to discuss the Senior Tooter concept and seasonal planters.

seniorsbudgettransportationcommunity-services
Tue May 27, 2025

Cultural District Committee

Cultural District Committee to distribute remaining funds and discuss Levitt Grant deadline

The Orleans Cultural District Committee will review and approve minutes from the April 29, 2025 meeting, receive a treasurer’s report on remaining funds distribution, and discuss a marketing and design update including the Levitt Grant deadline of June 30. The committee will also address any other business before adjourning.

cultural-districtfundinglevitt-grantmeeting-minutestreasurer-report
✓ Decided: Committee unanimously approved minutes, treasurer’s report, and adjourned

The Cultural District Committee approved the April 29, 2025 meeting minutes with a unanimous vote. The Treasurer’s Report was accepted unanimously. The meeting was then adjourned by unanimous support.

Tue May 27, 2025

Select Board

Select Board to discuss school budget and fund transfers

The Orleans Select Board will meet to discuss an amended operating budget for the Nauset Regional School District and the transfer of Excess & Deficiency Funds, as outlined in a May 20, 2025 letter from the school district. The meeting also includes an executive session for contract negotiations.

school-budgetfund-transferexecutive-sessionselect-boardpublic-meeting
✓ Decided: Board entered executive session and approved letter to school district

The Select Board voted unanimously to go into executive session to discuss strategy for negotiations with non‑union personnel. After reconvening, the board unanimously approved sending a letter from the Chair and Town Manager to the Nauset Regional School District Committee. The meeting was then adjourned unanimously.

Tue May 27, 2025

Conservation Commission

Conservation Commission to review coastal home renovation near Pleasant Bay

The Orleans Conservation Commission will hold an on-site meeting to review a Notice of Intent for a coastal home renovation at 12 Deacon’s Way. The project involves adding/renovating an existing dwelling within a 100-foot buffer zone of a Coastal Bank and the Pleasant Bay Area of Critical Environmental Concern (ACEC).

coastal-zoneconservation-commissionhome-renovationpleasant-bayzoning
Tue May 27, 2025

Marine & Fresh Water Quality Committee

Marine and Fresh Water Quality Committee reviews water monitoring and funding updates

The Orleans Marine and Fresh Water Quality Committee meets to discuss water quality monitoring plans for freshwater lakes, ponds, and estuaries, review funding updates for FY26, and receive updates from the Cape Cod Commission and Wastewater Management Advisory Committee. The committee also plans for the upcoming Celebrate Our Waters event.

water-qualitymonitoringfundingwastewaterestuarylake-pondherring-run
✓ Decided: Committee approved meeting minutes unanimously (6-0-0)

The Marine & Fresh Water Quality Committee approved the April 28, 2025 meeting minutes with a 6‑0‑0 vote. Discussion of the Auty Fund was tabled for a future meeting. The Wastewater Management Advisory Committee update was deferred. No other formal actions were voted on.

Thu May 22, 2025

Architectural Review Committee

Architectural Review Committee to review new business signs

The Architectural Review Committee will meet to discuss sign requests for two new businesses. The committee will also consider the approval of meeting minutes from May 8, 2025.

signsbusinesszoningarchitectural-review
✓ Decided: ARC approves new signs for Birchouse Botanicals and Gemini Art Gallery

The Architectural Review Committee unanimously approved the sign applications for Birchouse Botanicals at 48R Main Street and for Gemini Art Gallery at 7 South Orleans Road. Both motions passed with a 3-0-0 vote. The meeting was then adjourned.

Thu May 22, 2025

Finance Committee

Finance Committee to review reserve fund transfers and Comprehensive Plan presentation

The Orleans Finance Committee will meet on May 22, 2025, to review and approve meeting minutes, discuss a presentation on the Comprehensive Plan by George Meservey and John Ostman, and review reserve fund transfers. The meeting will also include public comment and updates from liaisons.

financecomprehensive-planreserve-fundspublic-commentmeeting-minutes
✓ Decided: Finance Committee approves two sets of minutes and sets June meeting dates

The committee unanimously approved the amended minutes from the April 24 and May 12 meetings (7-0-0 on each). It also adopted the schedule for the next Finance Committee meetings, setting dates for June 12 and June 26, 2025 at 5:30 pm. The meeting was then adjourned by a unanimous vote.

Wed May 21, 2025

Zoning Board of Appeals

ZBA to hear appeals and permit requests for Harris Road, Cranberry Highway, and Sparrowhawk Rd

The Zoning Board of Appeals will review an appeal regarding an accessory structure on vacant land and a Land Court remand concerning property use. The board will also consider a special permit for building coverage exceeding 4,000 square feet for a new residence.

zoningspecial-permitsvariancesland-use
✓ Decided: Board approved a special permit to change office use to storage at 260 Cranberry Hwy

The Zoning Board of Appeals approved three actions. It granted a continuation of the Biggers special‑permit hearing to June 4, 2025. It approved the appeal decision for Jennie Hutton Jacoby with a filing condition. It also approved a special permit to convert the office at 260 Cranberry Highway to storage, subject to conditions.

Wed May 21, 2025

Select Board

Select Board to vote on multiple chief and town manager contracts

The Orleans Select Board meets to consider amendments and new contracts for the Town Manager (FY27–FY31) and Police and Fire Chiefs (FY26–FY30). The board will also review and vote on amendments to the Native Plantings Policy and conduct annual reorganization. Public comment and license requests are scheduled.

contractstown-managerpolicefire-departmentpolicylicensing
✓ Decided: Select Board elects Kevin Galligan as Chair and approves multiple licenses

The Orleans Select Board entered an executive session to discuss non‑union personnel negotiations, then reconvened and approved a series of seasonal outdoor entertainment, liquor, and vendor licenses. The Board also adopted exemptions to the Native Plantings Policy and elected new officers, including Kevin Galligan as Chair. All motions carried with unanimous or recorded vote counts.

Wed May 21, 2025

Open Space Committee

Open Space Committee to discuss priority parcels and committee roles

The Open Space Committee will meet to review priority parcels and discuss committee roles and reappointments. The meeting includes a recap of priority parcels and updates regarding June 7.

open-spaceland-usecommittee-appointments
✓ Decided: Open Space Committee moved next meeting to June 25, 2025

The committee approved the minutes from the April 16, 2025 meeting. It voted to change the date of the next meeting to June 25, 2025 at 9 AM. The meeting was then adjourned.

Wed May 21, 2025

Board of Water & Sewer Commissioners

Board to discuss proposed FY2026 water rate increase

The Board of Water & Sewer Commissioners will review a presentation on proposed water rate increases for FY2026 and proposed changes to sewer use rules and regulations. The meeting also includes updates on wastewater infrastructure and drought conditions.

water-ratessewer-regulationsinfrastructuredroughtutilities
✓ Decided: Board recommends 5% water rate increase and schedules SURR public hearing

The Board voted unanimously (7-0-0) to recommend a 5% water rate increase to the Select Board. It also voted unanimously (7-0-0) to hold a public hearing on proposed changes to the Sewer Use Rules and Regulations (SURR). Additional unanimous actions included approving April 16 minutes, committing April receivables for water and sewer, abating a small town‑owned property charge, and approving a drain‑layer license for Lynch Development Corp.

Tue May 20, 2025

Select Board

Select Board and Planning Board to review Comprehensive Plan progress

The Select Board and Planning Board are holding a joint meeting to receive a progress report on the Orleans Comprehensive Plan.

planningtown-managementcomprehensive-plan
Tue May 20, 2025

Snow Library Board of Trustees

Library board to vote on artist Louise Couillard Zipperman presentation

The Snow Library Marion Craine Gallery Committee will meet to discuss routine gallery operations and vote on approving a presentation by artist Louise Couillard Zipperman. The board will also review financial and director reports and approve minutes from the prior meeting.

libraryartgalleryproceduralfinance
✓ Decided: Board approved moving library portion of capital plan to FY 2028

The trustees approved the minutes from the April 2025 meeting unanimously. They passed a motion to amend the Capital Improvement Plan, moving the library’s share into fiscal year 2028. A motion to approve artist Louise Couillard Zipperman for the September gallery exhibit was made and seconded, but the vote result was not recorded. The meeting was adjourned unanimously.

Tue May 20, 2025

Conservation Commission

Conservation Commission to review coastal work and fitness class RFP

The Conservation Commission will review several Notices of Intent for residential projects involving coastal banks and wetlands. The body will also vote on a draft Request for Proposal for fitness classes at Jonathan Young Windmill.

conservationwetlandscoastal-managementzoningpublic-space
✓ Decided: Commission approved projects at Great Oak Rd and Priscilla Rd, continued bulkhead hearing

The Commission voted to continue the public hearing on the 27 Cheney Rd bulkhead project to June 3, 2025. It approved the demolition and replacement project at 78 Great Oak Rd with a stone base for a rinse station and a planting protocol. It also approved the deck expansion at 29 Priscilla Rd with conditions, despite one dissenting vote. All related public hearings were formally closed.

Mon May 19, 2025

Affordable Housing Trust Fund Board

Board to discuss property acquisition at 22 Old Tote Road

The Affordable Housing Trust Board will review rental assistance updates and project statuses for several properties. The board will discuss the acquisition of 22 Old Tote Road and a funding request for the Governor Prence Redevelopment project.

affordable-housingproperty-acquisitionrental-assistancecommunity-development
✓ Decided: Board approved $1.5 M funding for Phase 1 of Governor Prence redevelopment

The Affordable Housing Trust Board voted unanimously to approve a $1,500,000 request for Phase 1 of the Governor Prence redevelopment at 66‑76 Route 6A. The board also approved the April 15, 2025 meeting minutes. The meeting was then adjourned.

Mon May 19, 2025

Orleans School Committee

Orleans School Committee to hold public hearing on School Choice program

The committee will hold a public hearing to discuss participation in the School Choice Program for 2025-2026. Members will also review the FY25 Expenditure Report and the 2025-2026 NPS School Handbook.

educationschool-choicebudgetpolicytransportation
✓ Decided: School Committee approves FY2026 transportation contract with Cape Cod Collaborative

The Orleans Elementary School Committee voted to approve exercising the first option term of the Transportation Memorandum of Agreement with the Cape Cod Collaborative for Fiscal Year 2026. All committee members voted in favor. No other formal actions were taken during the meeting.

Fri May 16, 2025

Veterans Committee

Committee to vote on designated Vietnam memorial area

The Orleans Memorial Day/Veteran's Day Committee is deciding on a designated area for the Vietnam memorial and discussing related updates, including a 501c3 brick sales report and Coast Guard Bell refurbishment. Plans for Memorial Day services, speakers, and logistics are also being finalized.

veteransmemorialmemorial-daycoast-guardbrick-salesvietnam-memorial
Thu May 15, 2025

Board of Health

Board of Health to hold sewer connection show cause hearings

The Board of Health will conduct show cause hearings for 13 properties ordered to connect to the municipal sewer. The board will also review variance and hearing requests for several local addresses and discuss a Recovery Coach Program.

sewerpublic-healthzoning-variancesfood-serviceseptic
✓ Decided: Board approved a six‑foot septic setback variance for 51 Great Oak Road

The Orleans Board of Health approved a six‑foot variance to the required ten‑foot septic setback at 51 Great Oak Road. It also approved a six‑month deferral for the sewer connection at 7 Brewster Cross Road. Several ongoing show‑cause hearings were continued to later dates, each with a 3‑0‑0 voice vote.

Wed May 14, 2025

Historical Commission

Public hearing on demolishing significant building at 20 South Orleans Road

The Historical Commission will hold a public hearing on a Notice of Intent to demolish a significant building at 20 South Orleans Road. The commission will also receive a report from the Public Education sub-committee, discuss commission elections and future plans, and review and approve meeting minutes. Public comment will be taken at the start of the meeting.

historical-commissiondemolitionpublic-hearingsignficant-buildingorleanscommittee-elections
✓ Decided: Commission approved a 12‑month demolition delay for 20 South Orleans Road

The Historical Commission voted unanimously to impose a twelve‑month demolition delay on the property at 20 South Orleans Road. The commission also approved the minutes from the April 9, 2025 meeting with a minor amendment. After those actions, the meeting was adjourned.

Wed May 14, 2025

Transportation and Bikeways Advisory Committee

TBAC to discuss crosswalk at Monument & Main, Skaket Beach speed table

The Orleans Transportation and Bikeways Advisory Committee will consider a proposed crosswalk at Monument and Main Streets, review a speed table at Skaket Beach, and debrief the April 28 community meeting. The committee will also hear updates from the Orleans Police and Public Works departments. Approval of prior meeting minutes and planning for the June agenda round out the items.

transportationbikewayscrosswalkspeed-tablecommunity-meetingpublic-workspolice
✓ Decided: Committee assigns crosswalk study, speed table install, and August Main St outreach

The advisory committee tasked Calvin Sutton with providing crosswalk spacing regulations and, with Rich Waldo, presenting Cape Cod Commission data on pedestrian beacons at the next meeting. A speed table at Skaket Beach is being installed this week, and DPW will start town‑wide line striping next week. Several members were assigned to prepare graphics, gather field‑survey data, contact VHB, and plan an August public meeting on Main Street.

Tue May 13, 2025

Conservation Commission

Conservation Commission to review bulkhead replacement and new home construction

The Orleans Conservation Commission will discuss two Notice of Intent applications during an on-site meeting at Town Hall. One proposal involves repairing and replacing a timber bulkhead and modifying a pier at 27 Cheney Rd in the Pleasant Bay Area of Critical Environmental Concern. The other proposal is to raze and replace a dwelling with a new septic system and grading at 78 Great Oak Rd within a wetland buffer zone.

conservation-commissionnotice-of-intentwetlandscoastal-bankpleasant-bay-acecbulkheadconstructionseptic-system
Tue May 13, 2025

Economic Development Committee

EDC to discuss sewer project and committee governance

The Economic Development Committee will discuss the ongoing sewer project via the Wastewater Management Advisory Committee, review committee governance and leadership, and recap the Annual Town Meeting. The meeting includes a staff update and approval of previous minutes.

economic-developmentsewerwastewatergovernancestaff-updatetown-meeting-recap
✓ Decided: Committee approved April 29 minutes unanimously

The Economic Development Committee approved the minutes from the April 29, 2025 meeting with a 6‑0‑0 vote. The committee also voted to adjourn the May 13 meeting unanimously. Discussions included wastewater project relief and technology collaboration, but no further actions were decided.

Tue May 13, 2025

Board of Assessors

Orleans Board of Assessors to review abatement and exemption reports

The Board of Assessors will meet to review motor vehicle and boat abatement reports and a monthly sales report. The board will enter executive session to discuss real estate exemption applications.

assessorstax-abatementsexemptionsreal-estate
✓ Decided: Board approved 42 motor vehicle tax abatements totaling $5,378.98

The Board of Assessors unanimously approved 42 motor vehicle excise tax abatements for 2025 totaling $5,378.98. They also approved additional abatements: 17 motor vehicle abatements for $2,220.79, 2 motor vehicle abatements for $20.95, 1 motor vehicle abatement for $11.81, and one boat excise tax abatement each for $25.00 in 2025 and 2024. The minutes from the April 8, 2025 open and executive sessions were both approved unanimously.

Tue May 13, 2025

Cultural Council

Orleans Cultural Council to elect officers and discuss community projects

The council will approve minutes from the March 11, 2025 meeting and receive a treasurer's report. The chair will lead a reorganization meeting including election of officers, a recap of the Art Show, and discussion of potential community projects for spring/summer 2025. A Cultural District report will also be presented.

cultural-councilartshumanitiessciencesgrantselectioncommunity-projectscultural-district
✓ Decided: Brian Smith appointed President of Orleans Cultural Council

The council approved the March meeting minutes. Brian Smith was appointed President, with Heather Morin remaining Treasurer and Ellen Snyder‑Grenier remaining Secretary. Ellen will contact the town to change the meeting time on the website, and each member will bring one actionable project idea to the August meeting. The next meeting is set for August 11, 2025.

Mon May 12, 2025

Select Board

Select Board to vote on warrant article for prior-year bills

The Orleans Select Board will consider and possibly vote on a recommendation for Article 13 (Bills of a Prior Year) as an additional warrant article. The meeting also includes other town meeting actions and a town manager report.

select-boardtown-meetingwarrantsbillsprocedural
Mon May 12, 2025

Finance Committee

Finance Committee to finalize Annual Town Meeting preparations

The Finance Committee will meet to complete voting and discuss talking points for the Annual Town Meeting. The body will also review meeting minutes from April 24, 2025, and confirm its future meeting schedule.

town-meetingfinance-committeebudget
✓ Decided: Finance Committee confirmed agenda and set next meeting date

The committee approved the talking points document to be read at the Town Meeting and scheduled the next Finance Committee meeting for May 22, 2025. The meeting was then adjourned by an 8‑0‑0 vote.

Thu May 8, 2025

Architectural Review Committee

ARC reviews four sign applications for businesses on May 8

The Architectural Review Committee will consider new or replacement sign applications for four businesses: Bank of America, Oliver Inc. (Check Point East Recording Studio), The Baldwin Group (Rogers & Gray rebranding), and Gemini Art Gallery. The committee will also vote on approving the minutes from April 24, 2025.

architecturesignsbusinesspublic-hearingorleans
✓ Decided: ARC approved several sign applications, waiving a site plan for one

The committee approved the Bank of America monument sign with downward lighting and approved new signs for Check Point East Recording Studio after waiving the site‑plan requirement. It also approved the Phare sign at 19 West Road with lighting that meets town standards. All motions passed unanimously (4‑0‑0).

Thu May 8, 2025

Finance Committee

Finance Committee to consider reserve fund request and Town Meeting remarks

The Orleans Finance Committee will meet to discuss a reserve fund request and prepare remarks for the upcoming Town Meeting. The committee will also approve minutes from April 24 and review its meeting schedule. Public comment is invited.

finance-committeereserve-fundtown-meetingpublic-commenthybrid-meetingorleans-ma
Thu May 8, 2025

Energy & Climate Action Committee

Committee prepares Article 20 solar development for Town Meeting

The Energy and Climate Action Committee will receive updates on the Orleans Climate Action Network and from the Assistant Town Manager, discuss climate change impact news, and prepare for the Article 20 Solar Development item at Town Meeting. Liaison reports from multiple boards and committees will be presented, followed by votes to approve previous meeting minutes.

energyclimatesolartown-meetingorleanscommitteepublic-hearing
✓ Decided: Committee approved past minutes and adjourned the meeting

The Energy & Climate Action Committee approved the March 13 minutes unanimously and approved the revised April 10 minutes by a 5‑0 vote, with one member abstaining. A motion to adjourn was made and approved unanimously. No other substantive actions were taken.

