The Boring PartsFederalLocal · USLocal · Canada
Orleans, Massachusetts

Orleans public meetings in 2025

286 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Thu Dec 18, 2025

Board of Health

Show cause hearings on sewer connection orders for 5 North Cottage

The Orleans Board of Health will hold continued show‑cause hearings for properties ordered to connect to the municipal sewer system, including 5 North Cottage. The agenda also includes a sewer deferral request for 18 Old Colony Way, a hearing request for 63 Old Field Road, a variance request for 51 Beach Road, and a testing reduction request for 14 Prides Path. Additional administrative items such as residential kitchen permits and temporary food service establishments will be reviewed.

sewerhealthpermitshearingsvariance
✓ Decided: Board approves bedroom and pool fencing variances, plus permits and deferrals

The Orleans Board of Health continued the Phase 1 show‑cause hearings to Jan 15, 2026 and extended the hearing for 5 North Cottage to the same date. It approved a sewer deferral for 18 Old Colony Way, variances for 63 Old Field Road and 51 Beach Road, reduced testing frequency for the I/A system at 14 Prides Path, and granted residential kitchen and temporary food service permits. All actions were adopted by voice vote of 5‑0‑0.

Thu Dec 18, 2025

Marine & Fresh Water Quality Committee

Committee will vote on its reorganization at Dec 18 meeting

The Marine & Fresh Water Quality Committee will discuss the 2025 State of the Waters report and review the November 24, 2025 meeting minutes. It will receive updates on Pilgrim Lake water quality after alum treatment, the Wastewater Management Advisory Committee, and the Winter Farmer’s Market booth. The meeting will conclude with a vote on the committee’s reorganization and a period for public comment.

water-qualitycommitteereorganizationreportspublic-comment
Thu Dec 18, 2025

Recreation Advisory Committee

Recreation Committee to review park renovation and annual report contributions

The Orleans Recreation Advisory Committee will meet to approve November minutes, hear a director's report on Eldredge Park renovation, and review staff updates. The committee will also vote on its contribution to the Town of Orleans Annual Report.

recreationparkscommitteetown-meetingeldredge-parkannual-report
Thu Dec 18, 2025

Community Preservation Committee

Committee reviews FY27 grant applications for housing, parks, and historic sites

The Orleans Community Preservation Committee will review grant applications for the Fiscal Year 2027 budget. The meeting includes presentations from the Affordable Housing Trust, Veterans Park Memorial, Civil War Monument, NW Schoolhouse, and Academy Playhouse. The committee will also discuss finances and approve minutes from the previous meeting.

budgethousingconservationparkshistoric-sitesgrant-applicationsorleans
Thu Dec 18, 2025

Human Services Advisory Committee

Human Services Advisory Committee reviews service applications

The committee will review applications for human services programs, receive an update on applications received, and discuss a request to increase an organization’s request. No formal decisions are noted; the meeting focuses on ongoing review and future issues.

human-servicesapplicationsreviewpublic-meeting
✓ Decided: HSAC approved Dec. 4 minutes and adjourned; no grant approvals

The Human Services Advisory Committee unanimously approved the minutes from the December 4, 2025 meeting. No grant applications were approved, denied, or otherwise acted upon. The committee then unanimously adjourned the meeting.

Wed Dec 17, 2025

Select Board

Board to consider Verizon pole installation request at 19 Ruggles Road

The Select Board will hold a public pole hearing to discuss and vote on NBC LLC's request, on behalf of Verizon New England, to install an overhead wire system from an existing pole to a new building at 19 Ruggles Road. The board will also vote on conservation restrictions for the properties at 137 Skaket Beach Road and 40 Payson Lane. Additional items include approval of annual license renewals for 2026 and routine approvals of recent board minutes and interview appointments.

pole-installationtelecommunicationsconservationlicensesboard-minutesinterviews
✓ Decided: Board approves conservation restrictions for two properties and appoints new members

The Select Board approved conservation restrictions for the parcels at 137 Skaket Beach Road and 40 Payson Lane. It also appointed Michael Abbott to the Cultural Council, Derek Bolduc to the Shellfish & Waterways Committee, and elevated Andrew Miao to a regular member of the Old Kings Highway Committee. The public hearing on the Ruggles Road utility pole request was continued to January 7, 2026. Routine items such as the consent agenda license renewals and past meeting minutes were also approved.

Wed Dec 17, 2025

Select Board

Select Board will review and discuss Section F of its policies

The Orleans Select Board will hold a workshop meeting on December 17, 2025. Board members will review and discuss the town’s Select Board policies, focusing on Section F. No formal actions or votes are listed on the agenda.

governancepolicyboardmeeting
Wed Dec 17, 2025

Zoning Board of Appeals

ZBA to hear special permit request for new home and garage at 5 Spinnaker Trail

The Zoning Board of Appeals will review a request for a special permit regarding building coverage limits. The board will also review meeting minutes from November 5 and November 19, 2025.

zoningspecial-permitresidential-construction
Wed Dec 17, 2025

Board of Water & Sewer Commissioners

Board to vote on sending Watershed Management Plan to public hearing

The Board of Water & Sewer Commissioners will discuss and vote on scheduling a public hearing for the Watershed Management Plan. The board will also review abatement requests and license renewals for drain layers.

water-managementsewerwatershedlicensingpublic-hearing
Tue Dec 16, 2025

Affordable Housing Trust Fund Board

Board will consider a confidential purchase or lease of property on Monument Road

The Affordable Housing Trust Fund Board will meet on Dec. 16, 2025 in the Nauset Room at Orleans Town Hall and via Zoom. An executive session is scheduled to discuss the purchase, exchange, or lease of real property on Monument Road. The board will also review proposals and a purchase‑sale agreement for a 4‑unit housing project at 22 Old Tote Road, and provide updates on several ongoing development projects.

affordable-housingproperty-purchasedevelopmentcommunity-preservationcontract
✓ Decided: Board approved taking title of 22 Old Tote Road property

The Affordable Housing Trust Fund Board entered executive session to discuss a real‑property transaction and then reconvened in open session. The board voted unanimously to take title of 22 Old Tote Road. It also unanimously approved renewing the management services contract for the Old Colony Way condominium and approved the minutes from the previous meetings before adjourning.

Tue Dec 16, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to vote on artist presentations

The Marion Craine Gallery Exhibition Committee will meet to review artist presentations and a membership application. The board will also review the gallery schedule and receive financial and director reports.

libraryartsgalleryorleans
Tue Dec 16, 2025

Conservation Commission

Conservation Commission reviews sewer project and land use permits

The Orleans Conservation Commission will review permits for a wastewater sewer project in the Lakes and Ponds area and several land development proposals. The agenda also includes administrative reviews and a vote on funding for a Putnam Farm agricultural barn.

sewerconservationzoningwetlandsfundingpublic-worksagriculture
✓ Decided: Commission unanimously approved major sewer project and multiple local developments

The Conservation Commission approved the Phase 3 Lakes and Ponds sewer project with special time‑of‑year and shrub conditions. It also approved three residential projects (75 Areys Lane, 8 Kescayogansett Rd, and 184 Quanset Rd) and a Certificate of Compliance for 60 Captain Linnell Rd with a $4,000 surety. Additionally, the commission authorized up to $45,000 for the Putnam Farm Agricultural Barn and struck an invalid order for the 75 Areys Lane project.

Mon Dec 15, 2025

Orleans School Committee

School Committee reviews MCAS results, special ed audits, and FY27 budget

The Orleans School Committee will hear reports on the latest MCAS results, special‑education audit findings and preschool program status. Administrators will also present the FY27 budget review, the FY26 monthly financial report, and a summary of the recent MASC conference. The meeting includes routine items such as approval of the November 13 minutes and scheduling of future meetings.

educationtestingspecial-educationpreschoolbudgetfinanceconference
Mon Dec 15, 2025

Cultural Council

Orleans Cultural Council to vote on 2026 grant support

The Cultural Council will review grant submissions and vote on which grants to support for 2026. The body will also discuss potential partnerships and programs for the upcoming year.

grantsartsculturecommunity-programming
✓ Decided: OCC meetings will move to the first Monday of each month starting 2026

The council approved the November 2025 meeting minutes. It adopted a new schedule for future meetings to be held the first Monday of each month at 5:30 pm beginning in 2026. A motion to adjourn was made, seconded, and passed, ending the meeting.

Thu Dec 11, 2025

Community Preservation Committee

Community Preservation Committee to hear FY27 grant presentations

The Community Preservation Committee will receive presentations from FY27 grant applicants. The meeting includes reviews of requests for historic preservation, open space, recreation, and housing projects.

grantshistoric-preservationhousingopen-spacerecreation
✓ Decided: Committee unanimously approved prior meeting minutes

The Community Preservation Committee approved the minutes from the December 4, 2025 meeting with an 8‑0‑0 vote. The committee then adjourned the December 11, 2025 meeting, also by an 8‑0‑0 vote. No other actions were taken.

Thu Dec 11, 2025

Architectural Review Committee

Architectural Review Committee to review signage and roofing applications

The Architectural Review Committee will consider two applications for property modifications. The committee also plans to discuss its future functioning with Select Board member Mefford Runyon.

architectural-reviewsignagezoningtown-governance
✓ Decided: ARC waived site plan requirement and approved Homegrown Boutique signs

The Architectural Review Committee unanimously waived the site‑plan requirement for Homegrown Boutique’s new signs and approved the three sign designs with downward‑facing lighting. It also approved Cape Associates’ roof replacement application, conditional on a later site‑plan submission. The meeting was then adjourned.