Wed May 7, 2025

Select Board

Select Board to vote on eminent domain for 5 Academy Place

The Select Board will vote on an Order of Taking by eminent domain for a parcel at 5 Academy Place. The board will also hold a public hearing on shellfish grant licensing and meet with the Affordable Housing Trust Fund Board regarding 22 Old Tote Road.

eminent-domainhousingshellfish-licensingbusiness-permitsappointments
✓ Decided: Select Board approved eminent domain to take 5 Academy Place for Veterans Memorial Park

The board voted 5‑0‑0 to execute an Order of Taking by eminent domain for the 0.25‑acre parcel at 5 Academy Place, designated Veterans Memorial Park. It also instructed the Affordable Housing Trust Board to pursue a purchase of 22 Old Tote Road for up to $500,000, awarded five $1,000 Sarah Brown scholarships, and approved a slip transfer to Mark Shakliks. Additional actions included two new Common Victualler licenses, a shellfish grant transfer, and the appointment of Elizabeth Jenkins to the Barnstable County HOME Consortium.

Wed May 7, 2025

Affordable Housing Trust Fund Board

Joint meeting to discuss acquisition of 22 Old Tote Road for housing

The Affordable Housing Trust Board will meet jointly with the Select Board to discuss the acquisition of 22 Old Tote Road for housing purposes. This is the only substantive item on the agenda.

affordable-housingacquisitionjoint-meetinghousing
Wed May 7, 2025

Zoning Board of Appeals

ZBA to decide appeal on accessory structure for vacant lot at 14 Harris Road

The Zoning Board of Appeals will continue a hearing on an appeal and variance request for an accessory structure on vacant land at 14 Harris Road. The applicant seeks to overturn the Zoning Administrator's decision that an accessory structure cannot be allowed by right on a lot without a primary dwelling. The board will also review minutes from April 16 and a decision for Case #2025-06 on Kenneth Lane.

zoningboard-of-appealszoning-appealvarianceaccessory-structureharris-road
✓ Decided: Board approved conditional pool variance for 14 Harris Road (4-1)

The Zoning Board approved the minutes from the April 16 meeting by a 5-0 vote. It also approved a motion to modify the Building Commissioner’s decision, allowing an in‑ground pool on 14 Harris Road provided the two adjoining lots stay under common ownership, with a 4-1 vote.

Tue May 6, 2025

Snow Library Board of Trustees

Library board to discuss federal funding cuts and grant decision

The Snow Library Board of Trustees will vote on meeting minutes and hear updates on federal funding cuts to libraries, a state grant decision (MPLCP), and an image digitization project. Reports from the chair, director, and financial officer are also scheduled. No major policy changes or expenditures are on the agenda.

libraryfundinggrantsdigitizationpublic-meeting
✓ Decided: Board approved April 5 minutes and adjourned the meeting (6‑0 votes)

The trustees approved the April 5, 2025 meeting minutes with a unanimous 6‑0 vote. They recognized the departing trustees, Sue Lynch and Pamela Ritchie, with gift cards. The board heard reports on a new partnership with the Orleans Conservation Trust, library staffing, technology upgrades, finances, and upcoming gallery exhibit. The meeting was adjourned by a unanimous 6‑0 vote.

Tue May 6, 2025

Conservation Commission

Commission to review multiple coastal construction proposals including stairway, deck, and driveway work

The Orleans Conservation Commission will hear several Notices of Intent and Requests for Determination for projects affecting coastal banks, wetlands, and storm flowage zones. Actions include review of a timber stairway replacement at 112 Freeman Ln, a deck extension at 29 Priscilla Rd, and a driveway relocation with culvert replacement at 19 Whippoorwill Ln. The commission will also consider an amended Order of Conditions for an addition at 77 Keziah's Ln and vote on a withdrawal request for renovations at 13 Sheeps Pasture Point.

conservationcoastal-bankwetlandscoastal-storm-flowageinvasive-speciesnotices-of-intentcertificates-of-complianceamendments
✓ Decided: Commission unanimously approved 112 Freeman timber stairway project

The commission voted 7-0-0 to continue the deck hearing for 29 Priscilla Rd to May 20, 2025. It then closed and approved the 112 Freeman Lane timber stairway project with a 7-0-0 vote. A continuation was approved for the 19 Whippoorwill Lane hearing to June 17, 2025, also 7-0-0. Finally, the commission approved an amended order of conditions for 77 Keziah’s Lane with a unanimous 7-0-0 vote.

Thu May 1, 2025

Board of Health

Board of Health to hold sewer connection hearings and variance requests

The Board of Health will conduct show cause hearings for properties ordered to connect to the municipal sewer. The board will also review variance requests for two properties and approve food service applications.

sewerpublic-healthvariancesfood-service
✓ Decided: Board approves 47 Daley’s Terrace variance for fourth bedroom with I/A system

The Board continued show‑cause hearings for four Phase 1 sewer properties, setting a July 17, 2025 deadline for each. It accepted the Aqua Fund’s new rule that condominium owners with fewer than 10 units may qualify for sewer grants. The Board also approved variances for 47 Daley’s Terrace (four bedrooms with an I/A nitrogen‑removing system) and for 24 Collins Lane’s pool fence distance.

Thu May 1, 2025

Human Services Advisory Committee

Opioid abatement fund and Navigator program to be reviewed

The Human Services Advisory Committee will meet to approve April minutes, discuss the Opioid Abatement Fund as it relates to the Navigator program, and revise the committee charge. New business includes a review of Open Meeting Law and formation of a regional HSAC advisory committee with Brewster and Eastham.

human-servicesopioid-abatement-fundnavigator-programopen-meeting-lawregional-collaborationcommittee-recruitmentapplications
✓ Decided: Committee agreed to support $20,000 Recovery Coach funding

The Human Services Advisory Committee unanimously approved its minutes and agreed to write a letter of support to the Board of Health for a $20,000 Recovery Coach program. It tasked members with drafting a revised committee charge, developing precise language for a new rolling‑admission application process, renaming the regional group, and creating a streamlined application form. The committee also noted the need to recruit a fifth member.

Wed Apr 30, 2025

Select Board

Select Board to vote on union agreements and stabilization fund overrides

The Select Board will consider signing memorandum of agreements for police and firefighter unions and appropriating override funds for special Stabilization accounts. The meeting also includes preparations for the upcoming Town Meeting and updates on infrastructure projects.

labor-relationsbudgetpublic-safetyinfrastructurelicensingconservation
✓ Decided: Board signs labor agreements with police and fire unions

The Select Board voted unanimously to sign Memoranda of Agreement with the Orleans Police Officers Federation and the Permanent Firefighters Association. It also approved two stabilization fund appropriations, adopted a revision to the Multi Member Body policy, and appointed a student officer for the police department. Additional actions included approving seasonal licenses, accepting commission resignations, and elevating a conservation commissioner.

Tue Apr 29, 2025

Economic Development Committee

Committee to review draft Comprehensive Plan's economic development goals

The Economic Development Committee (EDC) will hold a hybrid meeting to discuss the draft Orleans Comprehensive Plan's goals related to economic development, presented by the Planning Board. They will also discuss Annual Town Meeting warrant articles affecting economic development and a parking study in the Village Center and its impact on local businesses. Additional updates include a staff report from the Economic Development Coordinator and a wastewater management advisory update on the sewer project.

economic-developmentcomprehensive-planparkingvillage-centerwarrant-articlessewertown-meetingbusiness
✓ Decided: Committee approved March 11, 2025 meeting minutes unanimously

The Economic Development Committee approved the minutes from the March 11, 2025 meeting with a 5‑0‑0 vote. No other formal actions were taken; the committee discussed wastewater phases, a village‑center parking proposal, and draft Local Comprehensive Plan goals but recorded no votes on those items. The meeting was adjourned unanimously at 10:56 a.m.

Tue Apr 29, 2025

Cultural District Committee

Committee to vote on Vice Chair, discuss extending manager contract and grant programs

The Cultural District Committee will approve minutes, receive a treasurer's report, and fill the Vice Chair position. They will also discuss the Arts Week report, a temporary display of Marine Debris Art, an AFCC Grant, and several projects including extending the Projects Manager contract and creating a marketing plan for workshops. The committee will consider participating in Pride Weekend and forming a working group for promotional materials, and will receive an update on the Municipal Grant Program.

cultural-districtartsgrantscontractsvice-chairmarketingpride-weekend
✓ Decided: Committee approved up to $2,500 for promotional materials and signage

The Cultural District Committee appointed Honah Lee Milne as Vice Chair and accepted the Treasurer’s Report, both unanimously. It approved encumbrances of $2,000 for design and printing of promotional materials, $500 for FLAG signage, and any remaining funds to sponsor the June Pride Weekend or Cape Noir, all with unanimous votes. The committee also approved the March 25, 2025 minutes by majority with one abstention and agreed to pursue a $5,120 AFCC grant for the Fall ’25/Spring ’26 Pop‑Up Music series.

Tue Apr 29, 2025

Veterans Committee

Veterans Committee plans Memorial Day and Veteran's Day observances

The committee is coordinating preparations for Memorial Day on May 26th, including the event schedule and keynote speaker. Members are also discussing construction updates and design ideas for a Vietnam Memorial.

veterans-affairsmemorial-daypublic-monumentscommunity-events
Mon Apr 28, 2025

Transportation and Bikeways Advisory Committee

Transportation and Bikeways Committee meets, no substantive items listed

The Orleans Transportation and Bikeways Advisory Committee is convening for a regularly scheduled meeting. The agenda contains only procedural items: call to order and adjournment, with no specific proposals, project reviews, or public hearings listed.

transportationbikewaysadvisory-committeeprocedural
✓ Decided: Transportation and Bikeways Advisory Committee held informational meeting, no decisions made

The committee presented a PowerPoint on planned roadway projects to improve pedestrian and bicyclist safety. Attendees asked questions about accident history, funding, and walkability, expressing mixed feelings about safety. The committee said it will collect more data and increase community engagement before any actions are taken. No formal decisions or votes were recorded.

Mon Apr 28, 2025

Marine & Fresh Water Quality Committee

FY26 water quality funding warrants and Mill Pond nitrogen evaluation discussed

The Marine and Fresh Water Quality Committee will discuss FY26 Town Warrants Article 25 (Water Quality Funding Proposal) and Article 26 (Mill Pond Nitrogen Evaluation) with WMAC Chair Kevin Galligan and Town Planner George Meservey. They will also hear an update from the Economic Development Committee on activity at Town Landings, review plans for 2025 water quality monitoring, and receive a visual count update for Pilgrim Lake herring run. Other items include planning for an educational tabletop event and approving previous meeting minutes.

water-qualitymonitoringwarrantsnitrogenherring-runcommitteetown-landings
✓ Decided: MFWQC unanimously supports Article 26 for Mill Pond nitrogen evaluation

The Marine & Fresh Water Quality Committee voted 7‑0‑0 to support Article 26, which funds a nitrogen evaluation for Mill Pond. Chair Rich Levy will revise the committee’s draft letter of support and circulate it for review. No other substantive actions were voted on at this meeting.

Thu Apr 24, 2025

Architectural Review Committee

Architectural Review Committee to review signs for Phare at 19 West Road

The Architectural Review Committee will meet to discuss new business regarding signs at 19 West Road. The committee will also hold an informal discussion about a flashing road sign on Main St. at Meetinghouse Rd.

signagearchitectural-reviewpublic-works
✓ Decided: ARC approved new ladder sign for Pleasant Bay Realty at 57 Route 6A

The committee waived the site‑plan requirement and approved the new ladder sign for Pleasant Bay Realty at 57 Route 6A, with a 5‑0 vote. The review of the monument sign for Phare at 19 West Road was postponed pending site review and building‑department input, also by a 5‑0 vote. The minutes from the April 10, 2025 meeting were approved with a minor wording change, 5‑0. The meeting was then adjourned.

Thu Apr 24, 2025

Finance Committee

Orleans Finance Committee to prep for May 12 Town Meeting

The Finance Committee will discuss its role and comments for the May 12 Annual Town Meeting and consider reserve fund requests. An update on Main Street sidewalks from Transportation & Bikeways is also on the agenda. The committee will approve previous meeting minutes and review its meeting schedule.

✓ Decided: Finance Committee approved $3,660.97 Veterans Benefits reserve fund transfer

The committee voted 8-0-0 to approve a $3,660.97 reserve fund transfer for a Veterans Benefits Assessment. It also approved the amended minutes from 4/10/25 with a 7-0-1 vote. The committee unanimously approved a letter recommending a single statement of concern for the entire Town Meeting warrant.

Wed Apr 23, 2025

Council on Aging

Council on Aging discusses moving board meetings to Town Hall

The Orleans Council on Aging Board will meet to review the March 2025 budget summary and departmental updates. Members will discuss relocating board meetings to Town Hall and receive updates on several ongoing projects.

seniorsbudgetgovernment-operationspublic-facilities
Tue Apr 22, 2025

Conservation Commission

Conservation Commission to review deck work at 29 Priscilla Rd on coastal beach and bank

The Orleans Conservation Commission will hold an on-site meeting to review a Request for Determination for work at 29 Priscilla Rd. The proposal includes squaring off a section of an existing deck, extending the deck area, installing diamond piers, and removing poured fittings. The work is planned on a Coastal Beach, on a Coastal Bank, and within Land Subject to Coastal Storm Flowage. The commission will determine whether the project requires a Notice of Intent or other permit.

conservationcoastalpermittingconstructionbeachwetlands
Thu Apr 17, 2025

Board of Health

Public hearing on Transfer Station fee schedule highlights Board of Health agenda

The Orleans Board of Health will hold a public hearing on the Transfer Station fee schedule, continue show cause hearings for multiple properties under order to connect to municipal sewer, and consider variance requests for properties on Cove Road, Old Field Road, and Monomoy Lane. The board will also take administrative action on a food service establishment application for Emack and Bolios.

healthtransfer-stationsewervariancespublic-hearingboard-of-health
✓ Decided: Board adopts higher Transfer Station fees and rescinds fine for 86‑88 Route 6A

The Orleans Board of Health voted 5‑0‑0 to adopt proposed increases to the Transfer Station fee schedule, making the new rates effective upon publication (estimated April 27). The board also rescinded a previously issued fine for the properties at 86 & 88 Route 6A and granted them a six‑month extension to complete sewer connection. Several pending sewer‑connection cases were continued to future dates for further review.

Thu Apr 17, 2025

Recreation Advisory Committee

Eldredge Park update, new program manager on agenda

This meeting of the Recreation Advisory Committee is largely informational, featuring a Recreation Director's Report and an update on the Eldredge Park Project. The committee will also meet new Recreation Program Manager Jamie Demetri and approve minutes from prior meetings.

recreationparkscommitteesmeetings
✓ Decided: Committee approved prior minutes and adjourned the meeting

The Recreation Advisory Committee approved the minutes from the December 19, 2023, January 16, 2025, and March 20, 2025 meetings with a 4‑0‑0 vote. The committee then adjourned the April 17, 2025 meeting with a 6‑0‑0 vote. No other actions were decided.

Wed Apr 16, 2025

Zoning Board of Appeals

Orleans ZBA to hear lot division and accessory structure appeals

The Zoning Board of Appeals will hold a public hearing on two matters. The first is a continuation of an appeal regarding whether an accessory structure can be built on vacant land at 14 Harris Road without a primary dwelling. The second is a special permit and variance request by the Higgins family to divide the lot at 43 Kenneth Lane into two non-conforming lots. No decisions have been made; the board will take public comment and discuss these applications.

zoningzoning-board-of-appealspublic-hearingvariancespecial-permitlot-divisionorleans-ma
✓ Decided: Board unanimously approved extensions and permits for two property appeals

The Zoning Board of Appeals approved an extension to May 7, 2025 for Jennie Hutton Jacoby’s appeal concerning an accessory swimming pool. It also approved a special permit and a variance to divide the lot at 43 Kenneth Lane into two parcels. All motions passed with a 5‑0 vote.

Wed Apr 16, 2025

Open Space Committee

OSC to discuss priority parcels with George Meservey

The Orleans Open Space Committee will discuss priority parcels with George Meservey and the OPC plan for June 7. The committee will also approve March meeting minutes and schedule the next meeting. Public comment will be heard.

open-spaceland-acquisitionplanningmeetingorleans
✓ Decided: Open Space Committee approves prior meeting minutes

The committee voted to approve the minutes from the March 19, 2025 meeting. All members present voted in favor. The meeting was then adjourned by a unanimous motion.

Wed Apr 16, 2025

Board of Water & Sewer Commissioners

Board to discuss new sewer service charge and water rate increase

The Board of Water/Sewer Commissioners will hold a hybrid meeting to receive updates on sewer and water operations. Key discussions include the implementation of a Basic Sewer Service Charge (Phase I), a water rate increase and seasonal rates, and a variance request from The Knack.

watersewerratesfeesdroughtvarianceinfrastructure
✓ Decided: Board approves grease‑tank variance for The Knack and commits March water and sewer revenues

The Board approved a variance allowing The Knack (Whole Clam LLC) to pump its external grease tank every four months. It also committed $50,644.50 in sewer receivables and $153,021.93 in water receivables for March 2025. A sub‑committee was formed to study a possible rate increase of up to 5% effective July 1. The minutes of the March 19, 2025 meeting were approved.

Tue Apr 15, 2025

Affordable Housing Trust Fund Board

Affordable Housing Trust to vote on acquiring 22 Old Tote Road

The Orleans Affordable Housing Trust Board will discuss project updates for several properties, consider a Request for Proposals for property acquisition, and vote on encumbering funds for the potential acquisition of 22 Old Tote Road. The board will also prepare for Annual Town Meeting, including defining moderate income at 120% of AMI and reviewing seasonal community designation.

affordable-housingtrustproperty-acquisitionzoningtown-meetingcommunity-development
✓ Decided: Board encumbers $550,000 for Old Tote Road acquisition

The Affordable Housing Trust Board accepted a Notice of Funding Availability for the 22 Old Tote Road property (8‑0‑0). It voted to encumber $550,000 to cover the potential acquisition, plans, and sewer connection for that site (8‑0‑0). The board also approved the March 18, 2025 minutes (7‑0‑1) and adjourned the meeting (8‑0‑0).

Tue Apr 15, 2025

Snow Library Board of Trustees

Trustees to vote on artist Erika Zvilnaite presentation

The Snow Library Marion Craine Gallery Committee will vote on a presentation by artist Erika Zvilnaite ("Ezartesa") and approve minutes from March. The committee will also review the financial report, library director's report, and gallery schedule. This is a routine meeting with no budget or policy decisions.

librarygalleryartpublic-meetingsnow-libraryorleans
✓ Decided: Board approves Erika Zvilnaite exhibit for August and adopts March minutes

The Snow Library Marion Craine Gallery Committee approved the minutes from the March 18, 2025 meeting. The board also approved Erika Zvilnaite’s exhibition to be held in August. Both motions passed with all members in favor.

Tue Apr 15, 2025

Fourth of July Committee

Committee to review 2025 parade timeline and March minutes

The Orleans Fourth of July Committee will discuss the 2025 parade timeline and approve the previous month's minutes. No new business is listed; the meeting is largely procedural.

paradecommitteetown-eventsprocedural
Tue Apr 15, 2025

Conservation Commission

Conservation Commission to review Kents Point land management and site projects

The Conservation Commission will review several Notice of Intents for residential and commercial site improvements. The body will also vote on the methodology for updating the Kents Point Land Management process and discuss a grant opportunity for Putnam Farm.

conservationwetlandsland-managementzoninggrants
✓ Decided: Conservation Commission unanimously approves 19 Childs Homestead Rd project

The commission voted 7‑0‑0 to approve the 19 Childs Homestead Rd project, attaching its findings, standard conditions, and a special condition for a pre‑construction meeting about chain‑link fence removal. It also approved a Certificate of Compliance for the same site (vote recorded as 7). The hearings for three other applications were each continued to May 6 2025 by unanimous vote.

Mon Apr 14, 2025

Conservation Commission

Conservation Commission holds annual Putnam Farm growers meeting

The Orleans Conservation Commission is convening the annual Putnam Farm growers meeting to discuss agricultural updates and review the Rules & Responsibilities document along with the compliance schedule. The agenda includes welcoming remarks, an agriculture update from the Agricultural Advisory Committee, and a question-and-answer forum.

conservationagricultureputnam-farmrules-review
Thu Apr 10, 2025

Finance Committee

Finance Committee to vote on final FY26 budget, discuss wastewater financing

The Orleans Finance Committee will vote on the final FY26 budget, discuss wastewater initiatives and financing with Kevin Galligan and Rich Waldo, and discuss/vote on Town Meeting warrant articles. The meeting also includes public comment and approval of prior meeting minutes.

budgetwastewaterfinancetown-meetingpublic-comment
✓ Decided: Finance Committee approved FY26 budget and 13 town‑meeting articles

The Orleans Finance Committee unanimously approved the FY26 budget as amended. It recommended and approved a series of Town Meeting warrant articles covering fire‑station design, beaches, sewer and transfer station funds, solar development, bulkhead work, community preservation, wastewater projects, and housing and veterans provisions. The only article rejected was the residential exemption budget request. All votes were recorded as shown.

Thu Apr 10, 2025

Architectural Review Committee

Two new businesses seek sign approval in Orleans

The Architectural Review Committee will review sign applications for two new businesses: Wildflower Hair at 80–82 Route 6A and Flowers by the Bay at 31 Main Street. The committee will also approve minutes from the March 13, 2025 meeting.

architectural-reviewsignsnew-businessroute-6amain-streetorleans
✓ Decided: ARC approves two new business signs and March minutes

The Architectural Review Committee approved the signage application for Wildflower Hair at 80‑82 Route 6A with a 5‑0‑0 vote. It also approved the signage application for Flowers by the Bay at 31 Main Street with a 5‑0‑0 vote. The committee approved the minutes of the March 18, 2025 meeting, also by a 5‑0‑0 vote.

Thu Apr 10, 2025

Energy & Climate Action Committee

Vote on Transportation and Bikeways letter of support

The Energy and Climate Action Committee will vote on a letter of support for Transportation and Bikeways articles. The agenda also includes updates from the Orleans Climate Action Network and the Assistant Town Manager, a review of 2025 Goal Sheets, and liaison reports from various town boards. The meeting will consider climate change impact news and approve previous meeting minutes.

climate-actiontransportationbikewayspublic-commentcommitteeorleansupdates
✓ Decided: Committee adjourned after deferring March 13 minutes review

The Energy & Climate Action Committee discussed upcoming solar projects, grant articles, and community initiatives but made no substantive approvals. Review of the March 13, 2025 minutes was deferred to the May 8 meeting. A motion to adjourn was made, seconded, and approved unanimously.

Wed Apr 9, 2025

Transportation and Bikeways Advisory Committee

Committee to review draft Transportation section of Orleans Comprehensive Plan

The Transportation and Bikeways Advisory Committee will discuss and provide feedback on the draft Transportation section of the Orleans Comprehensive Plan for the Planning Board. The body will also review updates on several local road projects and prepare for a community meeting on April 28.

transportationbikewayscomprehensive-planroad-safetyinfrastructure
✓ Decided: Committee adds three new actions to transportation plan, including Route 6A study

The advisory committee approved the February 12, 2025 meeting minutes. It agreed to add “pedestrians and bicyclists” to the vulnerable‑user references in the Comprehensive Plan and to include three new action items: a public‑road layout, a traffic study of the Route 6A corridor, and improvements to the Route 6A, Eldredge Parkway, West Road intersection. The committee also decided to adjust the location of the seasonal speed table on Skaket Beach Road and to install the tables in late May/early June, using new electronic message boards during the adjustment period. A community meeting to review Main Street, Old Colony Way, and Beach Road projects was scheduled for April 28.

Wed Apr 9, 2025

Housing Authority

Housing Authority to vote on $279,622 amendment and executive director search contract

The Orleans Housing Authority will consider approving two Capital Funding Agreement amendments totaling over $286,000, certificates for window project completion, a contract for an executive director search, and a capital plan. The meeting also includes routine financial and director reports.

housingfinancecapital-projectscontractswindowsexecutive-directororleans
Wed Apr 9, 2025

Historical Commission

Historical Commission to discuss Main St. Historic District project

The Orleans Historical Commission will meet to discuss the Main St. Historic District project and a flashing road sign at Main St and Meetinghouse Road. The commission will also receive input from the Planning Department regarding the Comprehensive Plan.

historic-preservationplanningmain-stroad-signs
✓ Decided: Commission voted unanimously to recommend removal of the Main St. flashing sign

The commission unanimously approved a motion finding the flashing road sign at Main Street and Meetinghouse Road visually intrusive and recommending its removal. They also approved the creation of a public‑education subcommittee composed of Commissioner Marcarelli and Associate Member Mustaro. The board approved the minutes from the March 12, 2025 meeting.

Wed Apr 9, 2025

Select Board

Select Board to vote on final FY26 budget in joint meeting with Finance Committee

The Orleans Select Board will hold a joint meeting with the Finance Committee to vote on the final Fiscal Year 2026 budget. The board will also vote on union memorandum of agreements and cost-of-living adjustments for non-union employees, consider amendments to the Center for Culture and History in Orleans (CHO) lease, and review the 2025 agreement with the Orleans Chamber of Commerce. Other actions include approving fee changes for special one-day liquor licenses, finalizing warrant articles for the Annual Town Meeting, and placing debt exclusion questions on the May 20 ballot.

budgetcollective-bargainingfinancelicensesleasesagreementselections
✓ Decided: Select Board approves FY26 budget, COLA, beach pact and multiple licenses

The Orleans Select Board accepted the FY26 operating budget of $64,069,780 and a 3% cost‑of‑living adjustment for non‑union staff. It also approved the three‑year Nauset Beach Agreement with Chatham and a lease amendment for the Center for Culture and History. Filing fees for Special One Day Liquor Licenses were eliminated and several liquor and outdoor entertainment licenses were granted. Additional ballot questions, including debt‑exclusion items and a $5 million solar development, were placed on the May 20, 2025 election.

Tue Apr 8, 2025

Board of Assessors

Orleans Board of Assessors to discuss property abatements and exemptions

The Board of Assessors will hold a routine meeting to review motor vehicle commitments, various abatement reports (real estate, personal property, boat), real estate exemption reports, and uncollectible taxes. The board will also enter executive session to discuss exemption applications as allowed by state law. No specific dollar amounts or property addresses are listed in the agenda.

assessorsproperty-taxesabatementsexemptionsmunicipal-governmentorleans-ma
✓ Decided: Board approved $196,009.41 in motor vehicle excise commitments

The Board approved a motor vehicle excise commitment of $196,009.41 for 2025‑2. It also approved several abatements and exemptions, including motor vehicle abatements, real estate and personal property abatements, and elderly exemptions. The March 11, 2025 minutes were adopted.

Tue Apr 8, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee to hold public hearing on draft aquaculture regulations

The Shellfish and Waterways Improvement Advisory Committee will conduct a public hearing regarding draft aquaculture regulations for Orleans. The committee will also receive a report from the Natural Resources Manager, Harbormaster, and Shellfish Constable.

aquacultureshellfishwaterwaysregulationspublic-hearing
✓ Decided: Committee accepted minutes and scheduled a May 15 meeting

The committee unanimously approved the meeting minutes after a wording change. They agreed to look into Thursday, May 15 as the date for the next meeting. The meeting was adjourned by unanimous vote.

Tue Apr 8, 2025

Cultural Council

Orleans Cultural Council to discuss regionalization with Brewster

The Cultural Council will meet to elect officers and review a report on the possible regionalization of the Brewster and Orleans Councils. The body will also finalize plans for an Art Show Reception.

artscultureregionalizationgovernment
Tue Apr 8, 2025

Conservation Commission

Commission to review three projects in coastal buffer zones including Cape Cod Village improvements

The Orleans Conservation Commission will hold an on-site meeting on April 8, 2025. They will continue a previous application for Dead Low LLC at 317 S. Orleans Rd for a pool and shed removal. They will also review two new Notice of Intent applications: one from Cape Cod Village Inc. for site improvements at 19 Childs Homestead Rd, and one from Joshua A. & Karen H. Sloan for renovations at 13 Sheeps Pasture Point. All work is within buffer zones to coastal banks or wetlands.

conservation-commissioncoastal-bufferwetlandsnotice-of-intentconstructionorleansbuffer-zone
Mon Apr 7, 2025

Orleans School Committee

Orleans School Committee to review campus study site options

The committee will discuss recommended site options from the ongoing campus study and consider approving the NPS Policy Manual Sections A-D on second reading. They will also hear administrator reports covering the school handbook, curriculum, professional development, and security, and review the FY25 expenditure report.

school-committeecampus-studypolicy-manualexpenditure-reportorleans
✓ Decided: School Committee approved Policy Manual Sections A‑D for second reading

The committee voted unanimously to approve Policy Manual Sections A through D for a second reading. They also approved the February 3 and February 10, 2025 meeting minutes. The meeting was then adjourned at 5:13 pm.

Mon Apr 7, 2025

Registrar

Board of Registrars to vote on early voting schedule for May election

The Orleans Board of Registrars will swear in Beverly Fuller for a three-year term and vote on authorizing the Town Clerk to hold in-person early voting at Town Hall from May 5 to May 16. The board will also review the role of registrars.

electionsregistrarsearly-votingtown-hallpersonnel
✓ Decided: Town Clerk authorized to hold in‑person early voting for elections

Beverly Fuller was sworn in for a three‑year term as registrar. The board approved, by unanimous vote, a motion allowing the Town Clerk to conduct in‑person early voting at Town Hall for two weeks (May 5‑16) for the annual town election. The board also approved, unanimously, a motion permitting in‑person early voting for any special election in 2025.

Thu Apr 3, 2025

Board of Health

Board of Health to hold show cause hearings for municipal sewer connections

The Board of Health will review variance requests for four properties and a deferral request for 43 Canal Road. The board will also conduct show cause hearings for numerous properties under order to connect to the municipal sewer.

health-boardsewervariancespublic-health
✓ Decided: Board approves Fox Ridge variance and sets multiple sewer deadlines

The Orleans Board of Health approved a variance for 9 Fox Ridge Drive despite the septic tank size requirement (voice vote 4-0-0). It granted a deferral for 43 Canal Road until the April 17, 2025 meeting and issued fines or conditional deadlines for several properties that have not complied with sewer connection orders. Additional deadlines were set for permit and plan submissions, with fines of $200 for missed dates.

Thu Apr 3, 2025

Finance Committee

Finance Committee to discuss warrant articles for May Town Meeting

The Orleans Finance Committee will meet to discuss and vote on warrant articles for the upcoming May Town Meeting, including approving a warrant letter. This is a procedural meeting focused on finalizing items for the town meeting agenda.

finance-committeetown-meetingwarrant-articlesorleans
✓ Decided: Finance Committee recommended $45 M fire station design article

The committee approved the amended warrant letter for the May Town Meeting by a 7‑0‑0 vote. It also recommended the Consent Calendar for the town meeting with a 7‑0‑0 vote. Finally, the committee recommended Article 12 for fire station design and construction, a $45 million project, with a 6‑0‑1 vote (one abstention).

Thu Apr 3, 2025

Human Services Advisory Committee

HSAC to discuss Outer Cape Health Navigator program and grant process changes

The Human Services Advisory Committee will hear a presentation on Outer Cape Health's Navigator program in Orleans and discuss proposed changes to the HSAC grant review process. The committee will also set future meeting dates and vote on minutes from March 6, 2025. All items are for discussion and no decisions are on the agenda.

human-servicesgrant-reviewhealth-servicesdiscussioncommittee-meeting
✓ Decided: Committee approves $20,000 for Community Services Navigator Program

The Human Services Advisory Committee unanimously approved a $20,000 allocation for the Community Services Navigator Program. A motion to require an individual up‑or‑down vote on each eligible grant application passed with a 3‑to‑2 vote. The committee also approved the meeting minutes as amended.

Wed Apr 2, 2025

Select Board

Select Board to review May Town Meeting warrant articles

The Select Board will review warrant articles for the May Town Meeting. The meeting also includes an executive session to discuss collective bargaining strategy for several town unions and non-union personnel.

town-meetingcollective-bargaininglabor-relationspolicefire
✓ Decided: Select Board approved all warrant articles for the upcoming Town Meeting

The board placed Articles 1‑11, 14‑18, the capital budget article, Article 20 on solar energy, the bulkhead at Rock Harbor article, and Article 33 on the warrant, and removed Articles 28 and 29. Each motion passed unanimously with a 4‑0‑0 vote. The board also entered executive session to discuss collective‑bargaining strategy, which was approved 4‑0‑0. Capital debt was noted as $8 million, lower than the previously projected $11 million.

Wed Apr 2, 2025

Zoning Board of Appeals

Board to hear appeal of zoning enforcement order at 260 Cranberry Highway per Land Court remand

The Zoning Board of Appeals will hold a public hearing on a case remanded by the Land Court regarding a property at 260 Cranberry Highway. The applicant seeks reversal of a building commissioner's enforcement order, or alternatively a special permit or variance. The board will also review minutes from its March 19 meeting.

zoningboard-of-appealspublic-hearingenforcement-orderspecial-permitvariancecranberry-highway
✓ Decided: Board denied the appeal to overturn the zoning enforcement order

The board approved the March 19 meeting minutes after a motion and second. It upheld three ZEO findings on storage, change‑of‑use size, and setback requirements, and it overturned the ZEO finding about parking spaces. The board rejected the applicant’s request to overturn the enforcement order. It also approved a unanimous continuation of the case to May 19, 2025 for site‑plan review.

Tue Apr 1, 2025

Snow Library Board of Trustees

Library board to discuss federal funding cuts to libraries

The Snow Library Board of Trustees will hold a regular meeting with updates on federal funding cuts to libraries, financial reports, and director and trustee reports. The board will also vote on approving the minutes from the March 5, 2025 meeting. Public comment will be taken.

librarybudgetfederal-fundingpublic-commentminutes
✓ Decided: Board unanimously approves March minutes

The trustees approved the March 5, 2025 meeting minutes with a 4‑0 vote. They then adjourned the April 1 meeting unanimously. No other actions were voted on.

Tue Apr 1, 2025

Conservation Commission

Conservation Commission to vote on encroachment response, review septic and invasive species projects

The Orleans Conservation Commission will hold a public meeting to decide on a response to an encroachment on Peck Conservation Area, review a septic system proposal near an isolated land subject to flooding, and discuss invasive species management, a deck replacement, and an osprey pole installation. The meeting also includes administrative reviews and a liaison report on Kents Point land management.

conservationwetlandssepticinvasive-speciesencroachmentpublic-accesscoastal
✓ Decided: Commission denied septic system at 4 Driftwood Lane with unanimous vote

The Conservation Commission voted 7‑0‑0 to issue a negative determination for the Title 5 septic system proposed at 4 Driftwood Lane, effectively denying the project. It also denied a deck expansion at 29 Priscilla Rd and directed the applicant to seek a Resource Development Agreement. Approvals were granted for the Kents Point workday at 39 Keziahs Ln and an osprey pole at 654 S. Orleans Rd, and the commission ordered a cease‑and‑desist letter to an abutter encroaching on town conservation land. The public hearing on the 54 Tonset Rd invasive‑species project was continued to April 15, 2025.

Tue Apr 1, 2025

Personnel Advisory Board

Personnel Advisory Board to review compensation plan and by-law changes

The Personnel Advisory Board will discuss the compensation plan and new job titles. The board will also review Personnel By-Law changes intended for the Annual Town Meeting.

personnelcompensationtown-by-lawshuman-resourcestown-meeting
✓ Decided: Board approved changes to personnel bylaw and compensation plan

The board reviewed proposed changes to the personnel bylaw and compensation plan, including a reduction in steps over three years and new titles. Members voted their agreement with the proposed changes. The board also unanimously approved the minutes from the November 13, 2024 meeting and unanimously adjourned the session.