Thu Dec 11, 2025

Energy & Climate Action Committee

Committee to vote on Climate Action Roadmap recommendation

The Energy and Climate Action Committee will vote on a recommendation to the Select Board regarding the Climate Action Roadmap. Members will also review the Municipal Decarbonization Plan and prepare for a citizen forum on January 15.

climate-actiondecarbonizationenergy-codeenvironment
✓ Decided: Committee approved recommending the Select Board start the Climate Action Roadmap now

The committee unanimously passed a motion to submit a recommendation to the Select Board directing town staff to begin the Climate Action Roadmap procurement without waiting for grant funding. It also unanimously approved the minutes from the November 6, December 13, and November 20, 2025 meetings. The discussion on speakers for the Jan 15, 2026 Citizens Forum was tabled and the forum will be rescheduled. The meeting was adjourned by unanimous vote.

Wed Dec 10, 2025

Transportation and Bikeways Advisory Committee

Committee reviews crosswalk policy and road safety data

The Transportation and Bikeways Advisory Committee will review the town's crosswalk policy and discuss speed data for Barley Neck Road. Members will also address pedestrian crossing light issues at Old Colony and Main Street.

transportationbikewayspedestrian-safetytraffic-dataroads
✓ Decided: Committee unanimously approves crosswalk policy

The Transportation and Bikeways Advisory Committee approved the revised crosswalk policy by unanimous vote. The committee also approved the minutes from the November 12 meeting, again unanimously with one abstention. The pedestrian crossing light at Old Colony and Main Street was confirmed to be operating correctly and no further action was required. The meeting set agenda items for the January 5 session, including updates on the crosswalk policy, field survey, and a Beach Road community meeting.

Tue Dec 9, 2025

Economic Development Committee

Economic Development Committee reviews updates and prepares for special town meeting

The committee will review the November 7, 2025 meeting minutes, receive a staff update from Amanda Converse, discuss the upcoming Special Town Meeting, and examine the Economic Development Committee Data Dashboard. It will also address any new business and set the date for the next meeting.

economic-developmentmeetingupdatesspecial-town-meetingdata-dashboard
Tue Dec 9, 2025

Board of Assessors

Board reviews multiple tax abatements and commitments

The Orleans Board of Assessors will discuss reports on MV abatements, boat excise abatements, and real estate exemptions. It will also consider the In Lieu of Taxes report and various commitment items. Afterward, the board will enter an executive session to discuss real estate exemptions and deferrals confidentially.

tax-abatementsreal-estateexciseboard-of-assessorsmeeting
✓ Decided: Board approved $72,458.63 in real estate tax exemptions for FY2026

The Board of Assessors approved 63 real estate tax exemptions totaling S72,458.63 and a $3,029.55 tax deferral. It also accepted Julie Lee's resignation and approved a $54,431.19 payment in lieu of taxes for four Orleans Housing Authority properties. Several vehicle and boat excise abatements were unanimously approved, and the meeting was adjourned by a 2‑0 vote.

Tue Dec 9, 2025

Conservation Commission

Conservation Commission reviews sewer expansion and residential projects

The Conservation Commission is holding an on-site meeting to review Notices of Intent for three projects. These include a municipal sewer expansion and two private residential developments. All projects involve work within protected resource areas or the Pleasant Bay ACEC.

conservationsewerzoningenvironmentresidential-development
Tue Dec 9, 2025

Cultural District Committee

Cultural District Committee to discuss events and meeting schedule

The Cultural District Committee will review reports on current projects and events. The body is also discussing a change to its meeting time.

artsculturecommunity-events
✓ Decided: Committee changed monthly meeting time to 5:30‑7 pm on the fourth Tuesday

The Cultural District Committee approved the October 2025 minutes and the Treasurer's report, both unanimously. The board voted to accept the Solstice event flyer and public‑relations plan. Members also approved moving the regular meeting to 5:30‑7 pm on the fourth Tuesday of each month, with a unanimous vote.

Tue Dec 9, 2025

Cultural Council

Orleans Cultural Council to review grant cycle and future arts programming

The Cultural Council will review the status of current grants and set deadlines for the next cycle. Members will discuss the JOY Holiday Structure and plan for 2026 programs including art shows and murals.

grantsartsculturecommunity-programming
Thu Dec 4, 2025

Board of Health

Board of Health to hold sewer connection show cause hearings

The Board of Health will conduct show cause hearings for properties ordered to connect to the municipal sewer. The board will also review variance and testing reduction requests for specific residential addresses.

sewerpublic-healthvariancespermits
✓ Decided: Board approved a 140‑foot fence variance for 18 Sparrowhawk Road (5‑0‑0)

The Board continued show‑cause hearings for 8 Old Tote Road and 34 Route 6A, moving them to Jan 15 2026 (5‑0‑0 each). It approved a 140‑foot fence variance for 18 Sparrowhawk Road to allow a larger pool enclosure (5‑0‑0). Several license renewals—including Body Art, Hotels, and Swimming Pools—were approved (5‑0‑0 votes). The Board also continued a 17A testing request for 14 Prides Path I/A to Dec 18 2026 (5‑0‑0) and adjourned the meeting.

Thu Dec 4, 2025

Community Preservation Committee

Committee will discuss and possibly vote on out‑of‑town community housing initiatives

The Orleans Community Preservation Committee will review FY25/FY26 finances, including active and closed projects. Members will discuss and may vote on community housing initiatives that are located outside Orleans. The committee will consider FY27 grant applications and allocations totaling $1,440,318.84 for a range of historic, recreational, and housing projects. Updates on ongoing projects and a legal review will also be presented.

housinggrantsfinancecommunity-preservationprojects
✓ Decided: CPC sets aside $1 M for Eldredge renovation and closes several accounts

The committee voted 9‑0‑0 to close six account codes and return any balances to the CPC reserve fund. It also voted 9‑0‑0 to set aside $1 million to reduce bonding for the Eldredge Park renovation. A separate 9‑0‑0 vote declined funding for three Pennrose affordable‑housing grant applications totaling $300,000, and the committee confirmed that non‑strikethrough projects in Item 7 remain active. Minutes from the November 6 meeting were approved (8‑0‑1) and the meeting adjourned at 6 p.m.

Thu Dec 4, 2025

Human Services Advisory Committee

Human Services Advisory Committee to review funding applications

The committee will discuss the status of received applications and whether to increase specific organization requests. Members will also continue reviewing applications and a draft of the annual report.

human-servicesgrantsannual-reportcommunity-funding
✓ Decided: Committee unanimously approved the annual report and adjourned the meeting

The Human Services Advisory Committee approved the November 20, 2025 meeting minutes by unanimous vote. The committee also approved the HSAC report for inclusion in the Annual Town Report, again unanimously. The meeting was then adjourned by unanimous vote. No other applications were acted upon.

Wed Dec 3, 2025

Historical Commission

Public hearing on Notice of Intent for 15 Main Street demolition delay

The Orleans Historical Commission will hold a public hearing on a Notice of Intent concerning 15 Main Street. The commission will receive updates on the Form B project, the archaeology project, and the public education initiative. Members will review the draft Annual Town Report and consider the Demolition Delay Bylaw. The meeting will conclude with scheduling the next session.

historical-preservationdemolitionpublic-hearingprojectstown-report
✓ Decided: Commission approved demolition of 15 Main Street building

The Orleans Historical Commission approved the November 12, 2025 meeting minutes. It opened a public hearing on the Notice of Intent for 15 Main Street and voted to allow the building's demolition. The hearing was then closed and the commission adjourned.

Wed Dec 3, 2025

Select Board

Select Board to hold hearings on property tax classification and shellfish regulations

The Select Board will hold public hearings regarding FY26 property tax classification options and amendments to shellfish grant regulations. The board will also consider a grant expansion for Derek Bolduc in Little Pleasant Bay and a license transfer for Nauset Beach Camp #10.

taxesshellfishlicensingeconomic-developmentit-security
✓ Decided: Select Board adopts new environmental policy and archives licensed premises policy

The board agreed to replace the existing recycling policy with a broader environmental stewardship policy. It approved revisions to the Conservation Restrictions and Designer Selection Procedures policies and decided to archive the Licensed Premises Accessible to the Public policy. The board also noted several other policies as outdated and directed further review or revision.

Wed Dec 3, 2025

Select Board

Orleans Select Board to review board policies

The Select Board will hold a workshop meeting to review and discuss Select Board Policies. The discussion will focus on Section D and potentially Section E.

town-policygovernanceselect-board
Wed Dec 3, 2025

Housing Authority

Orleans Housing Authority to approve certifications and oil tank completion documents

The Orleans Housing Authority will meet to approve fiscal year end certifications, a report on tenant accounts receivable, and documents regarding oil tank replacements. The board will also vote on authorizing the chair to sign financial assistance contracts.

housingbudgetoil-tankcontractscertificationsmeetings
Wed Dec 3, 2025

Council on Aging

Board discusses FY26 goals, budget review, and community partnership updates

The Orleans Council on Aging board will hear a chair’s report on improving relationships with town bodies, a select board liaison update, and a Friends of Orleans COA report. It will review the October 2025 monthly budget summary. The board will also discuss establishing a workgroup to implement FY26 goals and priorities.

council-on-agingbudgetsenior-servicescommunityplanning
✓ Decided: Board unanimously adjourned the meeting

The Orleans Council on Aging met on December 3, 2025 with a quorum. No public comment or financial reports were presented. Carol Hackett formally assumed the Friends of the Orleans Council on Aging liaison role. The motion to adjourn was passed 6‑0‑0.