Thu Mar 27, 2025

Finance Committee

Budget review and Reserve Fund transfers on Finance Committee agenda

The Orleans Finance Committee will hold a hybrid meeting on March 27, 2025, to vote on Reserve Fund transfers and review the budget with Assistant Director of Planning and Community Development Elizabeth Jenkins. The committee will also discuss a letter for the Town Meeting warrant booklet and set future meeting dates, including a session focused on sewer costs on April 10.

finance-committeebudgetreserve-fundsplanningcommunity-developmentwarrantsewer
✓ Decided: Finance Committee approved a $4,195 reserve fund transfer for unemployment benefits

The committee approved the minutes from the March 12 and March 13 meetings by unanimous vote. It then approved a $4,195 reserve fund transfer to cover unemployment benefits for two town employees, also by unanimous vote. The remainder of the meeting consisted of discussion on housing initiatives and upcoming Town Meeting materials, with no further decisions made. The meeting adjourned at 7:20 pm.

Wed Mar 26, 2025

Council on Aging

Council on Aging to discuss garden restoration native planting policy and FY26 budget

The Orleans Council on Aging will vote on minutes from February and March 2025 meetings, and discuss several items including the Garden Restoration Project with new Native Planting Policy, the FY26 Budget Update, and a Supportive Day Program Grant. Public comment and reports from the Select Board liaison and Friends of COA are also on the agenda.

council-on-agingseniorsgarden-restorationnative-plantingbudgetgrantspublic-comment
Wed Mar 26, 2025

Select Board

Public hearings on shellfish rules and entertainment license, FY26 fee changes on tap

The Select Board will hold public hearings on proposed shellfish regulation amendments and the Town Cove Tap House annual entertainment license. The board will also vote on FY26 fee changes, discuss the Cape Cod Tech School budget, and review warrant articles for the May Town Meeting. Seasonal license renewals for various business types will be voted on.

public-hearingsshellfish-regulationsentertainment-licensefy26-feescape-cod-tech-schooltown-meetingseasonal-licenses
✓ Decided: Board adopts new shellfish regulation limiting harvest below 28°F

The Select Board approved several appointments, accepted a committee resignation, and renewed seasonal licenses. It adopted a change to Section 3.8 of the Orleans Shellfish Regulations that prohibits dry harvesting or harvesting in shoal areas when water temperature is under 28 degrees. The Board also approved FY26 beach fee changes and granted an annual indoor entertainment license to Town Cove Tap House.

Tue Mar 25, 2025

Conservation Commission

Conservation Commission reviews water access and septic projects

The Conservation Commission is holding an on-site meeting to review land use requests. The body will consider proposals for invasive species management and septic system installation.

conservationwetlandssepticland-use
Tue Mar 25, 2025

Cultural District Committee

Cultural District Committee welcomes new members and discusses arts initiatives

The Orleans Cultural District Committee meets to approve past minutes, welcome two new members, and review updates on the town’s comprehensive plan, cultural district banners, and upcoming Arts Week projects. The treasurer presents a financial report.

artscultural-districtcommitteeorleansplanning
✓ Decided: Committee approved February minutes and wording change to Treasurer's report

The Cultural District Committee unanimously approved the February 25, 2025 meeting minutes. It also unanimously approved changing the Treasurer’s report wording from “ENCUMBERED?” to “ALLOCATED.” The meeting was then adjourned by motion. No other substantive actions were decided.

Tue Mar 25, 2025

Veterans Committee

Veterans Committee to discuss GFM contractor start, Native American wording

The Orleans Veterans Committee will meet on March 25, 2025, to receive an update on the winning bid contractor GFM's start date and work schedule. They will also discuss proposed Native American acknowledgement wording for the Select Board, possible work on veterans squares during VMP construction, and Memorial Day preparations including keynote speaker Jeff Smith.

veteranscommitteegfm-contractornative-american-acknowledgementveterans-squaresmemorial-dayagenda
Mon Mar 24, 2025

Historical District Study Committee

Historic district committee to discuss report presentation to Select Board

The Orleans Historic District Study Committee will discuss presenting its preliminary study report to the Select Board at their March 26 meeting. The committee will also hold public comment and review minutes from the previous meeting. No final decisions are expected on this agenda.

historic-districtstudy-committeeselect-boardpublic-meeting
Mon Mar 24, 2025

Select Board

Joint meeting with School Committee on Campus Plan presentation

The Select Board will hold a joint meeting with the Orleans School Committee to receive a presentation on the Campus Plan from Galante Architecture Studio. The Board will also discuss proposed Short Term Rental requirements and review first draft warrant articles for the Annual Town Meeting. Public comment will be taken.

campus-planschool-committeeshort-term-rentalstown-meetingwarrant-articles
✓ Decided: Select Board adjourned meeting; joint health meeting agreed, no other votes

The Select Board discussed the Orleans Campus Plan and short‑term rental requirements. The board agreed to hold a joint meeting with the Board of Health. Both the Orleans Elementary Committee and the Select Board voted to adjourn their respective meetings.

Mon Mar 24, 2025

Orleans School Committee

Orleans School Committee and Select Board to discuss site review and cost estimates

The Orleans School Committee and Orleans Select Board are holding a joint meeting to review priority business. The discussion will include a recap by Ted Galante of TGAS and a review of site options and cost estimates.

school-committeeselect-boardsite-reviewcost-estimatesfire-rescue-station
Mon Mar 24, 2025

Marine & Fresh Water Quality Committee

Committee to discuss FY26 water quality funding and Mill Pond assessment

The Marine and Fresh Water Quality Committee will discuss the FY26 Water Quality Funding Proposal, including a potential Mill Pond assessment, and receive updates on cyanobacteria, the town comprehensive plan, and water quality monitoring programs. The agenda also includes planning for educational outreach and a preview of a fresh water quality presentation for an upcoming citizen forum.

water-qualityfundingcyanobacteriacomprehensive-planmonitoringherring-runmill-pond
✓ Decided: Committee tables Orleans Citizen Forum item and assigns comment compilation

The committee temporarily tabled the Orleans Citizen Forum on fresh water quality (Agenda Item 5). Rich Levy will compile the Marine & Fresh Water Quality Committee’s comments on the Comprehensive Plan goals and forward them to Town Planner George Meservey. The FY26 water‑quality funding request was noted at a total of $154,000 after revisions.

Thu Mar 20, 2025

Board of Health

Board of Health to discuss short-term rental regulations and comprehensive plan

The Orleans Board of Health will hold public hearings on multiple variance and hearing requests for properties including 2 Little Bay Road, 55 Woodsneck Road, and 24 Canal Road. The board will also discuss the Orleans Comprehensive Plan and short-term rental policy. Administrative items include a temporary food permit for Nauset Firebirds and approval of past meeting minutes.

board-of-healthshort-term-rentalscomprehensive-planvariancespublic-hearingsfood-permitsorleans
Thu Mar 20, 2025

Recreation Advisory Committee

Public hearing on Open Space and Recreation Plan

The Recreation Advisory Committee is holding a public hearing to present and gather input on the Open Space and Recreation Plan, followed by a gallery walk and topical stations for discussion. No decisions are being made; the next meeting is scheduled for April 17.

recreationopen-spacepublic-hearingplanningcommunity-input
✓ Decided: No substantive decisions made at the Open Space and Recreation Plan hearing

The Recreation Advisory Committee held a public hearing on the Open Space and Recreation Plan on March 20, 2025. A formal presentation was given by Weston and Sampson outlining the plan's background, purpose, and goals. Community survey feedback included 568 respondents, with 33% residing in Orleans for over 20 years and 40% feeling their needs are met. No decisions, approvals, or votes were recorded during this meeting.

Wed Mar 19, 2025

Select Board

FY26 School Budget Joint Meeting with Finance Committee

The Select Board will hold a joint meeting with the Finance Committee to discuss the FY26 School Budget presentations. The board also considers an Eversource petition for underground conduits on Rock Harbor Road, reviews results from the Solar Projects RFP, and discusses FY26 fee and rate changes. Additional items include a vote on changes to beach and OSV sticker eligibility rules and discussion of Town Meeting warrant articles.

select-boardeversourcesolarfeesbeachesschool-budgetfinance-committeetown-meeting-warrant
✓ Decided: Select Board approves beach sticker rules, road closure, and financial policy changes

The Orleans Select Board approved the 2025 Beach and OSV Sticker Eligibility Rules and Regulations, a road closure for the Lower Cape Pride Parade, and updates to financial policies for ambulance and general operating reserves. The board also closed the Eversource pole hearing after the company withdrew its petition, and heard budget presentations from the school district. Several items, including beach fees and the Town Meeting warrant, were deferred to future meetings.

Wed Mar 19, 2025

Zoning Board of Appeals

ZBA to hear appeal regarding accessory structure at 14 Harris Road

The Zoning Board of Appeals will review a decision regarding whether an accessory structure can be placed on a lot without a primary dwelling. The board will also discuss language changes for a previous case decision.

zoningland-usevarianceaccessory-structure
✓ Decided: Board approved language change for 15‑17 High Street case

The Zoning Board of Appeals unanimously approved a language change in the decision for Case 2025‑02 covering 15‑17 High Street. The board also unanimously voted to continue consideration of the Harris Road variance and appeal case to the April 16, 2025 meeting. The minutes from the February 5, 2025 meeting were approved.

Wed Mar 19, 2025

Open Space Committee

Open Space Committee to discuss Orleans Comprehensive Plan

The Open Space Committee will hear a presentation on the Orleans Comprehensive Plan from George Meservey and a representative from the planning board. They will also recap previous discussions regarding the Orleans Planning Commission and the committee's charge. The meeting includes public comment and scheduling of the next regular meeting.

open-spacecomprehensive-planplanningpublic-meeting
✓ Decided: Next Open Space Committee meeting set for April 16, 2025

The committee approved the February 19, 2025 minutes and scheduled its next meeting for April 16, 2025. A motion to adjourn was passed unanimously. No policy or project decisions were made; members discussed the upcoming CROS plan.

Wed Mar 19, 2025

Board of Water & Sewer Commissioners

Board to discuss new sewer service charge and water rate increase

The Orleans Board of Water/Sewer Commissioners will hold a hybrid meeting on March 19, 2025, at 1:00 PM. Items include an executive session on pending litigation, betterment appeals, additional allocated flow requests, sewer connection deferrals, and department reports. The board will discuss implementing a basic sewer service charge (Phase I), a water rate increase and seasonal rates, and updates on wastewater infrastructure. New business includes the Orleans Comprehensive Plan and various commitments.

watersewerratesbettermentlitigationinfrastructurecomprehensive-plan
✓ Decided: Board approves 5% water rate hike and $50 sewer charge for eligible properties

The Board voted unanimously to support a $50 basic sewer service charge for phase 1 and a water rate increase of up to 5% effective July 1 2025. It also conditionally approved extra water flow for 191 Route 6A and approved a $33,793.76 flow abatement for 2 Academy Place, while denying betterment abatement requests for 195 Route 6A and 37 S Orleans Road. Additionally, the Board recommended deferring the sewer connection for 18 Old Colony Way until Dec 31 2025 and adopted a mandatory two‑day‑a‑week watering restriction.

Wed Mar 19, 2025

Finance Committee

Finance Committee to review FY26 school budget presentations

The Orleans Finance Committee is holding a joint meeting to receive presentations on the FY26 School Budget. No votes or decisions are listed on the agenda; the session is informational.

financebudgetschoolsjoint-meeting
Tue Mar 18, 2025

Affordable Housing Trust Fund Board

Board to vote on support for Governor Prence site development

The Affordable Housing Trust Board will discuss the Comprehensive Plan and prepare for the Annual Town Meeting. The board will vote on support for Phase I of a development at the former Governor Prence site. Members will also meet in executive session regarding real property at Old Tote Road.

affordable-housingreal-estatetown-meetingzoningcommunity-development
✓ Decided: Board reviews housing projects, discusses comprehensive plan, votes to enter executive session

The Affordable Housing Trust Board heard project updates on several developments, including a Certificate of Occupancy expected in late April for 19 West Road and 65% completion at 107 Main St. The Board discussed the Comprehensive Plan's housing goals, with members suggesting language changes and priorities. No formal votes were taken on substantive matters; the Board approved prior minutes and voted unanimously to enter executive session to discuss real property at 22 Old Tote Road.

Tue Mar 18, 2025

Snow Library Board of Trustees

Snow Library Marion Craine Gallery Committee to review exhibit schedule

The Marion Craine Gallery Committee will meet to review the gallery schedule and receive financial and director reports. The board will also vote on the approval of the February 18, 2025 meeting minutes.

libraryartsgalleryorleans
✓ Decided: Snow Library gallery committee approves minutes, hears library update

The Marion Craine Gallery Committee approved the February minutes and received reports on finances and the library director's update. No substantive decisions were made beyond routine approvals and scheduling.

Tue Mar 18, 2025

Conservation Commission

Conservation Commission to review Orleans Comprehensive Plan with assistant planner

The commission will consider continuations of three coastal buffer zone projects and conduct administrative reviews of two properties. They will also discuss the Orleans Comprehensive Plan, vote on a response to an encroachment on Peck Conservation Area, and review the Kents Point petition.

conservationcoastal-bufferwetlandsinvasive-speciescomprehensive-planencroachmentpetitions
✓ Decided: Conservation Commission approves pool project at 25 Primrose Lane with conditions

The Orleans Conservation Commission approved a pool and hardscaping project at 25 Primrose Lane (7-0), with special conditions including off-site pool water removal, additional canopy trees, and a July 15 planting deadline. The commission also continued hearings for projects at 317 S. Orleans Rd and 54 Tonset Rd, and approved administrative reviews for tree removal and deck replacement. No substantive decisions were made on the Kents Point petition, only advisory motions.

Tue Mar 18, 2025

Fourth of July Committee

Orleans Fourth of July Committee reviews 2025 parade timeline

The committee will approve minutes from January and February 2025, then review the 2025 parade timeline and other business. The meeting includes standard old and new business items and adjournment.

paradecommitteeorleans
Mon Mar 17, 2025

Orleans School Committee

School Committee to hold FY26 budget hearing and vote

The Orleans School Committee will conduct a public hearing on the FY26 budget, followed by discussion and a vote. The agenda also includes an update on the FY26 budget and consideration of amended articles of agreement for the Cape Cod Collaborative.

school-committeebudgetpublic-hearingcape-cod-collaborativeexpenditure-report
✓ Decided: Orleans School Committee approves $6.4M FY26 budget, 6.03% increase

The Orleans Elementary School Committee approved the FY26 budget of $6,412,058, a $364,815 (6.03%) increase over FY25, after reclassifications from the Region-Only budget. The committee also voted to adopt the Cape Cod Collaborative's Amended Articles of Agreement to allow Plymouth to join. The meeting included a public hearing on the budget and a report on the ongoing campus feasibility study.

Thu Mar 13, 2025

Finance Committee

Finance Committee to vote on $3,802 transfer, discuss tax exemption petition

The Orleans Finance Committee will consider approving a $3,802 reserve fund transfer to cover depleted town unemployment benefits. They will discuss a potential citizen's petition for a resident tax exemption on the May Town Meeting warrant. Reports will be given on The Green Center, urine diversion systems, and the state revolving fund for wastewater. The committee will also approve minutes from February 27 and set upcoming meeting dates.

finance-committeeorleansreserve-fundunemploymenttax-exemptioncitizen-petitionwastewatergreen-center
✓ Decided: Finance Committee approves $3,802 unemployment fund transfer

The Orleans Finance Committee approved a $3,802 Reserve Fund Transfer to replenish depleted town unemployment benefits, and an $11,000 transfer for environmental health support staff. They also discussed a proposed Citizens' Petition for a Residential Tax Exemption but took no action. Minutes from 2/27/2025 were approved.

Thu Mar 13, 2025

Architectural Review Committee

Architectural Review Committee to review signs and Comprehensive Plan goals

The Architectural Review Committee will meet to discuss sign installations and relocations for local businesses. The committee is also scheduled to review the goals, objectives, and actions of the Orleans Comprehensive Plan.

signscomprehensive-planzoningarchitecture
✓ Decided: ARC approves two signs, discusses comprehensive plan update

The Architectural Review Committee approved signage for Community Development Partnership at 180 Rte 6A and for Wild Water Collective at 85 Rte 6A #1, both unanimously. The committee also discussed the Orleans Comprehensive Plan update with Planning Board staff, focusing on design guidelines, housing, and community design goals, but took no formal action on the plan.

Thu Mar 13, 2025

Energy & Climate Action Committee

Committee to vote on forwarding decarbonization letter to Select Board

The Energy and Climate Action Committee will vote on forwarding a Letter of Commitment to Decarbonize Municipal Buildings and Operations by 2050 to the Select Board. The committee will also appoint a member to review Comprehensive Plan goals with the Planning Committee, receive an update from the Assistant Town Manager, review 2025 Goal Sheets, and hear liaison reports from various boards.

energyclimate-actiondecarbonizationmunicipal-buildingsselect-boardcomprehensive-plangoal-review
✓ Decided: Committee votes to urge Select Board to commit to decarbonization by 2050

The Energy and Climate Action Committee unanimously approved sending a letter to the Select Board recommending a public commitment to decarbonize municipal buildings and operations by 2050. The committee also reviewed goal sheets for seven prioritized goals, added members to work groups, and approved the February 13 minutes. No other formal decisions were made; the meeting included reports and discussions on various energy and climate topics.

Wed Mar 12, 2025

Finance Committee

Joint public hearing on FY26 budget and capital plan

The Finance Committee will hold joint public hearings on the FY26 Budget at 6 pm and on the FY27-FY31 Capital Improvement Plan and FY26 Capital Budget at 7 pm. The agenda includes only these two hearings and administrative items.

financebudgetcapital-improvementpublic-hearing
✓ Decided: Finance Committee closes FY26 budget and capital plan hearings

The Orleans Finance Committee held joint public hearings with the Select Board on the FY26 Operating Budget and the FY26-FY31 Capital Improvement Plan (CIP) and FY26 Capital Budget. The committee voted 8-0 to close both hearings, with no formal approval or denial of the budgets. The FY26 budget is balanced at $64,536,334 in revenues and expenses, and the FY26 capital budget totals $98,009,034, including a $45 million fire-rescue station project.

Wed Mar 12, 2025

Historical Commission

Public hearing on demolition of significant building at 15 Namskaket Road

The Orleans Historical Commission will hold a public hearing on a Notice of Intent to Demolish a Significant Building at 15 Namskaket Road. They will also discuss an archeology project update, the Main Street East Orleans sidewalk/bike lane project, and set future direction for the Demo Delay Bylaw. Other agenda items include updates on an upcoming meeting with the Planning Board and the Historic District Committee.

historical-commissionpublic-hearingdemolitionhistoric-preservationarcheologysidewalk-projectbike-lane
✓ Decided: Historical Commission allows partial demolition at 15 Namskaket Road

The Orleans Historical Commission voted 5-0 to allow the partial demolition of the house and barn at 15 Namskaket Road, determining that the portions proposed for removal are not preferably preserved under the Demolition Delay Bylaw. The owner plans to remove the 1960s addition and part of the barn, then build a two-story addition and replicate the barn. The Commission also discussed future direction for the Demolition Delay Bylaw, including a proposed 18-month delay, and next steps for public education.

Wed Mar 12, 2025

Select Board

Select Board to hold public hearings on FY26 budget and capital plans

The Select Board and Finance Committee will hold joint public hearings regarding the FY26 Budget and the FY27-FY31 Capital Improvement Plan. The board will also consider a Chapter 40B Local Initiative Program application and a liquor license request.

budgetcapital-improvement-planhousingliquor-licensezoning
✓ Decided: Select Board endorses 17-unit affordable housing at former Governor Prence site

The Select Board voted unanimously to endorse the Housing Assistance Corporation and Habitat for Humanity's 17-homeownership-unit project at 66 & 76 Route 6A under the state's Local Initiative Program, authorizing a letter of support. The board also approved the Native Planting Resolution 4-1, with an amendment to exempt planters failing. Several committee appointments and resignations were accepted, and a one-day liquor license for Lower Cape TV was approved.

Tue Mar 11, 2025

Economic Development Committee

Economic Development Committee to vote on action priorities for Select Board

The Economic Development Committee will take a final vote on its action priorities, which will be sent to the Select Board and other town committees. The committee will also discuss municipal grant programs for small businesses and community events. Updates include a staff report and a wastewater management advisory committee update on the sewer project.

economic-developmentcommittee-prioritiesmunicipal-grantssewer-projectstaff-update
✓ Decided: EDC approves action priorities for Select Board

The Orleans Economic Development Committee unanimously approved its action priorities to be submitted to the Select Board. The committee also approved the minutes from the February 11, 2025 meeting. No public comment was received, and the Wastewater Management Advisory Committee did not attend due to a scheduling conflict.

Tue Mar 11, 2025

Cultural Council

Orleans Cultural Council plans April Art Show and election of officers

The Orleans Cultural Council will discuss the April reorganization meeting and election of officers, and plan the April Art Show. They will also hear a treasurer report and a Cultural District Report. The meeting includes approving minutes from the previous meeting.

cultural-councilartsgrantstown-meetingorleansmassachusetts
✓ Decided: Council approves $500 for Bogogenesis Art Week event

The Orleans Cultural Council approved a $500 sponsorship for Bogogenesis, an Art Week event, and set dates and tasks for the April student art show. The council also approved minutes from the February meeting and discussed extending a member's service.

Tue Mar 11, 2025

Select Board

Select Board holds FY26 budget workshop

The Select Board will conduct a workshop on the Fiscal Year 2026 budget and review town financial policies. The agenda is a discussion session with no votes or public hearings listed.

budgetfinancial-policiesselect-boardorleans
✓ Decided: Select Board reviews financial policies and FY26 draft budget

The Select Board met on March 11, 2025, and discussed changes to financial procedures for future purchases, general reserves, and the Capital Improvement Plan. They also reviewed the draft FY26 budget, asking questions about changes and increases, with further discussions planned. No formal decisions were made on these items; the meeting adjourned with a 5-0 vote.

Tue Mar 11, 2025

Board of Assessors

Assessors to discuss abatements, exemptions, and sales reports

The Orleans Board of Assessors will meet on March 11, 2025, to review motor vehicle and boat abatement reports, approve minutes, and hear the monthly sales report. The board will then enter executive session to discuss real estate exemptions, personal property abatements, real estate abatements, and Chapter 61 applications under confidentiality rules.

assessorsabatementsexemptionsmotor-vehicleboatreal-estatepersonal-propertychapter-61
✓ Decided: Board approves 68 tax abatements totaling over $10,200

The Orleans Board of Assessors approved multiple motor vehicle and boat excise tax abatements for 2024 and 2025, totaling $10,261.51. They also approved an abatement of unpaid real estate taxes and CPA surcharge for a town-owned parcel at 6 Cedar Pond Rd. All votes were unanimous (3-0).

Tue Mar 11, 2025

Council on Aging

Council on Aging to vote on Town Meeting Article for FY26 funding request

The Orleans Council on Aging Board will discuss the FY26 budget update and then vote on whether to submit a Town Meeting Article for a funding request. The meeting is a special session focused on budget and funding needs.

council-on-agingbudgetfundingtown-meeting-articlefinance
Tue Mar 11, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee to review latest draft of Orleans Comprehensive Plan

The Shellfish & Waterways Improvement Advisory Committee will receive a presentation on the latest draft of the Orleans Comprehensive Plan from the town planner and a Planning Board member. The body will also receive updates on aquaculture regulations and temperature regulations in Eastham.

aquaculturecomprehensive-planshellfishwaterwaysenvironmental-regulations
✓ Decided: Committee hears updates on herring count, Eastham temp rules, aquaculture regs

The Orleans Shellfish & Waterways Improvement Advisory Committee met on March 11, 2025, and heard reports on the Orleans Comprehensive Plan, herring run plans, and updates on Eastham's new temperature restrictions for shellfishing. The committee accepted the February minutes unanimously and received updates on aquaculture regulations, red tide sampling, and the Rock Harbor project. No formal decisions were made beyond approving the minutes.

Thu Mar 6, 2025

Community Preservation Committee

CPC to vote on FY26 budget allocations and hear project updates

The Community Preservation Committee will consider and possibly vote on some or all allocations for the FY26 budget article. The meeting also includes updates on a wide range of projects, from housing and historic preservation to open space and recreational improvements. A public comment period and approval of prior minutes are also on the agenda.

community-preservationbudgethousingopen-spacehistoric-preservationaffordable-housingprojects-update
✓ Decided: CPC approves FY26 budget article with Toop Trust clarification

The Community Preservation Committee voted unanimously to approve the FY26 budget article as written, including a clarification regarding the Toop Trust. The committee also discussed bonding options for the proposed Locust Road Open Space acquisition, with one member noting the time sensitivity may have passed. Project updates were provided, including the completed acquisition of the final unbuildable lot for Cedar Pond.

Thu Mar 6, 2025

Board of Health

Board of Health to hear 4 variance requests for residential properties

The Orleans Board of Health will vote on variance requests for properties at 25 Ellerslie Road, 20 Pilgrim Lake Terrace, 25 Primrose Lane, and 17 Sparrowhawk Road, plus a deferral request for 18 West Road Condominium. Administrative items include a temporary food permit for the Orleans Chamber of Commerce and approval of minutes from prior meetings.

board-of-healthvariancepublic-healthpermitsorleans
✓ Decided: Board of Health approves four pool fence variances and a septic system variance

The Orleans Board of Health approved four swimming pool fence variances (25 Ellerslie Road, 20 Pilgrim Lake Terrace, 25 Primrose Lane, and 17 Sparrowhawk Road) and a septic system variance for 17 Sparrowhawk Road, all with conditions. They also approved an 8-month deferral for the 18 West Road Condominium sewer connection, with specific deadlines. All votes were unanimous (4-0).

Thu Mar 6, 2025

Human Services Advisory Committee

Committee to discuss funding for Outer Cape Health’s Navigator program

The Human Services Advisory Committee will meet to discuss funding for the Outer Cape Health’s Navigator program in Orleans. The committee will also hold discussions regarding grant applications.

health-servicesfundinggrantspublic-health
✓ Decided: HSAC defers Navigator grant decision pending more info

The Orleans Human Services Advisory Committee discussed the FY26 Navigator grant procurement process but deferred any decision on additional funding for Outer Cape Health's Navigator program, citing the need for more information. The committee will invite program coordinator Brianne Smith to the next meeting for clarification. The minutes from the previous meeting were approved unanimously.

Wed Mar 5, 2025

Snow Library Board of Trustees

Trustees to vote on revised capital improvements plan for new Snow Library

The Snow Library Board of Trustees will vote on a revision to the New Snow Library Orleans Capital Improvements Plan numbers. The meeting also includes reports from the chair, finance, library director, a building inspection update, and the new library building update. Public comment will be taken before any votes.

librarycapital-improvementssnow-libraryorleansboard-of-trusteespublic-meetingbuilding-inspection
✓ Decided: Trustees approve revised $41.7M library design and construction plan

The Snow Library Board of Trustees approved the town manager's revised capital improvement plan for the new library, setting $41.7 million for FY-27 for both design and construction. The board also approved the February minutes and discussed operational updates, including building inspection fixes and new programs.

Tue Mar 4, 2025

Conservation Commission

Meeting with Town Counsel on Kents Point; continuations for four coastal buffer projects

The Conservation Commission will meet with Town Counsel regarding Kents Point Conservation Area, then consider continuations for four property owners proposing work within buffer zones to wetlands, coastal banks, and the Pleasant Bay ACEC. The agenda also includes a certificate of compliance, an administrative review, a monitoring report, and routine business. Not all listed items may be discussed.

conservation-commissionwetlandsbuffer-zonecoastal-bankpleasant-bay-aceckents-pointcontinuationspublic-comment
✓ Decided: Conservation Commission approves Klink project at 10 Locust Rd with conditions

The Commission approved the Klink project at 10 Locust Rd with conditions, including plantings by 7/15/25. It also approved the Winslow boathouse repair at 2 Ewing Dr with conditions, including a winter work restriction and Chapter 91 license requirement. Two projects were continued to 3/18/25: Dead Low LLC at 317 S. Orleans Rd and Jacobson at 25 Primrose Ln. A Certificate of Compliance was issued for 75 Viking Rd, and a beach access trail was approved for 167 & 175 Namequoit Rd.

Thu Feb 27, 2025

Finance Committee

Finance Committee discusses budgets for Council on Aging, Recreation, Fire Dept

The Orleans Finance Committee will hold a hybrid meeting to discuss three department budgets with their respective directors: Council on Aging (Judi Wilson), Recreation (Tom DeSiervo), and Fire (Geof Deering). The committee will also review meeting minutes, hear public comment, and receive liaison updates. No votes are scheduled; this is a discussion-only session.

finance-committeebudgetcouncil-on-agingrecreation-departmentfire-departmentpublic-commenthybrid-meeting
✓ Decided: Finance Committee reviews COA, Recreation, and Fire budgets

The Orleans Finance Committee met on February 27, 2025, to review the Council on Aging, Recreation, and Fire Department budgets. No formal votes were taken on these budgets; the discussions were informational. The committee approved the minutes from the February 13 meeting and adjourned.

Thu Feb 27, 2025

Architectural Review Committee

ARC to discuss Rotary Club signage and Cape Cod Five bank proposal

The Orleans Architectural Review Committee will review two business proposals: the Nauset Rotary Club's request to advertise meeting location and times at 6 Route 6A, and Cape Cod Five's new location and signs at 28 South Orleans Road. The committee will also consider approving minutes from its January 9, 2025 meeting.

architectural-reviewsignageproposalsmeeting-minutes
✓ Decided: ARC approves Nauset Rotary Club sign and Cape Cod Five temporary branch signage

The Orleans Architectural Review Committee approved two sign applications: a second Nauset Rotary Club sign near the rotary, waiving paint chip review, and signage for Cape Cod Five's temporary branch at 28 So. Orleans Road. Both motions passed 4-0. The committee also approved the January 9, 2025 meeting minutes with one abstention.

Thu Feb 27, 2025

Human Services Advisory Committee

Human Services Advisory Committee to discuss grant applications

The Human Services Advisory Committee will meet to discuss old business regarding grant applications. The committee will also vote on the minutes from the February 20, 2025 meeting.

human-servicesgrantscommittee
✓ Decided: HSAC approves $171.6k in FY2026 agency funding requests

The Human Services Advisory Committee approved all 18 agency funding requests for FY2026 as a single grant bloc totaling $171.6k, with the motion passing unanimously. The committee reviewed several agencies, including Sight Loss Services, Alzheimer's Family Support, Mass Appeal, South Coast Legal Services, Duffy Health Center, Housing Assistance Corporation, and Sustainable Cape. A discussion about earmarking the remaining $28.4k unobligated balance for a specific project was deferred. The minutes from the previous meeting were also approved.

Wed Feb 26, 2025

Council on Aging

FY26 budget update and caregiver initiative on Orleans COA agenda

The Orleans Council on Aging Board will vote to approve minutes from January, discuss an appointment to Elder Services of Cape Cod, and review the January budget summary and FY26 budget. New business includes a caregiver support initiative and discussion on male participation in senior programming. Old business includes updates on the Garden Restoration Project and COA Art Committee.

council-on-agingbudgetelder-servicescaregiver-supportsenior-programminggarden-restoration
Wed Feb 26, 2025

Select Board

Select Board to hold public hearings on liquor license and pole petitions

The Select Board will vote on police promotions, the 2025 Senior Tax Work Off Program, and a fee waiver for CHO. Public hearings are scheduled for a liquor license amendment and pole petitions for Ruggles Road and Nickerson Road.

policeliquor-licenseinfrastructuretaxesappointments
✓ Decided: Select Board approves police promotions, appointments, and license changes

The Orleans Select Board unanimously approved the promotion of two police officers to sergeant, appointed three members to the Affordable Housing Trust Board, extended the bay scallop fishing season, and approved the 2025 Senior Tax Work Off Program. The board also approved several license changes and fee waivers, and supported a letter to the MA Police Accreditation Commission.

Tue Feb 25, 2025

Cultural District Committee

Cultural District Committee to hear funding opportunity from Orleans Pond Coalition

The Orleans Cultural District Committee will hear a funding opportunity presentation from the Orleans Pond Coalition and Beyond the Bounds. They will also receive updates on grants/economic development, the website, cultural assets, and Arts Week planning.

cultural-districtfundinggrantseconomic-developmentartswebsiteorleans
✓ Decided: Committee approves $2,500 for beach concert and website funds

The Orleans Cultural District Committee approved funding requests, including $2,500 for a Beyond the Bounds musical event and additional website costs. They also approved a motion to transfer leftover funds to close out two grant accounts. A request to fund the Cape Noir program was tabled until March.

Tue Feb 25, 2025

Select Board

Select Board and School Committee to discuss campus planning

The Select Board will hold a joint meeting with the Orleans Elementary School Committee to receive an update on the campus planning process. No other business is scheduled.

select-boardelementary-schoolcampus-planningjoint-meeting
✓ Decided: Select Board and School Committee hear campus planning update

The Select Board and Orleans Elementary School Committee met jointly to receive a presentation from Habeeb Associates on a capital assessment for a potential community center, elementary school, and fire station on one site. No decisions were made; the presentation was informational, and a recommendation on how to proceed is due by April 1, 2025. The meeting adjourned without substantive action.

Tue Feb 25, 2025

Orleans School Committee

Joint meeting to review program books and floor plans for three town buildings

The Orleans School Committee and Select Board are meeting jointly to review the Program Books and floor plans for three proposed municipal buildings: the Fire Station, Community Center, and Elementary School. The review will focus on outlining proposed room sizes and how rooms are arranged within each building. This is a discussion item; no votes or decisions are specified on the agenda.

schoolsfacilitiesfire-stationcommunity-centerplanningjoint-meeting
Tue Feb 25, 2025

Conservation Commission

Conservation Commission to hear proposal to raise and repair boathouse at 2 Ewing Dr

The Orleans Conservation Commission will hold an on-site meeting to discuss a Notice of Intent for the raise and repair of an existing boathouse at 2 Ewing Dr. The work involves a Coastal Bank, Salt Marsh, Land Subject to Coastal Storm Flowage, and the Pleasant Bay ACEC.

conservation-commissionnotice-of-intentcoastal-banksalt-marshcoastal-storm-flowagepleasant-bay-acecboathouse
Tue Feb 25, 2025

Veterans Committee

Veterans Committee discusses Memorial Day preparations and native American acknowledgement

The Memorial Day/Veteran’s Day Committee is meeting to coordinate holiday preparations and discuss town projects. The body will review the bid process for town references and finalize wording for a native American acknowledgement.

veterans-affairsmemorial-daypublic-workscommunity-recognition
Mon Feb 24, 2025

Marine & Fresh Water Quality Committee

Committee to discuss FY26 water quality funding and 2025 monitoring plans

The Marine and Fresh Water Quality Committee will review updates on the FY26 funding proposal and water quality data summaries. The body is planning 2025 monitoring for freshwater lakes, ponds, and estuaries. Members will also discuss the Cape Cod Freshwater Strategy Report and the Pilgrim Lake Herring Run.

water-qualityenvironmentfundingmonitoringconservation
✓ Decided: MFWQC approves Dec. 16 minutes, plans FY26 funding and monitoring

The Marine and Fresh Water Quality Committee met on February 24, 2025, and approved the December 16, 2024 meeting minutes (5-0). The committee discussed updates on its FY26 funding request, which has been submitted and is pending Select Board review, and planned for upcoming water quality monitoring, including freshwater and estuary sampling. No other formal votes were taken; most items were informational or planning discussions.

Mon Feb 24, 2025

Historical District Study Committee

Committee to discuss Marion historic district denial impact

The Orleans Historic District Study Committee will discuss the implications of a recent denial of Marion, MA's proposed local historic district, and review a revised Preliminary Study Committee Report. The meeting also includes public comment and approval of previous meeting minutes.

historic-districtstudy-committeemarionminutespublic-commentpreliminary-study
✓ Decided: Historic District Committee accepts revised Preliminary Study Report

The Orleans Historic District Study Committee reviewed and accepted its revised Preliminary Study Report, which will be posted on the committee page. The committee also discussed the Massachusetts Historical Commission's denial of Marion, MA's similar 40C historic district bylaw, noting that Orleans would need to pursue a Special Act route. No public comment was received, and the minutes from the previous meeting were approved as amended.