Tue Dec 2, 2025

Snow Library Board of Trustees

Board to vote on FY2027 Snow Library Action Plan and EV charging stations

The Snow Library Board of Trustees will consider several agenda items, including approval of the October 7, 2025 meeting minutes and reports from the chair, financial officer, and library director. Trustees will vote on the draft of the 2025-2050 Orleans Comprehensive Plan, the FY2027 Snow Library Action Plan, and the installation of electric vehicle charging stations in the library parking lot. Additional votes will address early closures of the library on December 24 and December 31, 2025.

libraryplanningfacilitiesbudgetcommunity
Tue Dec 2, 2025

Conservation Commission

Commission to vote on supporting Orleans Conservation Trust walking‑trails guide redesign

The Conservation Commission will review certificates of compliance for several property owners who performed reconstruction, landscaping, and invasive‑plant management within coastal buffer zones. It will also discuss and vote on a request from the Orleans Conservation Trust to support the CPC application to redesign and update the Orleans Walking Trails Guide, possibly adding the Commission as a co‑applicant. The meeting includes public comment, chairman’s business, and approval of prior meeting minutes.

conservationcoastalcertificateswalking-trailsenvironment
✓ Decided: Commission approved four Certificates of Compliance and co‑applicant support

The Conservation Commission unanimously approved Certificates of Compliance for properties at 63 Kenneth Lane, 112 Areys Lane, 30 & 40 Payson Lane, and 60 Captain Linnell Road, each with specific ongoing conditions. It also approved supporting the Orleans Conservation Trust’s walking‑trails guide application as a co‑applicant. The board adopted the minutes from the October 7, 2025 meeting and adjourned the hearing.

Tue Nov 25, 2025

Veterans Committee

Veterans Committee to discuss Korean War design and monument presentation

The Veterans Committee will review follow-up actions from the Veterans Day service and receive construction updates on electric and sound systems. The body will also discuss a design for the Korean War and hear a presentation from Crosby Monuments.

veterans-affairsmonumentspublic-works
Mon Nov 24, 2025

Marine & Fresh Water Quality Committee

Committee will discuss next steps for Orleans 2050 Comprehensive Plan

The Marine and Fresh Water Quality Committee will review the October 27, 2025 meeting minutes and discuss next steps for the Orleans 2050 Comprehensive Plan. It will receive updates from the Wastewater Management Advisory Committee, the Community that CARES Collaboration, and the Winter Farmer’s Market Committee. The committee will also hear reports and discuss water quality and management programs for Pilgrim Lake, Cedar Pond, and Baker Pond, and will consider a public‑hearing support statement for the Orleans Pesticide Reduction HRP. The meeting concludes with announcements, public comment, and adjournment.

comprehensive-planwater-qualitywastewaterpesticide-reductionpond-managementpublic-hearing
✓ Decided: Committee unanimously voted to resubmit Baker Pond alum treatment request for spring 2026

The committee approved the October 27, 2025 minutes by unanimous roll‑call vote. Two agenda items—Winter Farmer’s Market Committee Booth and the Pilgrim Lake Herring Run—were postponed to future meetings. Members agreed to post a video about alum treatment on the town’s water quality website. A motion to resubmit the Baker Pond alum treatment request at the spring 2026 Town Meeting passed unanimously.

Mon Nov 24, 2025

Cultural Council

Cultural Council to review 2026 grant requests and holiday structure funding

The Orleans Cultural Council will review grant requests for 2026 and discuss various community programs. The body will vote on whether to fund a holiday structure for the Village Green and determine the funding amount.

grantsarts-and-culturecommunity-eventspublic-funding
✓ Decided: Council approved $5,000 to fund Village Green holiday lobster buoy structure

The council approved a $5,000 grant to fund the Village Green holiday lobster buoy structure, passing the motion unanimously. The October 2025 meeting minutes were approved. Discussion of existing cultural projects such as murals and park movies was postponed to the February meeting.

Thu Nov 20, 2025

Board of Health

Board reviews show‑cause hearings for three properties ordered to connect to sewer

The Board of Health will hold continued show‑cause hearings for three properties ordered to connect to the municipal sewer at 5 North Cottage Street, 8 Old Tote Road, and 34 Route 6A. It will also consider deferral requests for 157 Route 6A (David & Carolyn Delgizzi) and for 86 A, 86 B, and 88 Route 6A (Margaret Dodge). Additional items include variance requests for 47 Nauset Heights Road, 21 Pleasant View Drive, and 5 Spinnaker Trail, approval of temporary food permits for Cape Cod Charcuterie, and adoption of the 2026 agenda.

sewerdeferralvariancefood-permitsagenda
✓ Decided: Board of Health approves variances and extends multiple sewer hearings

The Orleans Board of Health approved a variance for 47 Nauset Heights Road and a pool‑area variance for 21 Pleasant View Drive, each by a 4‑0‑0 voice vote. It also voted to continue show‑cause hearings for several Phase 1 sewer‑connection properties, setting new dates in December, March and May. All motions passed unanimously.

Thu Nov 20, 2025

Recreation Advisory Committee

Recreation Advisory Committee to discuss Eldredge Park renovation

The committee will meet to determine next steps for the Eldredge Park Renovation Project. Members will also review the Recreation Director's report and discuss future recreation programming.

recreationparkseldredge-parkprogramming
Thu Nov 20, 2025

Human Services Advisory Committee

Committee will begin reviewing human services applications

The Orleans Human Services Advisory Committee will receive an update on applications received, approve the minutes from the previous meeting, and start its review of new applications. Public comments and questions are invited throughout the meeting.

human-servicesapplicationspublic-commentadvisory-committee
✓ Decided: Committee approved prior meeting minutes and assigned members to upcoming tasks

The Human Services Advisory Committee unanimously approved the November 6, 2025 meeting minutes. No funding requests were voted on. Members were assigned to review specific organizations at the next meeting. The meeting was adjourned unanimously.

Thu Nov 20, 2025

Energy & Climate Action Committee

Energy & Climate Action Committee to hold heat pump training

The committee will meet to coordinate the Energy Navigator Program. The session includes a training presentation on heat pumps by Steve Burke of Rise Engineering.

energyclimateheat-pumpstraining
✓ Decided: Energy & Climate Action Committee adjourned the meeting unanimously

The committee held a special meeting on November 20, 2025 to review the Energy Navigators program and hear a heat‑pump specialist. Attendees introduced themselves and discussed outreach successes at the farmers market and senior center. No policy actions or approvals were made; the only formal action was a motion to adjourn, which passed unanimously.

Wed Nov 19, 2025

Select Board

Select Board to vote on residential tax exemptions and property acquisition

The Select Board will vote on a residential tax exemption program and the designation of 56 Eldredge Park Way as Unique Real Property. The board will also consider seasonal closure requests for two restaurants and a one-day alcohol license. Other business includes a Special Town Meeting recap and Town Manager reports.

taxeslicensingreal-estaterestaurantstown-management
Wed Nov 19, 2025

Zoning Board of Appeals

ZBA to hear request for walk-in freezer units at 5 Old Colony Way

The Zoning Board of Appeals will meet to review previous meeting minutes and consider a special permit or variance application. The board will discuss the placement of accessory buildings at a specific property in the VC district.

zoningspecial-permitvarianceaccessory-building
✓ Decided: Zoning Board unanimously approves variance for 5 Old Colony Way

The board approved the October 15, 2025 meeting minutes by a 5‑0 vote and noted that no minutes were submitted for November 5, 2025. Public comment on the variance request for 5 Old Colony Way was opened and then closed, each by a 5‑0 vote. The board then approved the requested variance for the property at 5 Old Colony Way with a unanimous 5‑0 vote.

Wed Nov 19, 2025

Open Space Committee

Open Space Committee to discuss property purchase and review minutes

The Orleans Open Space Committee will hold a meeting to discuss a possible property purchase in executive session and approve minutes from October. The next meeting is scheduled for January 21, 2026.

open-spacepropertycpcminutesmeeting
✓ Decided: OSC approved drafting a letter of support for OCT’s Cedar Pond land acquisition

The committee voted unanimously to enter and later adjourn an executive session. Members approved a motion for the Open Space Committee to draft a letter of support for the Orleans Conservation Trust’s Cedar Pond application. The minutes from the October 15, 2025 meeting were also approved unanimously, and the meeting was adjourned.

Wed Nov 19, 2025

Board of Water & Sewer Commissioners

Board of Water & Sewer Commissioners to discuss Watershed Management Plan

The Board will meet to discuss and potentially vote on a Watershed Management Plan. The agenda also includes discussions regarding pending litigation in Case # 2472CV00509 and updates on wastewater and water department operations.

water-managementsewerlitigationwatershedinfrastructure
✓ Decided: Board approved settlement reducing betterment to $15,000

The Board entered executive session and voted 7-0-0 to accept a settlement judgment that lowers the betterment payment from $38,080.62 to $15,000. It also approved a standby request for 51 Gibson Road and abated $57.75. The Board committed $55,641.10 in sewer receivables and $1,532,753.44 in water and sewer rate receivables for October 2025. Finally, it denied the sewer abatement request for 117 Route 6A, all votes 7-0-0.

Tue Nov 18, 2025

Snow Library Board of Trustees

Second presentation by artist Guy Laszlow Trudeau will be voted on

The exhibition committee will consider a second presentation by artist Guy Laszlow Trudeau and vote on it. The committee will also review minutes from the October 21, 2025 meeting, receive a financial report and a library director’s report from Tavi Prugno, and review the gallery schedule presented by Tom Genereux. Additional agenda items include public comment, old and new business, and adjournment.

libraryartsexhibitionfinancemeeting
✓ Decided: Board approved artist Guy Trudeau’s gallery work

The Snow Library Board approved artist Guy Trudeau’s work for the gallery. The board also approved the minutes from the September 16 meeting. Both motions were passed with all members in favor. The meeting was adjourned at 5:25 pm.

Tue Nov 18, 2025

Conservation Commission

Commission reviews two development amendment proposals on Pleasant View and Towhee Lane

The Orleans Conservation Commission will consider two continuation items. The first is a proposed amendment to the Order of Conditions for DEP #54-2638 submitted by Eastward MBT, LLC for a dry‑laid block patio and planting adjustments within a 100‑foot buffer of a bordering vegetated wetland at 21 Pleasant View Drive. The second is a proposal from Crawford Land Management for 65 Towhee Lane to reconstruct a single‑family dwelling, renovate an existing boathouse, and conduct site‑improvement and land‑management work on coastal beach, bank, salt marsh, and areas subject to coastal storm flowage within the Pleasant Bay ACEC. The commission will also hear public comment and review minutes from the Kents Point public hearing held on August 27, 2025.

zoningland-usewetlandscoastalpublic-hearing
✓ Decided: Conservation Commission approves two development projects, adding conditions

The commission unanimously approved the amended Order of Conditions for 21 Pleasant View Drive. It also unanimously approved the project at 65 Towhee Lane with standard and special conditions. No public comments were received during the meeting.

Tue Nov 18, 2025

Fourth of July Committee

Committee will approve minutes from the September 22 meeting

The Orleans Fourth of July Parade Committee will meet to approve the minutes of its September 22, 2025 meeting, consider any open positions, and address any new business items. The agenda also includes scheduling the next meeting and adjournment. No specific proposals or contracts are listed.

paradecommitteeproceduralminutes
✓ Decided: Committee sets next meeting for Jan 20 after skipping December session

The committee postponed voting on the September 22 minutes to a later meeting because a quorum was not present. It decided to skip a December meeting and schedule the next meeting for January 20. The motion to adjourn was passed unanimously.

Mon Nov 17, 2025

Select Board

Select Board meeting will address routine procedural items

The Orleans Select Board will hold its regular meeting on November 17, 2025. The agenda lists only standard procedural items: Call to Order, Any other Town Meeting Action, and Adjourn. No specific decisions, proposals, or discussions are detailed in the agenda.

governmentproceduresmeeting
Thu Nov 13, 2025

Orleans School Committee

Orleans School Committee to review FY26 budget updates and enrollment

The Orleans School Committee will meet to receive updates on FY26 grants and budgets from Assistant Superintendent Vicky Saldana. The body will also review the FY26 monthly financial report and 2025-2026 enrollment figures.

educationbudgetenrollmentschool-committee
Thu Nov 13, 2025

Finance Committee

Finance Committee will approve prior meeting minutes and set speaking assignments

The Orleans Finance Committee will vote to approve the minutes from the October 30, 2025 meeting. The committee will assign speaking roles for the pro and con sides of four articles that received split votes. Additional agenda items include announcements, liaison reports, and scheduling of future meetings.

financeminutesschedulepublic-comment
✓ Decided: Finance Committee appointed a new ex‑officio member to the Wastewater Advisory Committee

The committee approved the minutes from its October meetings with vote totals of 7‑0‑0, 5‑0‑2, and 7‑0‑0. Members were assigned as ex‑officio liaisons to various town boards, including Chris Kanaga to the Wastewater Management Advisory Committee. The meeting was formally adjourned by an 8‑0‑0 vote.

Thu Nov 13, 2025

Energy & Climate Action Committee

Energy committee to discuss roles on energy code and review decarbonization plan

The Orleans Energy and Climate Action Committee will meet to discuss its roles regarding a specialized energy code, review the Municipal Decarbonization Plan, and approve minutes from a previous meeting.

energyclimatetown-meetingzoningpublic-hearing
✓ Decided: Committee approved October 9 minutes and adjourned the meeting

The Energy & Climate Action Committee unanimously approved the minutes from the October 9, 2025 meeting. The committee also unanimously moved to adjourn the November 13, 2025 meeting. No other actions or votes were recorded; updates on solar projects, EV chargers, the decarbonization plan, and an Eversource presentation were informational.

Wed Nov 12, 2025

Historical District Study Committee

Historical District Study Committee to discuss 15 Main Street and CPC grant

The committee will review a Notice of Intent for 15 Main Street and a request to amend a Community Preservation Committee (CPC) grant for the Academy of Performing Arts. Members will also receive updates on the Form B and archaeology projects.

historic-preservationcpc-grantspublic-hearingsarchaeology
Wed Nov 12, 2025

Select Board

Open house special town meeting for residents to discuss anticipated topics

The Select Board announced a special town meeting open house on November 12, 2025 at 4:00 p.m. in the Nauset Room of Town Hall. The agenda lists a call to order, a warrant article titled “Open House,” and adjournment, and notes that discussion items are anticipated but not guaranteed. The Select Board may attend, but the meeting is not a regular Select Board meeting.

open-housespecial-town-meetingpublic-engagement
Wed Nov 12, 2025

Board of Assessors

Board reviews abatements and FY26 property values

The Board of Assessors will discuss the MV abatements report, the boat abatements report, and betterment payoff warrants. They will also consider FY26 property values and new growth. Minutes from the previous meeting will be approved. An executive session will be held to discuss real estate abatements confidentially.

property-taxabatementsfinanceassessmentsexecutive-session
✓ Decided: Board authorized members to stamp signatures on future sewer betterment payoff warrants

The Board unanimously approved boat and motor vehicle excise abatements totaling $2,444.17 and wrote off uncollectible taxes for 2019 MV excise, 2020 boat excise, and 2020 personal property tax. It signed four sewer betterment payoff warrants and granted all three members authority to stamp their signatures on future sewer betterment payoff requests. Minutes from the October 14 meeting were approved, and the Board entered executive session unanimously to consider abatement and exemption applications.

Wed Nov 12, 2025

Transportation and Bikeways Advisory Committee

Committee reviews Beach Road feasibility study and plans December agenda

The Transportation and Bikeways Advisory Committee will hear a presentation on the Beach Road feasibility study by VHB. A workshop with the committee and VHB will follow, after which the public may comment. The committee will also consider approving the minutes from the October 8 meeting and will plan the agenda for December.

transportationbikewaysplanningpublic-commentminutes
✓ Decided: Committee unanimously approves October 8 meeting minutes

The committee approved the minutes from the October 8 meeting by unanimous vote. The meeting was then adjourned unanimously. No substantive policy decisions were made, but a public forum for the Beach Road feasibility study was scheduled for the January‑March timeframe.

Fri Nov 7, 2025

Economic Development Committee

Economic Development Committee to discuss November 17 Special Town Meeting Warrant

The Economic Development Committee will meet to review staff updates and the Special Town Meeting Warrant scheduled for November 17. The session includes a period for public comment and the approval of previous meeting minutes.

economic-developmenttown-meetinglocal-government
✓ Decided: EDC unanimously backs Downtown Housing Overlay District (Article 2)

The committee approved the minutes from the October 14, 2025 meeting by a 4‑0‑0 vote. After discussion, members voted 5‑0 to formally support Article 2, the Downtown Housing Overlay District, at the upcoming Special Town Meeting. The meeting was then adjourned by unanimous consent.

Thu Nov 6, 2025

Community Preservation Committee

Committee will discuss grant applications and outlook for the upcoming grant season.

The Community Preservation Committee will provide updates on projects underway, discuss received and anticipated grant applications and the outlook for the grant season, and approve the minutes from the October 2, 2025 meeting. Public comment will be accepted before the meeting adjourns.

grantscommunity-preservationminutespublic-commentprojects
✓ Decided: Approved $8,860 Academy shutter grant shift and billed OHC website invoice

The committee voted to bill the Orleans Historic Commission website invoice to the FY26 grant for public education. It also approved repurposing $8,860 of the Academy preservation grant for shutters, pending OHC approval and compliance with standards. The minutes from the October 2, 2025 meeting were approved, and the meeting was adjourned.

Thu Nov 6, 2025

Human Services Advisory Committee

Committee will assign received applications and discuss outreach plans

The Human Services Advisory Committee will review and assign applications it has received. It will provide an update on a letter sent to nonprofits. The committee will discuss ideas for public relations, outreach, and inclusion of its work in the Orleans Comprehensive Plan. Additional procedural items and future business will also be noted.

human-servicesoutreachnonprofitscomprehensive-plantown-meeting
✓ Decided: HSAC approves minutes and assigns outreach actions for FY2027 funding

The committee unanimously approved the October 9, 2025 meeting minutes. Members were assigned to specific nonprofit applicants and agreed to call each organization to encourage FY2027 funding applications. The committee decided a review checklist was unnecessary and will invite Pleasant Bay Community Boating to meet on November 20. Susan will ask the Planning Board chair to include HSAC work in the Orleans Comprehensive Plan, and Meff will explore removing HSAC from the town budget cycle.

Thu Nov 6, 2025

Energy & Climate Action Committee

Committee will hear presentation and public comment on the Specialized Energy Code

The Energy & Climate Action Committee will hold a presentation on the Specialized Energy Code by the Department of Energy Resources. After the presentation, the public will have an opportunity to comment and ask questions about the code. No formal decisions are scheduled for this meeting.

energyclimate-actionspecialized-energy-codepublic-commentorleans
✓ Decided: Committee adjourned the meeting unanimously

The Energy & Climate Action Committee held a special meeting to gather public input on the Specialized Energy Code. The committee heard a presentation from Massachusetts Department of Energy Resources staff and comments from several residents. The meeting was adjourned at 8:15 p.m. by a unanimous motion.