Thu Feb 20, 2025

Human Services Advisory Committee

Human Services committee to interview three grant applicants

The Human Services Advisory Committee will conduct in-person interviews with three organizations seeking grants: Lower Cape Outreach Council, Outer Cape Health, and Aids Support Group. The committee may also discuss grant applications under old business. Minutes from the previous meeting will be voted on.

human-servicesgrantspublic-meetinglower-cape-outreach-councilouter-cape-healthaids-support-group
✓ Decided: Committee hears agency presentations, discusses $200K distribution

The Orleans Human Services Advisory Committee heard presentations from Lower Cape Outreach Council, Outer Cape Health Services, and Aids Support Group of Cape Cod. The committee discussed the $200,000 line item for distribution, with about $173,000 in requests, and considered whether to offer supplemental funds to agencies, such as an additional $20,000 to re-establish the Community Resource Navigator Program at the Orleans Police Station. No funding decisions were made; the committee will consult with procurement officials next week. The minutes from the previous meeting were approved unanimously.

Wed Feb 19, 2025

Board of Water & Sewer Commissioners

Board to consider flow abatement request at 2 Academy Place

The Board of Water/Sewer Commissioners will hold a hybrid meeting to discuss a flow abatement request for 2 Academy Place, a sewer connection deferral for 18 West Rd, and FOG variance requests for 96 and 87 Route 6A. The board will also receive department reports including a Veolia operating report for January 2025, a wastewater infrastructure update, a drought update, and an HVAC grant update. New business includes proposed sewer charge commitments/abatements for multiple properties and a drain layers license renewal.

watersewerflow-abatementfog-varianceveoliadroughtwastewatersewer-connection
✓ Decided: Board approves sewer deferral, FOG variances, and show-cause notice

The Board of Water and Sewer Commissioners voted unanimously to recommend an 8-month sewer connection deferral for 18 West Road, approved two FOG variance requests (98 Route 6A and 87 Route 6A), and issued a show-cause notice to 54 Main Street for FOG non-compliance. They also continued the flow abatement request for 2 Academy Place to March 5, 2025, and approved monthly commitments and abatements.

Wed Feb 19, 2025

Open Space Committee

Open Space Committee to discuss its charge and get CPC update

The Orleans Open Space Committee will meet to discuss its own charge and receive an update from the Community Preservation Committee (CPC). The agenda includes public comment and scheduling of the next meeting, but no votes or concrete proposals are listed.

open-spacecommunity-preservationprocedural
✓ Decided: Open Space Committee's CPC funding requests denied

The Orleans Open Space Committee learned that both of its applications to the Community Preservation Committee were denied. The committee agreed to keep 'Open Space' as the focus of its charge and discussed ways to communicate its values to the community. The minutes from the January 15, 2025 meeting were approved.

Tue Feb 18, 2025

Fourth of July Committee

Orleans Fourth of July Committee to review 2025 parade timeline

The committee is meeting to discuss the 2025 parade timeline and theme. Members will also consider suggestions for the Grand Marshall.

community-eventsparadeplanning
Tue Feb 18, 2025

Affordable Housing Trust Fund Board

Orleans AHTB to consider purchase of Locust Road and Old Tote Road for housing

The Affordable Housing Trust Board will meet to discuss project updates, including 19 West Road and 107 Main Street, and consider a vote to enable staff to act on routine matters. The board will also discuss the regional 'Ready Renters' program and a potential vote to support year-three participation in the Shared Regional Housing Service Office. An executive session is scheduled to consider the purchase of properties on Locust Road and Old Tote Road for low- and moderate-income housing.

affordable-housinghousing-trustproperty-purchaseexecutive-sessionhousing-authorityready-rentersregional-housing-service
✓ Decided: Orleans AHTB votes to join regional housing service office

The Orleans Affordable Housing Trust Board voted 6-0 to join the Shared Regional Housing Service Office for one year, with funding up to $20,000 from non-Trust sources if possible, otherwise from the Trust. The board also voted 6-0 to allow Planning Department staff to act on routine or urgent matters in consultation with the Trust. Project updates were given for several affordable housing developments, and the board entered executive session to discuss property at Locust Road and Old Tote Road.

Tue Feb 18, 2025

Snow Library Board of Trustees

Snow Library gallery committee meets for routine reports and schedule review

The Marion Craine Gallery Committee will hold a regular meeting to approve previous minutes, hear financial and director's reports, and review the gallery schedule. No major decisions or public hearings are listed, only standard procedural items.

librarygallerycommitteemeetingsnow-library
✓ Decided: Gallery committee approves January minutes, hears lighting update

The Marion Craine Gallery Committee approved the January 21, 2025 meeting minutes with one edit. The library director reported no financial changes, with the account balance remaining at $1,643.99. The committee discussed recommended lighting changes for the gallery, which may require rewiring and an electrician, potentially funded by the Friends of Snow Library. The gallery is booked through July, with no pending applications.

Tue Feb 18, 2025

Board of Assessors

Board of Assessors to review tax abatements and exemptions

The Board of Assessors will meet to review motor vehicle and boat abatement reports and a monthly sales report. The board will enter executive session to discuss real estate exemptions, Chapter 61 applications, and personal property and real estate abatements.

taxesassessorsabatementsexemptionschapter-61
✓ Decided: Board approves 11 MV excise abatements totaling $2,254.13

The Orleans Board of Assessors approved multiple motor vehicle excise tax abatements and commitments, denied five abatements for vehicles disposed after December 1, and approved an abatement of unpaid taxes for the town-acquired parcel at 72 Tonset Rd. The board also agreed to submit two draft warrant articles for the 2025 Annual Town Meeting to increase disabled veterans' property tax exemptions. Minutes from previous sessions were approved.

Tue Feb 18, 2025

Conservation Commission

Invasive species management and water access path proposed at 54 Tonset Rd

The Orleans Conservation Commission will hear a Notice of Intent for invasive species management, a 4-foot water access path, and a 200 sq ft landing area at 54 Tonset Rd. They will also consider a continuance request for raising and repairing a boathouse at 2 Ewing Dr. Certificates of Compliance will be reviewed for pier reconstruction at 75 Viking Rd and invasive species removal at 13 Weeset Proprietor's Wy. The Commission will vote on Putnam Farm Rules and discuss the Kents Point Environmental Assessment draft report.

conservationinvasive-specieswetlandscoastal-banksalt-marshpermitpublic-hearingcertificate-of-compliance
✓ Decided: Conservation Commission continues two wetland hearings, approves compliance certificates

The Orleans Conservation Commission continued two public hearings: one for invasive species management and water access at 54 Tonset Rd, and another for raising and repairing a boathouse at 2 Ewing Dr. The Commission also approved Certificates of Compliance for projects at 75 Viking Rd and 13 Weeset Proprietor's Way, and approved the Putnam Farm Rules document. All votes were unanimous (7-0).

Thu Feb 13, 2025

Finance Committee

Finance Committee to review budget and a $14,067.97 Reserve Fund transfer

The Finance Committee will conduct a budget review with Town Manager Kim Newman. The body will also consider a specific fund transfer for veterans benefits and discuss the committee's future goals.

budgetveterans-benefitsfinance
✓ Decided: Finance Committee approves $14,067.97 for Veterans Benefits

The Orleans Finance Committee approved a $14,067.97 Reserve Fund Transfer for Veterans Benefits, covering costs for three veterans instead of one. The committee also reviewed the FY26 budget with the Town Manager, discussing housing, staffing, short-term rentals, and other fiscal topics. No other formal votes were taken.

Thu Feb 13, 2025

Energy & Climate Action Committee

Committee to discuss eliminating on-site fossil fuel in municipal operations by 2050

The Energy and Climate Action Committee will discuss a commitment to eliminate on-site fossil fuel use in municipal buildings and operations by 2050. The committee will also vote to approve its 2025 Goals and review goal sheets. Updates will be provided on the Orleans Climate Action Network and from the Assistant Town Manager. A presentation on the Specialized Energy Code and a factsheet on Climate Leader Community Grants are also scheduled.

climate-actionenergyfossil-fuelsmunicipal-buildingsgoalsgrantsorleans
✓ Decided: Orleans energy committee adopts 2025 goals, backs decarbonization letter

The Energy and Climate Action Committee unanimously adopted its 2025 goals, which include pursuing the Specialized Energy Code, municipal decarbonization, and Climate Leader Community status. The committee also discussed a draft letter recommending the Select Board commit to decarbonizing municipal buildings by 2050, to be considered at the next meeting. No final votes were taken on the letter or the Specialized Energy Code.

Thu Feb 13, 2025

Human Services Advisory Committee

Human Services Advisory Committee to interview grant applicants

The committee will conduct interviews with grant applicants for homeless prevention and Independence House. Members will also continue discussing the HSAC mission statement.

grantshomelessnesshuman-servicescommunity-support
✓ Decided: HSAC approves revised committee charge, sends to director

The Orleans Human Services Advisory Committee unanimously approved a revised committee charge and sent it to Health & Human Services Director Alex Fitch for review. They also unanimously approved removing the appendices section from the FY26 Human Services funding application form. The committee heard presentations from the Homeless Prevention Council and Independence House, both seeking funding, but took no action on their requests.

Wed Feb 12, 2025

Historical Commission

Historical Commission discusses demolition delay bylaw and historic district status

The Orleans Historical Commission will discuss the demolition delay bylaw, including its status and next steps, and review a proposal from Charles. They will also discuss historic district status and next steps, and receive reports on an archaeology project and a CPC report. The meeting includes public comment and approval of minutes; no votes or binding decisions are scheduled.

historical-commissiondemolition-delayhistoric-districtarchaeologycpcorleans
✓ Decided: Historical Commission reaffirms MACRIS database as significant buildings list

The Orleans Historical Commission voted 5-0 to reaffirm its policy that properties in the Massachusetts Historical Commission's MACRIS database are considered significant buildings under the Demolition Delay Bylaw, and will transmit this to Town Counsel. A proposed bylaw change that would consider buildings 75+ years old as historic, extend the delay to 18 months, and remove Select Board appeal failed 0-3-2. The Commission also discussed the Main Street project, historic district status, and an archeology project.

Wed Feb 12, 2025

Housing Authority

Housing Authority to award septic replacement contract for 53 Meetinghouse Road

The Orleans Housing Authority will meet to review financial and director reports and approve project completions. The board will consider awarding a contract for septic replacement and discuss the search for an Executive Director.

housingcontractsinfrastructurepersonnel
Wed Feb 12, 2025

Transportation and Bikeways Advisory Committee

Complete Streets Prioritization Plan discussion to guide project funding

The committee will discuss the Complete Streets Prioritization Plan and its impact on decision-making, planning, and funding, as well as hear updates on Main Street and Beach Road planning. They will also debrief with the Select Board and discuss the inclusion of 'Cape Cod berm' in paving plans.

transportationbikewayscomplete-streetspavingplanningselect-board
✓ Decided: Committee reviews Beach Road sidewalk options, Main Street phasing

The committee discussed feedback from the Select Board on two Old Colony and two Main Street design options, and reviewed a letter requesting a 5-foot sidewalk on both sides of Beach Road. No formal votes were taken; the meeting focused on updates and planning for future warrant articles.

Tue Feb 11, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee to consider bay scallop season extension, cold temperature restrictions

The Shellfish & Waterways Improvement Advisory Committee will discuss a request to extend the 2025 bay scallop season and receive an update on cold temperature restrictions affecting shellfish harvesting. The agenda also includes public comment with reminders on conflict of interest training and a fertilizer/pesticide petition update, as well as a request from the Orleans Pond Coalition to participate in a water celebration event. Regular reports from the Natural Resources Manager and Select Board Liaison are scheduled.

shellfishscallop-seasonharvesting-restrictionsfertilizer-pesticidepublic-hearingwater-qualityorleansmarine-resources
✓ Decided: Committee backs bay scallop season extension request to DMF

The committee voted to support extending the 2025 bay scallop season and requested the selectboard send a letter to DMF. The vote passed with two members abstaining due to fishery involvement. Other updates included progress on Rock Harbor work and a new osprey pole.

Tue Feb 11, 2025

Select Board

Select Board to discuss and vote on FY26 budget, capital plan, and financial policies

The Select Board will discuss the FY26 Capital Budget and CIP, the overall town budget, and review financial policies. They will vote on adopting the financial policies and transmitting the FY26 budget to the Finance Committee. The board will also consider a one-day entertainment license for Town Cove Tap House and a modification to a temporary closure request for Nauset Gastronomy dba The Rail.

budgetcapital-planfinancial-policieslicensingselect-board
Tue Feb 11, 2025

Economic Development Committee

EDC to produce final draft on committee action priorities

The Economic Development Committee is meeting to review staff and Chamber of Commerce updates. The committee will work on a final draft of action priorities based on updates from various working groups.

economic-developmentcommunity-planningtourism
✓ Decided: EDC approves Jan. 14 minutes, discusses festival and broadband

The Orleans Economic Development Committee approved the January 14, 2025 meeting minutes unanimously. Members discussed the success of the Outermost Roots and Blues Festival, which generated over $400K for Cape Cod businesses and $1.5M in incremental commerce, and confirmed its approval for October 10-12, 2025. The committee also reviewed updates on broadband improvements, including a $250M grant for fiber optic service to Nauset Beach, and outlined future focus areas for business development and ecosystem support.

Tue Feb 11, 2025

Conservation Commission

Conservation Commission reviews water access project at 54 Tonset Rd

The Conservation Commission is holding an on-site meeting to review a Notice of Intent for 54 Tonset Rd. The body will discuss proposed land use changes within protected buffer zones and wetlands.

conservationwetlandswater-accessenvironmental-review
Tue Feb 11, 2025

Cultural Council

Orleans Cultural Council to discuss Arts Week and town mural project

The Cultural Council will review grant updates and the distribution of award letters. Members will discuss planning for an April art show and potential program funding for Arts Week.

artsgrantsculturecommunity-events
✓ Decided: Orleans Cultural Council approves minutes, plans April art show

The Orleans Cultural Council approved the minutes from its January 14, 2025 meeting. The council discussed plans for an April art show, proposing dates for artwork pickup, installation, and a reception, with further details to be finalized at the March meeting. No grant awards or other substantive decisions were made; the meeting focused on administrative updates and event planning.

Mon Feb 10, 2025

Orleans School Committee

School Committee reviews FY26 budget, wellness policy first reading

The Orleans School Committee will discuss the FY26 budget and review the FY25 expenditure report. The committee also holds a first reading of the NPS ADF Wellness Policy. Other items include declaring surplus property and approving prior meeting minutes.

school-committeebudgetwellness-policyfiscal-year-2026expenditure-reportsurplus-propertyminutes-approval
✓ Decided: Orleans School Committee approves Wellness Policy update

The Orleans Elementary School Committee approved the NPS ADF Wellness Policy in form only, with all members voting in favor. The committee also reviewed the FY25 expenditure report and discussed the FY26 budget, noting a 3.99% increase in Version 3. No gifts, grants, or surplus items were approved.

Thu Feb 6, 2025

Community Preservation Committee

Committee to vote on FY26 Community Preservation allocations after public hearing

The Community Preservation Committee will hold a public hearing to gather community feedback on projects and needs for the FY26 Community Preservation Plan. Following the hearing, members will review legal clarifications and reserves, and may vote on allocations for the FY26 budget article. The meeting also includes approval of prior minutes.

community-preservationpublic-hearingbudgetallocationsfy26orleans
✓ Decided: CPC approves $948,780 in FY26 grants, including $400K for affordable housing

The Community Preservation Committee voted 7-2 to approve FY26 grant allocations totaling $948,780, including $400,000 for the Affordable Housing Trust, full funding for the CHO protective structure for the CG36500 vessel, and no funding for the Open Space acquisition at 32 Locust Road. The committee also agreed to withdraw a consultant application and fund $5,000 for a consultant as an administrative expense. The public hearing was closed unanimously.

Thu Feb 6, 2025

Board of Health

Board of Health to hear variance at 25 Primrose Lane and Phase 1 connection compliance

The Board of Health will hold public hearings on a variance request at 25 Primrose Lane, an extension request at 20 South Orleans Road, and an approval request at 33 Clayton Circle. The board will also consider disposal works installer licenses for two companies and meet jointly with the Board of Water and Sewer Commissioners to discuss the Phase 1 connection compliance date.

healthvarianceswater-sewerlicensingpublic-hearingsorleans
✓ Decided: Board of Health approves sewer hookup extension for 20 South Orleans Road

The Orleans Board of Health approved a sewer connection extension for 20 South Orleans Road, contingent on removal of water service, and approved a basement wet bar pump at 33 Clayton Circle with plumbing inspector sign-off. Two disposal works installer licenses were also approved. The variance request for 25 Primrose Lane was continued to March 6, 2025.

Thu Feb 6, 2025

Board of Water & Sewer Commissioners

Water Board and Health Board to discuss Phase 1 connection compliance

The Board of Water/Sewer Commissioners will hold a hybrid special joint meeting with the Board of Health to discuss Phase 1 connection compliance. No votes or decisions are listed; only discussion is scheduled.

watersewerhealthcompliancejoint-meeting
✓ Decided: Joint board sets plan to enforce sewer connection compliance by March 16

The Board of Water and Sewer Commissioners and the Board of Health held a joint meeting to discuss enforcement for properties that have not connected to the sewer system by the March 16, 2025 deadline. They agreed to send certified letters to 67 noncompliant properties starting March 17, 2025, requiring them to attend show-cause hearings in April. The Board of Health may issue fines, which could block beach and transfer station stickers and other licenses, with daily fines if compliance is not met within 30 days after the hearing. No formal votes were taken on the enforcement plan during this discussion.

Thu Feb 6, 2025

Human Services Advisory Committee

Committee to interview grant applicants from Family Pantry and Food 4 Kids

The Human Services Advisory Committee will conduct in-person interviews with grant applicants from Family Pantry and Food 4 Kids. The committee will also discuss the applicant interview process and deadlines, and continue working on its mission statement. Minutes from the January 30, 2025 meeting are scheduled for approval.

human-servicesgrantsfood-pantryfood-4-kidsmission-statementinterviews
✓ Decided: Committee hears food program updates; press-contact motion fails

The Orleans Human Services Advisory Committee heard presentations from The Family Pantry of Cape Cod and Food 4 Kids, and confirmed its $200k FY2026 budget request will be included in the Health and Human Services Department budget. A motion requiring committee approval before members contact the press about committee business failed with 2 ayes and 2 abstentions. The committee approved the previous meeting's minutes and adjourned.