Wed Nov 5, 2025

Select Board

Select Board will review FY27 budget policy and discuss Town Manager evaluation

The Orleans Select Board meeting on November 5, 2025 will consider the FY27 budget policy statement and the accompanying budget schedule. The board will also receive a report on the Town Manager’s evaluation and discuss a new evaluation instrument. Committee interviews with the Cultural District, Energy and Climate Action, and Transportation & Bikeways committees are scheduled. The meeting includes standard items such as public comment and announcements.

budgettown-manager-evaluationcommittee-interviewsgovernancepublic-comment
✓ Decided: Board adopts FY27 budget schedule and policy unanimously

The Select Board unanimously approved the FY27 budget schedule and policy. It also appointed John Dugan as an associate member of the Energy & Climate Action Committee and Bob McDonald as a regular member of the Transportation & Bikeways Committee, each for a term ending June 30, 2028. All three actions passed with a 4‑0‑0 vote.

Wed Nov 5, 2025

Zoning Board of Appeals

Zoning Board to hear home occupation sign and home addition permit requests

The Orleans Zoning Board of Appeals will meet to review meeting minutes and consider two special permit applications: a home occupation sign at 89 Nickerson Rd and home additions at 17 Deer Run.

zoningspecial-permithome-occupationbuilding-additionsorleans
✓ Decided: Zoning Board unanimously approves two special permits for a home‑occupation sign and a dwelling addition

The Orleans Zoning Board of Appeals approved a Special Permit for a sign at 89 Nickerson Road and a Special Permit for an addition to the dwelling at 17 Deer Run. Both approvals were voted unanimously 5‑0. The sign permit includes placement approval by the Building Commissioner, and the dwelling addition will exceed 4,000 sq ft of building coverage.

Wed Nov 5, 2025

Council on Aging

Board votes to approve minutes from the October 15, 2025 meeting

The Orleans Council on Aging Board will vote to approve the minutes from its October 15, 2025 meeting. It will discuss reports from the town’s representative to the Board of Elder Services of Cape Cod and the Islands, review the September 2025 budget summary and FY27 budget update, and consider a new action plan to improve relationships with town multi‑member bodies. Additional updates include a SNAP crisis briefing and FY26 board goals.

council-on-agingbudgetsenior-servicescommunity-outreachboard-meeting
✓ Decided: COA Board unanimously approved October meeting minutes

The board voted to approve the October 15, 2025 meeting minutes with a 6‑yes, 0‑no, 0‑abstain vote. The meeting was then adjourned unanimously. No other formal actions or votes were recorded.

Tue Nov 4, 2025

Affordable Housing Trust Fund Board

Board will discuss the Specialized Energy Code's impact on affordable housing

The Affordable Housing Trust Fund Board will meet via Zoom on November 4, 2025. The board will discuss the Specialized Energy Code and its potential impacts on affordable housing. It will also discuss warrant articles and the board’s position on them. No formal decisions are indicated in the agenda.

affordable-housingenergy-codewarrant-articleshousing-policyboard-meeting
✓ Decided: Board rejects support for Specialized Energy Code (2-4-2 vote)

The Affordable Housing Trust Fund Board considered a motion to support the Specialized Energy Code and voted it down 2-4-2. The board then unanimously approved support for Warrant Articles 2, 4, and 5. The meeting was adjourned by unanimous vote.

Tue Nov 4, 2025

Snow Library Board of Trustees

Board will vote on the FY2027 Action Plan for Snow Library

The Snow Library Board of Trustees will consider several routine items, including approval of the October 7, 2025 meeting minutes and reports on finances, exterior vegetation, and library operations. Trustees will vote on the FY2027 Action Plan and on a temporary early closing of the library at 5 pm on Wednesday, November 26, 2025. The meeting also includes a report from the Friends Representative before adjournment.

librarybudgetoperationscommunitymeeting
Tue Nov 4, 2025

Conservation Commission

Commission reviews coastal project amendments and a new conservation restriction

The Orleans Conservation Commission will discuss several amendment requests for coastal development projects, including changes to a patio, deck, and stairs at multiple parcels. It will also consider a certificate of compliance for site regrading and invasive‑species removal. Finally, the commission will review and vote on a proposed conservation restriction at 137 Skaket Beach Road.

coastal-developmentland-useconservationwetlandsstorm-flowage
✓ Decided: Conservation Commission approved a new conservation restriction at Skaket Beach

The Orleans Conservation Commission approved a conservation restriction for 137 Skaket Beach Road (5-0-0). It also approved the 3 Shore View Drive deck project with a pre‑construction meeting condition (7-0-0) and granted certificates and permits for Kents Point stairs, 10 Howard Way compliance, and a certificate of compliance. Two pending projects were continued to a hearing on November 18, 2025.

Thu Oct 30, 2025

Finance Committee

Finance Committee to vote on warrant articles for November Town Meeting

The Finance Committee will discuss and vote on warrant articles for the November 17, 2025, Town Meeting. The committee will also review its Code of Conduct.

financetown-meetinggovernment-oversight
Tue Oct 28, 2025

Conservation Commission

Amended Order of Conditions for Eastward MBT’s project at 21 Pleasant View Dr.

The Conservation Commission will consider an amendment to the Order of Conditions for a development by Eastward MBT, LLC at 21 Pleasant View Dr. The amendment proposes adding a dry‑laid block patio adjacent to the approved swimming pool and adjusting the locations of approved plantings. The work is planned within the 100‑foot buffer zone of a bordering vegetated wetland. Additional items may be discussed beyond those listed.

zoningenvironmentwetlandsdevelopmentconservation
Tue Oct 28, 2025

Cultural District Committee

Cultural District Committee will review minutes and discuss upcoming arts events

The committee will vote to approve the September 2025 meeting minutes. It will hear the treasurer’s report and an update on the MCC grant. Members will discuss planned events such as Pop‑Up Practices, the Solstice celebration, and Arts Week, as well as the committee website.

cultural-districtartsgrantsevents
✓ Decided: Committee unanimously supports Solstice labyrinth design with white tape and extra lighting

The Cultural District Committee approved the September 2025 minutes by unanimous vote. It also unanimously supported the proposed Solstice star‑labyrinth design, specifying white tape, additional lighting, and a five‑path star layout. The meeting was adjourned unanimously.

Tue Oct 28, 2025

Veterans Committee

Veterans Committee discusses upcoming Veterans Day service and monument updates

The Orleans Veterans Committee will receive an update on the construction meeting held on October 20, 2025. Members will discuss plans for the upcoming Veterans Day service, including agenda items and speakers. The committee will also review recent discussions about a statue on Monument Road. A motion to close the meeting will be considered.

veteranseventsconstructionmonumentsmeetings
Mon Oct 27, 2025

Marine & Fresh Water Quality Committee

Committee discusses Baker Pond management and pesticide reduction

The Marine and Fresh Water Quality Committee will review water quality monitoring closeouts for freshwater lakes, ponds, and estuaries. The body will discuss the Baker Pond Management Plan's Fall Town Meeting Warrant proposal and a support statement for the Orleans Pesticide Reduction HRP.

water-qualityenvironmentpesticideslake-managementmonitoring
✓ Decided: Committee approved September 22 meeting minutes unanimously

The Marine & Fresh Water Quality Committee unanimously approved the September 22 regular meeting minutes and the September 22 special meeting minutes (both 6-0-0). No new policies or contracts were adopted; members discussed monitoring updates, erosion issues, and upcoming projects.

Thu Oct 23, 2025

Housing Authority

Vote to approve Bad Debt write‑off at Orleans Housing Authority meeting

The Orleans Housing Authority will discuss its budget and director's report, review an old laundry room contract, and consider several new business items. Items include certificates of completion for septic work at the Meetinghouse, a CFA amendment, and votes on a Bad Debt write‑off, a Fair Market Housing Plan, and other projects. The board will also review the 2025 annual report, approve vouchers, and set the next meeting date.

housingfinancecertificatesdebtplanning
Thu Oct 23, 2025

Architectural Review Committee

Committee to discuss Downtown Housing Overlay District amendment

The Architectural Review Committee will review two property applications and discuss a proposed amendment to the Downtown Housing Overlay District. The body will consider a motion regarding its opinion of the zoning bylaw amendment.

zoninghousingarchitectural-reviewsigns
✓ Decided: ARC formed a working group to draft its position on the Downtown Housing Overlay amendment

The committee approved a vinyl siding replacement for 45 S. Orleans Rd. (4‑0‑0). It also approved the September 11 and October 9, 2025 meeting minutes (each 4‑0‑0). A motion to create a working group to summarize the ARC’s stance on the Downtown Housing Overlay District amendment passed unanimously (4‑0‑0). A prior recommendation to the Planning Board was withdrawn by unanimous agreement.

Wed Oct 22, 2025

Select Board

Select Board to vote on housing overlay district and pesticide bill

The Select Board will vote to request an official opinion on housing criteria and amend a purchase agreement. They will also discuss supporting a pesticide reduction bill at a public hearing.

housingzoningpesticidestown-meetingenvironmentselect-board
✓ Decided: Select Board approved amendment to 22 Old Tote Road purchase agreement

The board approved an amendment to the 22 Old Tote Road Purchase & Sale Agreement, setting a new closing date of Dec. 31, 2025 (vote 3‑0‑1). It also voted unanimously to request an official opinion on the Downtown Housing Overlay District eligibility (4‑0‑0). Additionally, the board approved a letter of support for the Orleans Pesticide Reduction Home Rule Petition (Bill H.995) (4‑0‑0).

Tue Oct 21, 2025

Affordable Housing Trust Fund Board

Board will vote on applying for a FY27 Community Preservation Committee grant

The Affordable Housing Trust Fund Board will consider a grant application to the FY27 Community Preservation Committee. It will also approve an amendment to the purchase and sale agreement for 22 Old Tote Road rental housing and set a timeline for related proposals. Discussions will cover the Stretch Code's impact on affordable housing and a notice of funding availability carried over from the previous meeting.

affordable-housinggrantsrental-housingzoningtax-exemptioncommunity-preservation
✓ Decided: AHTB approved applying for $700,000 FY27 grant to fund affordable housing

The board voted unanimously (6-0-0) to have staff apply to the Community Preservation Committee for a FY27 grant of $600,000 for a housing unit and $100,000 for gap funding. It also unanimously approved an amendment to the purchase and sale agreement for 22 Old Tote Road and accepted the Notice of Funding Availability as presented. All motions were carried with a 6-0-0 vote.

Tue Oct 21, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to vote on gallery exhibits and plaque wording

The Marion Craine Gallery Exhibition Committee will review artist presentations and exhibit applications. The board is also deciding on the wording for the Bobi Eldridge memorial plaque and the status of an annual Lower Cape Pride exhibit.

libraryartsgallerypublic-exhibits
✓ Decided: Committee approved annual Lower Cape Pride exhibit each June

The board unanimously approved the September 2025 minutes. It also approved Susan Karchmer and Rachael Sokolowski to exhibit in January and February, and adopted an annual Lower Cape Pride exhibit every June. The meeting was adjourned unanimously at 5:25 pm.

Tue Oct 21, 2025

Conservation Commission

Conservation Commission to review Kents Point Land Management Plan

The Conservation Commission will review several project applications and a request for a revised plan. The body will also discuss and possibly vote on changes to the Kents Point Land Management Plan.

conservationzoningland-managementenvironmental-review
✓ Decided: Commission approved bulkhead rehab at 13 Old County Rd with conditions

The Conservation Commission unanimously approved the bulkhead rehabilitation project at 13 Old County Rd, attaching findings and standard conditions plus special DMF letter requirements. It also approved a revised plan at 20 Seacrest Dr with stone delineators and no mulch (5‑2‑0), a restoration at 20 Cheney Rd, a like‑for‑like gravel driveway replacement at 16 High Tide Ln, and a Certificate of Compliance for a septic system at 26 Gibson Rd. Additionally, the commission adopted changes to the Kents Point Land Management Plan to seasonally restrict parking from June 15 to September 15, establishing a one‑year pilot and monitoring program.

Tue Oct 21, 2025

Veterans Committee

Veterans Committee to discuss monument designs and construction updates

The Memorial Day/Veteran’s Day Committee is meeting to review construction updates and monument designs. The session includes presentations from Crosby Monuments and Site One.

veterans-affairsmonumentspublic-works
Mon Oct 20, 2025

Orleans School Committee

Fire/Rescue station update and security briefing top agenda items

The Orleans School Committee will hear a security update from Chief MacDonald and a fire/rescue station update from Select Board Chair Kevin Galligan. The committee will also discuss the NPS religious exemption curriculum opt‑out, review administrators’ reports, and consider the FY27 budget timeline. A recurring item to declare a surplus will be addressed.

school-committeesecurityfire-rescuecurriculumbudgetsurplus
Thu Oct 16, 2025

Board of Health

Board will hold show cause hearings for five properties ordered to connect to sewer

The Orleans Board of Health will conduct continued show cause hearings for properties under an order to connect to the municipal sewer, including 5 North Cottage Street, 89 Old Colony Way, 8Old Tote Road, 34Route 6A, and 63 Route 6A. The board will also discuss the upcoming Orleans Municipal Sewer Project Phase 2. Additional agenda items include public comment, temporary food permit approvals for Surfside Seafood, Cape Cod Charcuterie, and Beach Patrol Taco’s N Stuff, a health agent report, and administrative matters.

sewerpublic-healthpermitswater-infrastructuremunicipal
✓ Decided: Board postpones multiple Phase 1 sewer hearings to November 2025

The Orleans Board of Health voted to continue five Phase 1 sewer connection hearings until November 6 or November 20, 2025. It also moved the deferral request for 157 Route 6A to November 20. The Board approved three temporary food permits and appointed a burial agent, then adjourned.

Wed Oct 15, 2025

Select Board

Board will vote on the November 17, 2025 Special Town Meeting warrant

The Select Board will hold a public hearing on transferring the liquor license for Rock Harbor Grill Inc. at 18 Old Colony Way, then vote on a new common victualler license for Cat Bar, Inc. at the same address and a one‑day alcohol license for Sunset Leisure at 96 Rt 6A. The board will also vote to appoint Jeremy Wiley as a student officer to the Orleans Police Department and to sign the November 17, 2025 Special Town Meeting warrant. Additional agenda items include committee interviews and resignations, a presentation on the Specialized Energy Code, and discussion of warrant articles for the special town meeting.

liquor-licensepolicespecial-town-meetingcommitteesenergy-code
✓ Decided: Select Board approved land acquisition for new fire‑rescue station costing $91.35 M

The board approved moving forward with a purchase‑and‑sale agreement to buy a 0.82‑acre parcel from Dr. Monfette for $1,350,000 to expand the fire‑rescue station and also approved a $91.35 million land acquisition for the fire‑rescue station project. It approved the transfer of the Rock Harbor Grill liquor license to Cat Bar, a new annual common victualler license for Cat Bar, and a one‑day liquor license for Sunset Leisure. Additional actions included appointing Jeremy Wiley as a student officer, appointing Joel Porten to the Transportation & Bikeways Committee, and supporting multiple Special Town Meeting warrant articles on zoning, the Specialized Energy Code, affordable‑housing tax exemption, community‑impact fee, and a capital improvement fund. All votes were unanimous (4‑0‑0) except the affordable‑housing tax exemption which passed 3‑0‑0.

Wed Oct 15, 2025

Zoning Board of Appeals

Board will consider two special permit applications for residential additions

The Orleans Zoning Board of Appeals will review minutes from its September 17, 2025 meeting. It will then hear two special permit requests: one for an addition at 77 Monument Rd and another for modifications at 30 Hayward Lane. The board will also address administrative items such as filing decisions within 14 days and reporting on the application review.

zoningspecial-permitsresidential-additionspublic-hearingorleans-ma
✓ Decided: Board unanimously approved two special permits for residential additions

The Orleans Zoning Board of Appeals approved a Special Permit for 77 Monument Rd and a Special Permit for 30 Hayward Lane, each with a unanimous 5‑0 vote. The board also approved the meeting minutes from September 17, 2025. No other substantive actions were taken.

Wed Oct 15, 2025

Open Space Committee

Open Space Committee meeting to discuss GIS lesson and CPC update

The Open Space Committee will hold its October 15 meeting to hear an online GIS lesson presented by John Jannell, receive a CPC update from Hardie, and consider approval of the August meeting minutes. The agenda also includes routine items such as call to order, chair business, scheduling the next meeting, and adjournment.

open-spacegiscpcminutesmeeting
✓ Decided: Open Space Committee approved prior minutes and adjourned the meeting

The committee approved the minutes from the September 17, 2025 meeting after a motion and second, with all members voting in favor. A motion to adjourn was made and seconded, and all members present voted to approve the adjournment. The next meeting was tentatively set for November 19, 2025.

Wed Oct 15, 2025

Council on Aging

Council on Aging board to discuss FY26 goals and FY27 budget priorities

The Orleans Council on Aging board will vote to approve the minutes from the September 24, 2025 meeting. The board will then review and discuss FY26 board goals and priorities. Finally, members will discuss the process for a new draft charge and possible recommendations for FY27 budget priorities.

council-on-agingbudgetsenior-servicesboard-governance
✓ Decided: Board approved FY26 COA goals and priorities

The Orleans Council on Aging Board approved the FY26 Board Goals and Priorities with a 6‑0 vote. The board also approved the September 24, 2025 meeting minutes by a 5‑0 vote. The meeting was then adjourned unanimously.

Wed Oct 15, 2025

Board of Water & Sewer Commissioners

Public hearing on the Watershed Management Plan scheduled for Oct. 15

The Orleans Board of Water & Sewer Commissioners will hold a hybrid meeting on October 15, 2025. The agenda includes a public hearing on the Watershed Management Plan, a FOG variance request for the Orleans Whole Foods Store, and an additional allocated flow project for 43 Route 6A. Several water abatement requests are also listed, along with departmental reports on wastewater and drought conditions.

watershedfog-variancewater-abatementsewerdrought
✓ Decided: Board approves Whole Foods grease‑tank variance and extra wastewater flow

The Orleans Water & Sewer Board voted unanimously to approve a variance allowing Orleans Whole Foods to pump its external grease tank every four months instead of three. It also approved an additional wastewater flow of 66 gallons per day for 43 Route 6A. Several financial commitments and water charge abatements were authorized, and a request for a water‑leak abatement was denied.

Tue Oct 14, 2025

Economic Development Committee

Annual Small Business Survey results presented to Orleans EDC

The Economic Development Committee will review the September 9, 2025 meeting minutes and receive a staff update from Economic Development Coordinator Amanda Converse. An intern will present the results of the town’s Annual Small Business Survey. The committee will consider the Special Town Meeting Warrant scheduled for November 17 and address any new business items.

economic-developmentsmall-businesstown-meetingsurveyupdates
✓ Decided: EDC scheduled a virtual meeting on Nov. 7 to review the Downtown Housing Overlay District warrant

The committee unanimously approved the September 9, 2025 meeting minutes (vote 4‑0‑0). It also scheduled a special virtual meeting for Friday, November 7 at 9:00 a.m. to review the final Downtown Housing Overlay District warrant and consider an EDC endorsement. No other substantive actions were taken.

Tue Oct 14, 2025

Board of Assessors

Board will discuss real estate abatements and Chapter 61 applications in executive session

The Orleans Board of Assessors will review reports on motor vehicle abatements, motor vehicle excise commitments, and boat excise commitments. It will also approve the meeting minutes and examine the monthly sales report. An executive session will be held to discuss real estate abatements and Chapter 61 applications, which are confidential matters.

assessorsabatementsexcisefinanceexecutive-session
✓ Decided: Board approved $200,000 overlay surplus release for FY2026 budget

The Board unanimously approved 16 motor vehicle excise tax abatements totaling $7,926.92 and released $200,000 of overlay surplus for the FY2026 budget. It also unanimously authorized the Assessor to sign FY2026 tax recap sheets and approved boat and motor vehicle excise commitments for FY2026 and 2025. The minutes of the September 9 session were approved, and the board voted 2‑0 to adjourn and enter executive session.