Wed Feb 5, 2025

Select Board

Select Board to vote on transmitting FY26 budget to Finance Committee

The Select Board will discuss and possibly vote on transmitting the FY26 budget to the Finance Committee. They will also vote on a Purchase and Sale Agreement for 10 Cedar Pond Rd. Other items include a police MOA recommendation, Cape Cod Commission presentation, and nominations for the Cape Cod National Seashore Advisory Commission.

budgetfinancepolicereal-estatecape-cod-commissionpublic-hearing
✓ Decided: Select Board approves police comp-time MOA, festival dates, land purchase

The Select Board unanimously approved a memorandum of agreement with the Orleans Police Federation allowing extra compensatory time for Sgt. William Norton, set dates for the 2025 Outermost Roots and Blues Music Festival, and signed a purchase and sale agreement for 10 Cedar Pond Road. The board also nominated members to the Cape Cod National Seashore Advisory Commission. Advisory updates covered road projects and Cape Cod Commission priorities, but no other binding decisions were made.

Wed Feb 5, 2025

Zoning Board of Appeals

Orleans ZBA continues hearing on non-conforming dwelling at 9 Nauset Road

The Zoning Board of Appeals holds a public hearing on three continued applications for special permits related to non-conforming structures. Cases include razing and replacing a non-conforming dwelling, constructing a guest house that exceeds building coverage limits, and adding a second floor and decks to an existing structure. The board will also review minutes from the January 15 meeting.

zoningspecial-permitnon-conformingpublic-hearingorleans
✓ Decided: ZBA approves three special permits for non-conforming properties

The Orleans Zoning Board of Appeals unanimously approved three special permits for property owners seeking to modify or replace non-conforming structures. The permits allow a dwelling replacement at 9 Nauset Road, a guest house at 15-17 High Street, and a second-floor addition at 9 Gull Lane, all with conditions as noted.

Wed Feb 5, 2025

Snow Library Board of Trustees

Snow Library Trustees to vote on children's area computers recommendations

The Snow Library Board of Trustees will meet to approve minutes from January and discuss reports. A key agenda item is a vote on recommendations for the children's area computers. The meeting also includes reports from the Chair, Financial Director, and Library Director.

librarytrusteeschildrencomputersbudgetpublic-meeting
✓ Decided: Trustees pause new library project, await Spring Town Meeting decision

The Snow Library Board of Trustees discussed a roadmap for a new library with the town manager, who suggested seeking design funds at Fall Town Meeting 2025. However, trustees agreed to temporarily pause the project and reassess after Spring Town Meeting 2025, with no formal vote taken. They also discussed removing children's area computers due to behavioral issues, but no decision was made.

Wed Feb 5, 2025

Board of Water & Sewer Commissioners

Public hearing on betterment abatement for 39 Cove Road

The Board of Water/Sewer Commissioners will hold a betterment abatement hearing for 39 Cove Road, consider a deferral request for 20 South Orleans Rd, and receive department reports. The meeting also includes approval of January 15, 2025 minutes and old/new business.

watersewerbettermentabatementpublic-hearingdeferralorleans
✓ Decided: Board denies sewer abatement for 39 Cove Road, recommends deferral for 20 South Orleans Road

The Board denied a sewer betterment abatement request for 39 Cove Road, finding no miscalculations or discrepancies in water use data. It also voted to recommend a two-year sewer connection deferral for 20 South Orleans Road to the Board of Health.

Tue Feb 4, 2025

Select Board

Select Board to hold FY26 Budget and CIP Workshop

The Select Board will meet to conduct a workshop regarding the Fiscal Year 2026 budget and the Capital Improvement Program (CIP).

budgetcapital-improvement-programfinance
Tue Feb 4, 2025

Conservation Commission

Commission to review pool, retaining wall, and septic projects near coastal buffers

The Orleans Conservation Commission will hold a public meeting to review multiple Notice of Intent applications for projects within the 100-foot buffer zone to coastal banks and wetlands, including pools, retaining walls, dormers, and septic systems. Also scheduled are a continuation request for a boathouse repair, a certificate of compliance for a lapsed order, and an administrative review for tree removal. The meeting includes public comment and approval of prior minutes.

conservation-commissioncoastal-bufferwetlandsnotice-of-intentpublic-hearingpleasant-bay-accessseptic-systemstree-removal
✓ Decided: Conservation Commission approves 36 Crystal Lake Dr project with conditions

The Orleans Conservation Commission approved the project at 36 Crystal Lake Drive (dormers, deck, septic system) with special conditions including gutters directed to drywells, a no-mow native shrub buffer, and transplanting impacted shrubs. The Commission continued hearings for two other projects (Dead Low LLC and Jacobson) to 3/4/25, and approved a Certificate of Compliance for 3 Norseman Dr and tree removal at 136 Portanimicut Rd.

Mon Feb 3, 2025

Affordable Housing Trust Fund Board

Orleans AHTB to vote on Land Disposition Agreement for 66 and 76 Route 6A

The Affordable Housing Trust Board will meet to consider an executive session on the purchase or lease of properties at 66 and 76 Route 6A and Locust Road. The board will then hold a public comment period, vote on a Land Disposition Agreement for those Route 6A properties, and discuss and possibly vote on supporting a development by POAH/HAC/Habitat at the same location. An update on membership of the Trust and Housing Committee is also scheduled.

affordable-housingreal-estateexecutive-sessionland-dispositionroute-6aorleans
✓ Decided: Board approves land disposition agreement for 66-76 Route 6A

The Affordable Housing Trust Board voted 5-0 to execute the Real Property Disposition Agreement for the property at 66 and 76 Route 6A, as approved by the Select Board on January 22, 2025, with minor grammatical amendments by Town Counsel, and authorized Vice Chair Mathison to sign. The board also entered executive session to discuss the purchase, exchange, lease, or value of that property and Locust Road, reconvening with no report on Locust Road. No public comments were offered, and the meeting adjourned.

Mon Feb 3, 2025

Orleans School Committee

School Committee to review OES programming report from TGAS

The Orleans School Committee will meet to discuss a programming report for OES presented by Ted Galante of TGAS. The discussion will cover shared files, school questionnaire responses, and a proposed program book.

educationschool-planningoes
✓ Decided: School committee reviews site planning for Eldredge Parkway project

The Orleans School Committee met on February 3, 2025, and heard a presentation from TGAS founding principal Ted Galante on the ongoing programming study for the Eldredge Parkway site, which includes the fire station, elementary school, and proposed recreation center. No formal decisions were made; the committee discussed the questionnaire process, space planning, and upcoming public meetings. The meeting adjourned without any votes or approvals.

Thu Jan 30, 2025

Affordable Housing Trust Fund Board

Board to vote on land agreement for 66 and 76 Route 6A

The Affordable Housing Trust Board will meet to discuss and vote on a Land Disposition Agreement for properties at 66 and 76 Route 6A. The board will also consider support for development at those locations by POAH, HAC, and Habitat.

affordable-housingreal-estateland-disposition
Thu Jan 30, 2025

Community Preservation Committee

CPC to review finances, legal recommendations, and funding proposals

The Community Preservation Committee will discuss priorities suggested by the Town Manager's office, review legal recommendations from Town Counsel, and examine finances and reserves to guide allocation decisions. The committee will also consider specific proposals and identify any additional information needed. A public hearing is scheduled for February 6.

community-preservationfinanceslegalproposalspublic-hearingorleans
✓ Decided: CPC confirms historic grants, discusses FY26 funds

The Orleans Community Preservation Committee (CPC) reviewed legal recommendations for FY26 applications and passed several motions confirming that specific grants qualify as historic preservation or open space uses. The committee also discussed FY26 funding priorities with the Assistant Town Manager, noting $1,051,195 available for allocation. No final funding decisions were made; the meeting was largely procedural and preparatory.

Thu Jan 30, 2025

Human Services Advisory Committee

HSAC interviews grant applicants for Children's Place and Elder Services

The Human Services Advisory Committee will conduct in-person and Zoom interviews with grant applicants for Children's Place and Elder Services. The committee will also discuss the applicant interviews, consider a potential revision of the HSAC mission statement, and review the revised FY2026 applicant Excel spreadsheet. Minutes from the January 23, 2025 meeting are scheduled for a vote.

human-servicesgrantsinterviewsmission-statementfy2026minutescommittee
✓ Decided: HSAC hears agency presentations, plans budget and review process

The committee heard presentations from Cape Cod Children's Place and Elder Services, noting funding challenges. They agreed to add Alzheimer Family Services to the interview schedule and to review additional applications without interviews. A $200,000 budget request for next year was presented to the Select Board. The January 23rd minutes were approved unanimously.

Wed Jan 29, 2025

Nauset Regional School Committee

Subcommittee reviews FY26 Central Office, Pre-K, OT/PT budgets

The Nauset Regional School District Central Office Budget Subcommittee will continue reviewing the FY26 Central Office Budget, as well as the Pre-K and OT/PT budgets. They will also receive an update on software expenditures. This is a working meeting with no final decisions expected.

school-budgetpre-kot-ptsoftware-updatenauset-regional
Tue Jan 28, 2025

Select Board

Select Board to hold FY26 Budget Workshop

The Select Board will meet to conduct a workshop regarding the Fiscal Year 2026 budget.

budgetfinance
Tue Jan 28, 2025

Conservation Commission

Conservation Commission to review three Notice of Intents

The Orleans Conservation Commission will hold an on-site meeting on January 28, 2025. The agenda lists three Notice of Intents: Dead Low LLC; John E & Gail M Jacobson; and Peter W & Linda E Joy, with referenced addresses at 317 S. Orleans Rd, 25 Primrose Ln, and 36 Crystal Lake Dr. The chair may discuss other items as permitted.

conservationnotice-of-intentwetlandsorleanspublic-meeting
Tue Jan 28, 2025

Cultural District Committee

Committee to vote on treasurer, review FY2025 budget

The Cultural District Committee will consider approving minutes from December 17, 2024, with a clarification to Goal 3.2. Members are scheduled to vote on appointing Craig Oliveira as Treasurer and discuss the FY2025 budget for January–June 2025. Reports from the Cultural Assets Working Group and an Arts Week update are also on the agenda.

cultural-districtbudgetappointmentsminutesarts-weektreasurer
✓ Decided: Committee approves $2,700 for website, marketing, and I Spy reprint

The Orleans Cultural District Committee approved a motion to encumber $2,700 from the FY25 MCC grant for website redesign, marketing, and I Spy reprint. They also unanimously approved the December 17, 2024 minutes as amended, appointed Craig Oliveira as Treasurer, and accepted the Treasurer's report. The committee discussed budget encumbrances and outreach strategies for Arts Week.

Tue Jan 28, 2025

Veterans Committee

Orleans Veterans Committee discusses bid process, Native American acknowledgement

The Memorial Day/Veteran's Day Committee will meet to discuss follow-up on a town bid process, a new rendition by David Hawks, and wording for a Native American acknowledgement. They will also consider potential upgrades to veterans squares and set next month's meeting date. No votes on ordinances or funding are scheduled.

veteransmemorial-daynative-american-acknowledgementtown-committeeorleans
Mon Jan 27, 2025

Historical District Study Committee

Historic District Study Committee to discuss draft preliminary report

The Orleans Historic District Study Committee will meet to discuss the draft Preliminary Study Committee Report. The agenda also includes public comment and review of minutes from previous meetings with the Historical Commission.

historic-districtstudy-committeereportpublic-comment
✓ Decided: Historic District Study Committee reviews draft report, plans pause

The Orleans Historic District Study Committee reviewed its draft Preliminary Study Report and agreed to bring it to the Select Board with an executive summary, while pausing further work unless the board shows strong support. The committee also discussed the need for public education and a constituency before proceeding with a draft bylaw. No final decisions were made on the report's content or next steps beyond these agreements.

Mon Jan 27, 2025

Marine & Fresh Water Quality Committee

Committee to decide on FY26 funding proposal

The Marine and Fresh Water Quality Committee will discuss and decide on the FY26 funding proposal. The body will also review water quality data summaries and the 2024 State of the Waters results for Orleans.

water-qualitybudgetenvironmentclimate-action
✓ Decided: Committee keeps Bakers Pond alum treatment in FY26 budget request

The Marine and Fresh Water Quality Committee voted to keep funding for an interim alum treatment of Bakers Pond in its FY26 budget request, despite public concerns. Members agreed to schedule a public meeting on the Bakers Pond Management Plan recommendations. The committee also agreed to co-sponsor a March 25 climate change program at Snow Library.

Thu Jan 23, 2025

Community Preservation Committee

New FY26 grant presentations for schoolhouse and open space projects

The Community Preservation Committee will hear presentations for new FY26 grants, including the NW Schoolhouse First Floor Restoration and open space projects on Locust Rd and Bay Ridge. The committee will also review legal and historic feedback, update finances and current projects, and approve minutes from January 9. A public hearing is scheduled for February 6.

community-preservationgrantshistoric-preservationopen-spacepublic-hearing
✓ Decided: CPC hears FY26 grant pitches, defers decisions pending legal review

The Community Preservation Committee heard presentations for three FY26 grant applications: NW Schoolhouse first-floor restoration ($95,029.93), Locust Road open space acquisition ($300,000), and Bay Ridge lots ($120,000). No votes were taken on these projects; the committee awaits legal feedback expected in about a week. The committee also discussed a Town Manager memo recommending 10% reserves in each statutory category and reviewed an Affordable Housing Trust update on housing projects. The only formal action was approving the January 9, 2025 minutes (9-0).

Thu Jan 23, 2025

Finance Committee

Finance Committee to discuss budget with police and DPW chiefs

The Orleans Finance Committee will review and discuss budget questions, meeting with Police Chief Scott MacDonald and DPW Director Rich Waldo. They will also review minutes from January 9, 2025, receive updates and liaison reports, and set future meeting dates including a session with Fire Chief Geof Deering on February 13.

financebudgetpolicepublic-worksfiremeetingstown-government
✓ Decided: Finance Committee hears police, DPW budget needs; no votes taken

The Orleans Finance Committee met on January 23, 2025, and heard presentations from Police Chief Scott MacDonald and DPW Director Rich Waldo about their departments' budgets, staffing challenges, and operational needs. No formal decisions were made; the committee only approved the minutes from the January 9 meeting.

Thu Jan 23, 2025

Human Services Advisory Committee

HSAC to interview two grant applicants and discuss resolution on FY26 extension

The Human Services Advisory Committee will interview Serena Kilawee (Orleans After School Program) and Patty Watson (Capabilities) for grant applications, followed by committee discussion. The committee will also discuss a resolution supporting extension of the FY26 grant application process.

human-servicesgrantsafter-school-programcapabilitiesfy26
✓ Decided: HSAC extends grant application deadline to Feb 14

The Orleans Human Services Advisory Committee heard presentations from two agencies and voted to extend the grant application deadline to February 14, 2025, to encourage more applications. The committee also approved the January 16 minutes and discussed future agenda items, including updating its charge.

Wed Jan 22, 2025

Council on Aging

Council on Aging to vote on amended newsletter policy and senior center hours

The Orleans Council on Aging Board will meet on January 22, 2025, at the Senior Center. They will vote on approving December 2024 meeting minutes and an amended newsletter policy. Discussion items include a potential change in Senior Center hours and updates on the Garden Restoration and Telephone Replacement projects. The FY26 budget update and financial report for December 2024 are also on the agenda.

council-on-agingsenior-centerbudgetpolicyhours-of-operationgrantsfacilities
Wed Jan 22, 2025

Recreation Advisory Committee

Recreation Advisory Committee to review spring programming

The Recreation Advisory Committee will meet via Zoom to discuss the Recreation Director's report. The body is expected to make recommendations for spring programming.

recreationprogramming
✓ Decided: Recreation committee hears January report; no votes taken

The Recreation Advisory Committee met via Zoom on January 22, 2025, and received the Director's Report. No formal decisions or votes were made; the minutes will be approved at the next meeting. The report covered program registrations, revenue, and updates on youth and adult programs.

Wed Jan 22, 2025

Select Board

Select Board to vote on Land Disposition Agreement for 66 & 76 Route 6A

The Select Board will vote on a land agreement for properties on Route 6A and set the dates for the Annual Town Meeting and Election. The meeting includes public hearings regarding a demolition delay appeal and shellfish grant renewals.

real-estatetown-meetingshellfishingwastewaterzoninglabor-negotiations
✓ Decided: Select Board imposes 6-month demolition delay on 23 Standish Rd.

The Board voted unanimously to find 23 Standish Road historically significant and impose a 6-month demolition delay, retroactive to the original Historical Commission hearing in November. They also approved a land disposition agreement for 66 and 76 Route 6A, a road closure for the annual PD Block Party, shellfish grant renewals, and several wastewater-related motions.

Tue Jan 21, 2025

Affordable Housing Trust Fund Board

Affordable Housing Trust Board to discuss property negotiations and housing projects

The Affordable Housing Trust Board will meet to discuss updates on affordable housing projects, including properties at 19 West Road, 107 Main St, and 66-76 Route 6A. The board will also consider defining income eligibility at 120% AMI for the Orleans Affordable Housing Trust and receive a year-end report from the Community Preservation Committee.

affordable-housinghousing-projectsproperty-negotiationsincome-eligibilitycommunity-preservation
✓ Decided: Trust moves forward on 44 Main St. development, discusses 120% AMI eligibility

The Orleans Affordable Housing Trust Board met on January 21, 2025, and discussed several housing projects. They decided to move forward with Phase 1 of the 44 Main Street development, with funding from Trust and Town funds, and will work with the Town Manager's office on contributions. The Board also discussed setting 120% AMI as income eligibility for the Trust, with a warrant article to be developed for Annual Town Meeting. No formal votes were taken on these items; the only votes were to enter executive session, approve the December minutes, and adjourn.

Tue Jan 21, 2025

Snow Library Board of Trustees

Gallery committee to vote on three artist presentations

The Marion Craine Gallery Committee of Snow Library is meeting to vote on artist presentations by Rick Francolini, Liz Perry, and Pat Watson, and to approve minutes from December 17, 2024. They will also receive a financial report and the library director's report, and review the gallery schedule.

librarygallery-committeeartist-presentationsminutes-approvalexhibit-schedule
✓ Decided: Snow Library gallery committee approves June Pride exhibit, May and July shows

The Marion Craine Gallery Committee heard artist presentations and approved the December 2024 minutes. The committee scheduled exhibits for May (Printmakers of Cape Cod), June (Lower Cape Pride), and July (Pat Watson), with coordinators assigned. No other substantive decisions were made; the library was denied a state construction grant.