Tue Oct 14, 2025

Conservation Commission

Repair of a 135‑foot timber bulkhead at Town Cove

The Orleans Conservation Commission will discuss two conservation projects. One proposal is to restore about one‑third of the Orleans Conservation Trust property at 20 Cheney Rd into a high‑functioning eastern sandplain grassland, including vegetation alteration and invasive species removal. The other proposal is to repair, replace, and rehabilitate an existing timber bulkhead about 135 feet long (69 feet within Orleans) at 13 Old County Rd along Town Cove, involving work on coastal bank and related marine lands.

conservationenvironmentcoastalhabitatinfrastructure
Tue Oct 14, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee reviews proposed shellfish grant regulation changes and clam presence

The Shellfish & Waterways Improvement Advisory Committee will review proposed changes to shellfish grant regulations. Members will discuss whether manila clams are present in Orleans and Eastham waters. The meeting includes a public comment period and a report from Natural Resources Manager, Harbormaster, and Shellfish Constable Nate Sears.

shellfishwater-qualityfisheriespublic-commentnatural-resources
✓ Decided: Committee unanimously approved the Shellfish Grant Regulations

The advisory committee approved the meeting minutes without changes. The committee unanimously approved the Shellfish Grant Regulations after discussion. The meeting was then unanimously adjourned.

Tue Oct 14, 2025

Cultural Council

Council will discuss 2026 grant cycle deadlines and upcoming cultural projects

The Orleans Cultural Council will approve the September meeting minutes and hear the treasurer's report, which includes a grant update and the FY25 budget submission. Members will discuss the 2026 grant cycle, including deadlines for requests. The council will also follow up on a mural project, movies in the park, and consider holiday decorations through the Recreation Department.

culturalgrantsbudgetartsrecreation
✓ Decided: Council approves September minutes and votes to fund holiday display

The Orleans Cultural Council approved the September meeting minutes. A unanimous vote approved financial assistance for a new holiday display on the Village Green, though the exact amount will be set at a later meeting. No other formal actions were taken.

Thu Oct 9, 2025

Finance Committee

Finance Committee will discuss minutes, a climate presentation, and upcoming warrant articles

The Orleans Finance Committee will consider approval of the September 25 meeting minutes. A presentation by John Londa of the Energy and Climate Committee will be given. Members will discuss and vote on warrant articles for the November 17 Fall STM. The committee will also review upcoming meeting dates and locations.

financeminutesclimatewarrant-articlesmeeting-schedule
✓ Decided: Finance Committee recommends funding for wastewater engineering support

The committee approved the minutes from the September 25 meeting unanimously. It voted 7‑0‑0 to recommend the Fund Wastewater Engineering Support article. A recommendation for the Downtown Housing Overlay District was initially voted 3‑3‑1 and then rescinded by a unanimous 7‑0‑0 vote. The meeting was adjourned with a 7‑0‑0 vote.

Thu Oct 9, 2025

Human Services Advisory Committee

Committee will review and update its review and assignment processes

The Human Services Advisory Committee will receive updates on its charge, website, shared drive, a letter to nonprofits, and multi‑member bodies orientation. It will then discuss the committee’s review process and consider how to handle assignments, interview clustering, and outreach ideas. The meeting will also address how to manage late applications and set future calendar dates.

human-servicescommitteeprocessoutreachupdates
✓ Decided: Committee set a $200,000 budget assumption for FY27

The Human Services Advisory Committee approved the June 26, 2025 meeting minutes (4‑in‑favor, 1 abstention). It adopted a $200,000 budget assumption for FY27 and agreed to begin reviewing applications as soon as they are received. Members decided to interview all new applicants, to wait for agency applications before assigning reviewers, and assigned outreach and scheduling tasks. The meeting was adjourned unanimously.

Thu Oct 9, 2025

Energy & Climate Action Committee

Committee will recommend a Climate Action Roadmap to the Select Board

The Orleans Energy & Climate Action Committee will discuss several updates and outreach efforts, and will make a recommendation to the Select Board on the town's Climate Action Roadmap. It will also consider an appointment of a representative from Eversource for grid modernization and heat‑pump rate issues. The meeting includes updates from town staff, the local climate network, and a review of liaison assignments.

climate-actionenergyboard-recommendationsoutreachappointments
✓ Decided: Committee approved September 11, 2025 meeting minutes

The Energy & Climate Action Committee approved the minutes from the September 11, 2025 meeting, noting a needed clarification on the Climate Action Plan funding reference. The motion was moved by Roger McDaniel, seconded by David Jacobson, and passed unanimously. No other substantive actions were taken at this meeting.

Thu Oct 9, 2025

Architectural Review Committee

ARC will review property improvement applications and a new zoning by‑law presentation.

The Architectural Review Committee will consider six scheduled applications, including siding replacement, roof replacement, solar panel installation, landscaping, and sign modifications. The committee will also hear a presentation from the Planning Department on a new zoning by‑law. Minutes from the September meetings will be approved.

zoningarchitecturesignagesolarroofing
✓ Decided: ARC approves solar panels, new signs, roof replacement and grass planting

The Architectural Review Committee approved the installation of 366 solar panels on the Seashore Park Inn roof, a grass planting project at the same site, a new sign for Idle Times Bike Shop, a new HERS Raters of Cape Cod sign, and a full roof replacement for the Seashore Park Inn. The committee also postponed review of the meeting minutes and formally adjourned the meeting.

Wed Oct 8, 2025

Historical Commission

Discussion of Public Education Initiative status and next steps

The Orleans Historical Commission will vote to approve the September 10, 2025 meeting minutes and review several open items, including draft statements of work for the Form B and Archaeology projects, an external website hosting payment, and the status of a public education initiative. The commission will also consider sunsetting its Facebook account and address any new business before setting future agenda items.

historicaleducationwebsiteminutesprojects
Wed Oct 8, 2025

Select Board

Select Board to discuss Luxury Real Estate Transfer Fee and Special Town Meeting

The Select Board will consider an amendment to its meeting agenda policy and discuss a proposed Luxury Real Estate Transfer Fee. The board may also vote on supporting warrant articles for a Special Town Meeting.

real-estatetaxestown-meetinggovernancepolicy
✓ Decided: Board unanimously approved adding Wampanoag acknowledgment to meeting agenda

The Select Board voted 4-0-0 to enter Executive Session to discuss real‑property matters. It then unanimously approved an amendment to Select Board Policy A‑3 to include a Wampanoag acknowledgment statement on the agenda. The Board discussed a proposed real‑estate transfer fee and warrant articles but took no votes. The meeting was adjourned by unanimous vote.

Wed Oct 8, 2025

Transportation and Bikeways Advisory Committee

Committee to discuss speed reduction and intersection safety

The Transportation and Bikeways Advisory Committee will discuss speed reduction strategies and a dangerous intersection review. The body will also review crosswalk policy and a field survey for Main Street.

transportationbikewaysroad-safetysignageinfrastructure
✓ Decided: Committee approved new meeting schedule: first Monday 3:30‑5:00 pm

The Transportation and Bikeways Advisory Committee unanimously approved moving regular meetings to the first Monday of each month, 3:30‑5:00 pm, starting in January. The committee also agreed to award the Main Street field survey contract to VHB immediately. The crosswalk policy will be revised and forwarded to the Select Board, and no action will be taken on the Route 28/Lake Drive intersection at this time.

Tue Oct 7, 2025

Snow Library Board of Trustees

Board will discuss the FY2027 Action Plan draft and facility assessment request

The Snow Library Board of Trustees will review and discuss the FY2027 Action Plan draft. They will also consider the Orleans request for proposals (RFQ) for a comprehensive facilities assessment of town‑owned facilities. Additional items include a financial report, the library director’s report, and the Friends representative report. The meeting will conclude with adjournment.

libraryfinancefacilitiesplanningcommunity
✓ Decided: Board unanimously approved the September 2025 meeting minutes

The trustees voted to approve the September 2025 minutes, with all members in favor. A motion to adjourn the meeting was also passed unanimously. No other motions were voted on.

Tue Oct 7, 2025

Conservation Commission

Conservation Commission to review residential projects and land restoration

The Conservation Commission will hear notices of intent for residential construction and renovations. The body will also consider a restoration project for eastern sandplain grassland and a request to support an amended Conservation Restriction.

conservationzoningenvironmental-protectionland-management
✓ Decided: Commission approved 21 Little Bay Rd pool project with monitoring and fence removal

The Conservation Commission unanimously approved the 5 Captain Linnell Rd addition with conditions on plastic material handling, a no‑mow zone, and a revised storm‑water plan. It also unanimously approved the 21 Little Bay Rd pool replacement, requiring removal of a split‑rail fence, annual monitoring, tree replacement, and overseeding of the lawn. The hearings for 65 Towhee Lane and 3 Shore View Dr were each continued to November 4, 2025. All votes were 7‑0‑0.