Tue Jan 21, 2025

Conservation Commission

Conservation Commission to vote on spending $10,000 for kiosks

The Orleans Conservation Commission will consider continuations for several projects in wetland buffer zones, including a new dwelling, a pool installation (with a withdrawal request), and a boathouse repair. They will vote on authorizing up to $10,000 from the Conservation Trust Fund to purchase kiosks for conservation properties. Additionally, the Commission will receive updates on the Kent's Point environmental study and discuss Phase 5 planning for Putnam Farm.

conservationwetlandscoastal-banktrust-fundkiosksplanningenvironmental-study
✓ Decided: Conservation Commission approves 9 Nauset Rd home replacement, continues Klink hearing

The Orleans Conservation Commission approved a new single-family dwelling at 9 Nauset Rd with conditions, continued the Klink property hearing to 2/4/25, accepted withdrawal of the Bekarian pool application, and approved several other projects and certificates of compliance. The commission also authorized spending up to $10,000 for kiosks and discussed next steps for the Kent's Point environmental study.

Tue Jan 21, 2025

Fourth of July Committee

Orleans 4th of July Parade Committee to review 2024 parade and 2025 timeline

The committee is meeting to review the 2024 parade and the timeline for 2025. The body will also discuss committee roles and the need for a clerk.

community-eventsparadecommittee-administration
Thu Jan 16, 2025

Board of Health

Board of Health considers six property requests and food service approvals

The Orleans Board of Health will hold a hybrid meeting to consider an extension request, a hearing request, and four variance requests for properties at 16 South Orleans Road, 17 Nells Way, 16 Kescayogansett Road, 25 Harwich Road, 14 Twitchknot Farm Way, and 3 Fools Restaurant. The board will also review administrative items including a food service establishment application approval, a mobile beverage truck waiver request, and a waiver for 44 Loomis Lane. The Health Agent will deliver a report.

health-boardvariancefood-servicepublic-hearingwaiverproperty
✓ Decided: Board of Health approves sewer extension, septic system, pool fence variances

The Orleans Board of Health approved a two-year sewer connection extension for 16 South Orleans Road, an I/A septic system for 17 Nells Way, and pool fence variances for three properties. It also approved an outdoor cooking waiver for 3 Fools Restaurant, a mobile beverage truck application, and a Title 5 waiver for 44 Loomis Lane. All votes were unanimous except the 14 Twitchknot Farm Way variance, which passed 3-1.

Thu Jan 16, 2025

Human Services Advisory Committee

Human Services Committee to review FY2026 grant process and schedule agency interviews

The Orleans Human Services Advisory Committee will discuss and continue the postmortem of the FY2026 grant application process, schedule upcoming agency application interviews, and review a consultant report from Crescendo. The committee will also vote on minutes from the previous meeting. These items involve internal planning for human services funding allocation.

human-servicesgrantscommitteesconsultant-reportmeeting-minutes
✓ Decided: Committee votes to ask town to reopen grant process

The Human Services Advisory Committee voted 4-1 to request that the town reopen the human services grant application process with a close date by February 14, aiming to include more agencies. They also learned of two late applications and will schedule interviews. Interviews with agencies begin January 23.

Wed Jan 15, 2025

Open Space Committee

Committee votes to enter executive session for 32 Locust Rd and Bay Ridge properties

The Open Space Committee will discuss its official charge, vote to enter executive session to discuss properties at 32 Locust Rd and 8, 10, 14 Bay Ridge, receive a Community Preservation Committee update, and set the next meeting date. The agenda is primarily procedural with one substantive closed-session item.

open-spaceexecutive-sessionlocust-rdbay-ridgecpcorleans
✓ Decided: Open Space Committee discusses charge, enters executive session

The Orleans Open Space Committee met and discussed whether to revise its charge, prompted by recent articles about other towns' committees. No formal decision was made on the charge. The committee voted unanimously to enter executive session to discuss properties at 32 Locust Road and 8, 10, and 14 Bay Ridge, then approved the minutes from the December 4, 2024 meeting.

Wed Jan 15, 2025

Zoning Board of Appeals

ZBA to hear three special permit applications for non-conforming structures on Nauset, High, and Gull streets

The Zoning Board of Appeals will hold a public hearing on three special permit applications. Cases include razing and replacing a non-conforming dwelling at 9 Nauset Road, constructing a guest house exceeding coverage limits at 15-17 High Street, and adding a second story and decks at 9 Gull Lane. The board will also review minutes from the December 2024 meeting.

zoningspecial-permitpublic-hearingnon-conforming-structuresorleans
✓ Decided: ZBA continues three special permit cases to Feb. 5 hearing

The Orleans Zoning Board of Appeals approved minutes from Dec. 4, 2024, and granted continuances for all three special permit applications on the agenda. Each case was continued to the next hearing on February 5, 2025, pending additional approvals or revisions. No final decisions were made on any application.

Wed Jan 15, 2025

Board of Water & Sewer Commissioners

Board to enter executive session for pending lawsuit Leonard vs. Town

The Board of Water/Sewer Commissioners will meet in hybrid format. They will enter executive session to discuss pending litigation (Case #2472CV00509, Leonard vs. Town of Orleans). A public betterment abatement hearing is scheduled for 64 Patriots Way. The board will also consider sewer connection deferral and FOG variance requests, discuss microplastics in drinking water, and review department updates.

water-sewerlitigationbettermentpublic-hearingdepartment-reportswater-quality
✓ Decided: Board denies sewer betterment abatement for 64 Patriots Way

The Board denied a sewer betterment abatement request for 64 Patriots Way because no miscalculations or discrepancies were found in the water use data. They also approved a sewer connection deferral for 16 South Orleans Road until March 15, 2027, and approved a FOG variance for Skaket Beach Motel contingent on installing an internal grease trap. Several routine items were approved, including minutes, drain layer renewals, and monthly receivables commitments.

Tue Jan 14, 2025

Economic Development Committee

EDC to vote on recommendation review process and discuss focus areas

The Economic Development Committee will vote on its Recommendation and Statement Review Process and hold a final discussion on committee focus areas, including member assignments and action priorities. Updates will be given on the town's broadband grant and general staff matters. The meeting includes public comment and approval of prior minutes.

economic-developmentcommitteebroadbandfocus-areasreview-processorleans
✓ Decided: EDC votes to advocate for broadband Wi-Fi at Nauset Beach

The Orleans Economic Development Committee unanimously approved a motion to advocate for using the balance of a broadband grant to improve Wi-Fi service at Nauset Beach. They also approved a new Recommendation and Statement Review Process and decided to write to the state Department of Revenue commissioner requesting town-level sales tax data. No public comment or correspondence was received.

Tue Jan 14, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee to discuss radioactive wastewater and shellfish harvesting

The Shellfish and Waterways Improvement Advisory Committee will review the 2024 annual report and discuss cold temperature restrictions on shellfish harvesting. The body will also receive updates on the Holtec proposed release of radioactive wastewater into Cape Cod Bay and striped bass fishery management.

shellfishwater-qualityenvironmentfisheriespublic-health
✓ Decided: Committee approves 2024 annual report for town submission

The Shellfish & Waterways Improvement Advisory Committee voted unanimously to forward its 2024 annual report to the town as written. The committee also discussed updates on striped bass regulations, opposition to Holtec's wastewater release, and cold temperature restrictions on shellfish harvesting, but no other formal decisions were made.

Tue Jan 14, 2025

Conservation Commission

Conservation Commission to review tree removal at 9 Kescayogansett Rd

The Orleans Conservation Commission will hold an on-site meeting to discuss an administrative review for John Brink at 9 Kescayogansett Road. The proposal involves removing 7 trees, ivy, and bittersweet. No other substantive items are listed on the agenda.

conservation-commissiontree-removalinvasive-speciesenvironmental-review
Tue Jan 14, 2025

Board of Assessors

Board to review abatements, exemptions, and Chapter 61 applications

The Orleans Board of Assessors will meet to discuss motor vehicle and boat abatement reports, approve minutes, and review monthly sales data. In executive session, the board will consider real estate exemptions, Chapter 61 applications, and real estate abatements, which are confidential under state law.

assessorsabatementsexemptionschapter-61real-estatemotor-vehicleboatsexecutive-session
✓ Decided: Board approves 18 motor vehicle and boat abatements

The Orleans Board of Assessors approved a total of 18 abatements for motor vehicles and boats, all by unanimous 2-0 votes. The board also approved the minutes from the November 12, 2024 meeting.

Tue Jan 14, 2025

Cultural Council

Cultural Council to finalize grant acceptance and denial letters

The Orleans Cultural Council is meeting to approve minutes from December 2024, receive a treasurer's update on submitted grants, and discuss grant-related correspondence. The chair will report on denial and acceptance letters sent, a press release for grant recipients, and updates for the town website. A report on the Cultural District is also scheduled.

grantscultural-councilartshumanitiessciencesorleans
✓ Decided: Orleans Cultural Council approves youth art show for April/May

The Orleans Cultural Council approved moving the youth art show to April/May to coincide with Town-Wide Arts Week, with Brian Smith overseeing it. They also approved minutes from November and December, and discussed grant follow-ups and potential collaborations, including a possible queer youth festival and movie nights.

Mon Jan 13, 2025

Orleans School Committee

Orleans School Committee to discuss FY26 Elementary School Budget

The Orleans School Committee will meet to review the FY26 Orleans Elementary School Budget and the school's improvement plan. The body will also review the FY25 expenditure report and consider the approval of gifts and grants.

educationbudgetschool-improvementgrants
✓ Decided: Orleans School Committee approves $465 Cape Cod Five grant

The Orleans School Committee met remotely on January 13, 2025, and approved a $465 grant from Cape Cod Five for teacher Lagasse's classroom collaboration project. Members also agreed to hold a special meeting to review the draft OES Program Book before a joint meeting with the Select Board. The committee received updates on special education, the FY26 budget (Version 2 at $6,210,540), and the School Improvement Plan, but took no other formal votes.

Thu Jan 9, 2025

Architectural Review Committee

Review of new signs for Law Office of Tracey D. Smith at 158 Route 6A

The Architectural Review Committee will review a request for new signs at the Law Office of Tracey D. Smith, located at 158 Route 6A in Orleans. The committee will also consider approval of minutes from its November 14, 2024 meeting.

signsarchitectural-revieworleanscommerciallaw-office
✓ Decided: ARC approves new sign for Law Office of Tracy D Smith

The Orleans Architectural Review Committee approved a new sign application for the Law Office of Tracy D Smith at 158 Route 6A. The sign will share a post with the existing sign, use similar colors, and be made of wood with no lighting changes. The committee also approved the minutes from the November 14, 2024 meeting.

Thu Jan 9, 2025

Finance Committee

Orleans Finance Committee to discuss budget review process

The Finance Committee will meet to vote on the Annual Report letter. Members will also determine the questions to be used during budget reviews and interviews with department heads.

budgetfinancetown-administration
✓ Decided: Finance Committee approves 2024 Annual Report letter

The Orleans Finance Committee approved its 2024 Annual Report letter with amendments, including discussion of a residential tax exemption and other revenue ideas. The committee also finalized a list of questions for department head budget reviews, with a deadline of January 16 to send them out. No other substantive decisions were made; the meeting was largely procedural and informational.

Thu Jan 9, 2025

Energy & Climate Action Committee

Committee to vote on 2025 goals, discuss Specialized Energy Code

The Energy and Climate Action Committee will discuss and vote on priorities for 2025 goals and discuss adoption of the Specialized Energy Code. The meeting also includes updates from the Orleans Climate Action Network and the Assistant Town Manager, a Chairman's Report on a meeting with the Water and Sewer Commission, and a review of liaison assignments.

climate-actionenergy-codegoalsliaisonspublic-meeting
✓ Decided: Orleans energy committee sets 2025 goals, approves annual report draft

The Energy and Climate Action Committee discussed and set priorities for 2025, including adopting a specialized energy code, creating a municipal decarbonization plan, and advancing renewable energy projects. It unanimously approved the draft of its section for the Town's annual report, with edits. The committee also heard updates on state technical assistance for a decarbonization roadmap and Select Board approval to move forward with solar projects.

Thu Jan 9, 2025

Community Preservation Committee

Community Preservation Committee reviews FY26 grant presentations

The committee is meeting to hear a presentation for Affordable Housing Trust funding for FY26. Members will also review legal and historic feedback on other grant applications and discuss the annual report.

grantsaffordable-housingcommunity-preservationtown-budget
✓ Decided: CPC hears affordable housing funding update, no votes taken

The Community Preservation Committee met on January 9, 2025, and heard a presentation on affordable housing needs and funding, including a potential $3 million phase I development at Governor Prence. No substantive decisions were made; the only votes were to approve the December 19, 2024 minutes and to adjourn, both passing 9-0.

Thu Jan 9, 2025

Human Services Advisory Committee

Human Services Advisory Committee to review grant processes and budget requests

The committee will discuss the FY2026 Human Services Grant application process and budget request. Members will also review the status of the Department of Health & Human Services reorganization and the Orleans Navigator Program.

human-servicesgrantsbudgethealth-departmentgovernment-reorganization
✓ Decided: Committee to contact nonprofits that skipped funding applications

The Orleans Human Services Advisory Committee approved a motion to contact nonprofits that applied for funds last year but not this year to ask why and whether they would apply if the application process reopened. The committee also discussed the Health Department reorganization, regional collaboration, and the 2025 application review process, but no other formal decisions were made.

Wed Jan 8, 2025

Select Board

Vote on Bond Anticipation Note and Bond Sales

The Select Board will vote on issuing a Bond Anticipation Note and on bond sales. They will also vote on a conservation restriction for 33 Eli Rogers Road and consider a HAC request to stage modular units at 66 Route 6A. Other agenda items include a recap of the Outermost Music Festival, discussion of Pride Month celebrations, and a vote on a hawker's/peddler's license for Dancing Spoons food truck. An executive session is scheduled for real property and collective bargaining.

bondsconservationhousinglicensingpride-monthsolarexecutive-sessioncollective-bargaining
✓ Decided: Select Board approves $11.98M bond sale and $19.4M notes

The Select Board approved the sale of $11,980,000 in General Obligation Municipal Purpose Bonds to TD Securities and $19,413,584 in Bond Anticipation Notes to Truist Securities, both at favorable rates. The board also supported a conservation restriction for 33 Eli Rogers Rd., approved the annual hawker's license for Dancing Spoons food truck, and allowed temporary use of town property at 66 & 76 Rt 6A for modular unit staging. All votes were unanimous (5-0).

Wed Jan 8, 2025

Snow Library Board of Trustees

Snow Library Board of Trustees to meet January 8

The Board of Trustees will meet to review financial and director reports. The agenda includes an update on the new library building.

librarypublic-buildingsorleans
✓ Decided: Snow Library denied state construction grant; trustees weigh funding options

The library was denied the MBLC construction grant due to lack of economic need. Trustees discussed sequencing the project with the proposed fire station, considering spring or fall town meeting funding, and whether to seek design-only ($4.1M) or design plus construction ($41M) funding. No funding decision was made.

Wed Jan 8, 2025

Historical Commission

Historical Commission to discuss Demo Delay bylaw draft and pending cases

The Orleans Historical Commission will meet to discuss a draft bylaw for the Demo Delay Committee and receive reports from the Historic District Study Committee. The commission will also review pending demolition delay cases and approve previous meeting minutes. No specific properties or dollar amounts are mentioned in the agenda.

historical-commissiondemo-delaybylawhistoric-districtorleans
✓ Decided: Commission discusses but takes no vote on Demolition Delay Bylaw changes

The Orleans Historical Commission discussed proposed revisions to the Demolition Delay Bylaw, including removing the Select Board appeal, changing the historic significance threshold to 75 years, and extending the delay to 18 months. A motion to pursue these changes for the May 2025 Town Meeting was made but withdrawn before a vote. The Commission also reviewed pending demolition delay cases and approved minutes from two prior meetings.

Wed Jan 8, 2025

Transportation and Bikeways Advisory Committee

Committee to review VHB design for Od Colony shared-use path, decide on Select Board recommendation

The Transportation and Bikeways Advisory Committee will review VHB’s design for the Od Colony Project, including a south side shared-use path model, and determine which option to forward to the Select Board in February. The committee will also discuss the Complete Streets Prioritization Plan, ensuring members understand its impact on decision-making, planning, and funding. They will confirm that the Main Street Project remains on the Capital Plan for 2026 and vote on moving future meeting times to 9:30 AM starting February 12.

transportationbikewayscomplete-streetsshared-use-pathcapital-planmain-streetod-colony
✓ Decided: Committee recommends Option 2 for Old Colony Way shared-use path

The Orleans Transportation and Bikeways Advisory Committee unanimously recommended Option 2 for the Old Colony Way shared-use path, which includes a wide sidewalk on the south side and no parking there, while keeping the north side sidewalk. The committee also unanimously approved a motion to request funds in the FY2026 Capital Plan for a field survey for Main Street and engineering design for Old Colony. No other substantive decisions were made.

Tue Jan 7, 2025

Affordable Housing Committee

Committee to discuss 2025 workplans, including Housing Opportunity and Communications frameworks

The Affordable Housing Committee will hear updates from Assistant Director Elizabeth Jenkins, discuss recruitment of new committee members, and review proposed 2025 workplans including a Housing Opportunity Evaluation Framework and a Communications Development Framework. The committee will also vote to approve minutes from its September 1, 2024 meeting.

affordable-housingworkplanshousing-opportunitycommunicationscommittee-recruitmentmeeting-minutes
Tue Jan 7, 2025

Conservation Commission

Conservation Commission reviews multiple proposals for work in coastal buffer zones and wetlands

The Orleans Conservation Commission will hold a public meeting to review several Notices of Intent for projects in coastal resource areas, including new dwellings, pool installations, and additions. The agenda also includes continuations, a certificate of compliance, administrative reviews, and monitoring reports. Public comment will be heard.

conservationcoastal-bufferwetlandspublic-hearingcoastal-bankpleasant-bay-acecvernal-poolsalt-marsh
✓ Decided: Conservation Commission continues three hearings, approves River Rd addition

The Orleans Conservation Commission voted unanimously to continue public hearings for three projects (9 Nauset Rd, 13 Archer Ln, 9 Gull Ln) to January 21, 2025, and approved a project at 14 River Rd with special conditions. The Commission also denied an administrative review for 36 Crystal Lake Dr, requiring a Notice of Intent instead, and approved a Certificate of Compliance for 51 Gosnold Rd.