Thu Oct 2, 2025

Select Board

Select Board to discuss Eldredge Park Renovation project

The Orleans Select Board meeting on October 2, 2025 will discuss a Community Preservation Committee application for the Eldredge Park Renovation project. The agenda also includes a call to order and an adjournment. The meeting may address additional items not listed, as noted in the disclaimer.

parkscommunity-preservationorleanstown-meeting
Thu Oct 2, 2025

Board of Health

Board reviews sewer connection orders and multiple permit requests

The Orleans Board of Health will hold continued show‑cause hearings for three properties ordered to connect to the municipal sewer. It will consider a hearing request for 130 Brick Hill Road and variance requests for 39 Champlain Road and 14 Greymoor Way. The board will also review several temporary food permit applications for local events and vendors.

healthsewerpermitsvariancesfoodzoning
✓ Decided: Board of Health approves building permit and multiple variances, extends sewer hearings

The Orleans Board of Health approved a building permit for 130 Brick Hill Road and granted variances for pool fencing at 39 Champlain Road and septic capacity at 14 Greymoor Way. It also extended show‑cause hearings for Phase 1 sewer connections at several properties, moving deadlines to October 16 or December 18, 2025. All temporary food service permits and one mobile food service permit were approved, and the minutes from the May 15, 2025 meeting were adopted.

Thu Oct 2, 2025

Community Preservation Committee

Committee will vote on Eldredge Park Renovation funding application

The Orleans Community Preservation Committee will hold a public hearing on October 2, 2025, with in‑person and Zoom participation. Members will discuss letters received about the Eldredge Park Renovation and then vote on application 16 F CPC FY26 for that project. A conservation presentation by Stephen O’Grady and project updates will also be provided. The meeting will conclude with approval of the September 4, 2025 minutes.

community-preservationparkspublic-hearingconservationminutes
✓ Decided: CPC recommends $3 million Town Meeting loan for Eldredge Park renovation

The Community Preservation Committee voted to recommend that the Town Meeting borrow $3 million for the Eldredge Park Renovation project. The motion passed with a vote of 8‑0‑1. The committee also approved the minutes from September 4, 2025, closed the Select Board, and adjourned the meeting.

Wed Oct 1, 2025

Select Board

Select Board to review Open Space and Recreation Plan and festival licenses

The Select Board will consider endorsing a draft Open Space and Recreation Plan by Weston & Sampson. The board will also vote on various licenses for the Outermost Roots and Blues Festival and determine warrant articles for a Fall Special Town Meeting.

open-spacelicensingfestivalstown-meetingwater-infrastructure
✓ Decided: Select Board unanimously approves Open Space and Recreation Plan

The Board voted 4‑0‑0 to approve the Open Space and Recreation Plan draft prepared by Weston & Sampson. It also approved several one‑day alcohol and outdoor‑entertainment licenses for the Friends of Nauset Beach festival events on October 11‑12, and a two‑day Hawkers & Peddlers license for Billingsgate Market. Additionally, the Board authorized Town Manager Kim Newman to act as the town’s representative for the Massachusetts Clean Water State Revolving Fund Phase 3 application, also by a 4‑0‑0 vote.

Wed Oct 1, 2025

Zoning Board of Appeals

Special permits considered for home additions at 77 Monument Rd and 30 Hayward Lane

The Orleans Zoning Board of Appeals will review minutes from its September 17, 2025 meeting. It will then consider two special permit applications: one for a proposed addition to a single‑family house at 77 Monument Rd, and another for footprint, deck, and storage modifications at 30 Hayward Lane. The board may discuss additional items at the Chair's discretion.

zoningpermitshousingboardhearings
Wed Oct 1, 2025

Board of Water & Sewer Commissioners

Board conducts site visit to 350 South Orleans Rd to assess watershed

The Orleans Board of Water & Sewer Commissioners will hold a special meeting on October 1, 2025 at 1:00 PM for a site visit to 350 South Orleans Rd. The visit is intended to understand the watershed area and its current allowed uses before the scheduled public hearing on October 15, 2025. The meeting will take place at the DPW office, 40 Giddiah Hill Rd.

watersewerwatershedsite-visitpublic-hearing
Tue Sep 30, 2025

Veterans Committee

Veterans Committee to discuss memorials and Veterans Day planning

The Memorial Day/Veteran’s Day Committee is meeting to discuss the Vietnam and Korean War memorials. The group will also review brick sales and begin planning for Veterans Day.

veterans-affairsmemorialspublic-artcommunity-events
Thu Sep 25, 2025

Finance Committee

Finance Committee proposes canceling 10/23 meeting to attend Comprehensive Plan forum

The Finance Committee will discuss budget priorities from the September 24 joint public hearing with the Select Board and review capital planning and revenue/budget working groups. It will consider a proposal to cancel the October 23 Finance Committee meeting so members can attend the Orleans Citizens Forum Planning Board presentation of the Comprehensive Plan. The committee will also approve the minutes from the September 11 meeting and receive updates and liaison reports. Upcoming meeting dates will be confirmed.

financebudgetplanningmeetingspublic-hearing
✓ Decided: Finance Committee cancelled the October 23 meeting to attend a planning board presentation

The committee approved the minutes from the September 11 meeting by an 8‑0‑0 vote. It then decided to cancel the October 23 Finance Committee meeting so members could attend the Planning Board's Comprehensive Plan presentation. No other substantive actions were taken.

Thu Sep 25, 2025

Architectural Review Committee

Walkway replacement and landscape planting at 15 Locust Rd.

The Orleans Architectural Review Committee will consider a scheduled application to replace a walkway and enhance landscape plantings at 15 Locust Rd. The committee will also vote to approve the meeting minutes from September 11, 2025. Additional matters may be discussed at the Chair's discretion.

architectural-reviewwalkwaylandscapingminutestown-meeting
✓ Decided: ARC approves 15 Locust Road walkway improvement application

The Architectural Review Committee voted to accept the application for improvements to the walkway at 15 Locust Road. The motion was moved by Ms. Marsh, seconded by Ms. McMahan, and passed unanimously with a 3‑0‑0 vote.

Wed Sep 24, 2025

Select Board

Board will vote on road closure for Halloween Stroll and a one‑day alcohol license

The Select Board will consider several items, including a road closure request for the Orleans Chamber of Commerce’s Halloween Stroll on Oct. 25, 3:00‑4:30 p.m., and a request for a one‑day alcohol license for Agway of Cape Cod at 20 Lots Hollow Road on Oct. 3, 2025, 4:00‑6:00 p.m. The board will also hear a presentation on a possible special town meeting article for body‑worn and in‑car video cameras, and will hold a joint public hearing with the Finance Committee on upcoming budget priorities. Additional agenda items include recognition of the Orleans Intern Program “Spirit of Massachusetts Award,” follow‑up discussion of the Residential Tax Exemption Program, and interviews for affordable‑housing and cultural‑district committee appointments.

road-closurealcohol-licensingpublic-safetybudgetzoninghousingcultural-district
Wed Sep 24, 2025

Council on Aging

Council on Aging will vote on Eldredge Park renovation support

The Orleans Council on Aging board will review and vote on several items, including the Eldredge Park Renovation Plan. Members will discuss funding for a new COA vehicle and set priorities for the FY27 budget. The board will also consider a draft charge to submit to the Select Board and approve the minutes from the July 23 meeting.

agingbudgettransportationparksgovernance
✓ Decided: COA Board approved Eldredge Park renovation plan and adopted 2026 schedule

The board approved the minutes from the July 23, 2025 meeting. It adopted the 2026 COA Board meeting schedule. Members voted to support the Eldredge Park Renovation Plan. The board also approved a new draft charge and sent it to the Select Board for approval.

Wed Sep 24, 2025

Finance Committee

Joint public hearing on FY 26 budget priorities with the Select Board

The Finance Committee will hold a joint public hearing with the Select Board to discuss FY 26 budget priorities for upcoming fiscal years. The meeting will be hybrid, allowing in‑person attendance at the Nauset Room, Town Hall, and remote participation via Zoom. After the hearing, any other business may be considered. The meeting will adjourn at the end of the session.

budgetfinancepublic-hearingselect-boardtown-meeting
Tue Sep 23, 2025

Conservation Commission

Orleans Conservation Commission holds on-site meeting

The Orleans Conservation Commission will hold an on-site meeting at Town Hall on September 23, 2025. The agenda lists matters anticipated by the Chair, though not all items may be discussed.

conservationtown-hallon-site-meetingagenda
Tue Sep 23, 2025

Cultural District Committee

Cultural District Committee to discuss FY26 budget and priorities

The Cultural District Committee will meet to review the FY26 budget and determine priorities for 15K in MCC funding. The body will also discuss upcoming events and website updates.

budgetartsculturecommunity-events
✓ Decided: Committee unanimously approved the August 2025 minutes

The Cultural District Committee approved the August 2025 meeting minutes by unanimous vote. No other actions were formally approved; the committee discussed upcoming events, potential Arts Week funding, and banner repairs, but deferred decisions pending budget confirmation. The meeting was adjourned unanimously and the next meeting is set for Oct. 28, 2025.

Mon Sep 22, 2025

Marine & Fresh Water Quality Committee

Committee will discuss alum treatment recommendation for Baker Pond

The Marine and Fresh Water Quality Committee will meet on September 22, 2025 to review the Baker Pond Management Plan, including an overview and update, and to consider a recommendation to use alum treatment for Baker Pond. The meeting will also include a period for public comment before adjourning.

water-qualityenvironmentpond-managementalum-treatmentpublic-hearing
✓ Decided: Committee discussed alum treatment for Baker Pond but took no action

The Marine & Fresh Water Quality Committee met on September 22, 2025 to review the Baker Pond Management Plan and consider a short‑term alum treatment to address phosphorus. Members presented data and public comments were heard, and the committee outlined next steps for a Town Meeting article and possible funding. No formal vote, approval, denial, or other decision was recorded at this meeting.

Mon Sep 22, 2025

Marine & Fresh Water Quality Committee

Committee to discuss Baker Pond Management Plan and Town Meeting proposal

The Marine and Fresh Water Quality Committee will receive updates on water quality monitoring for local lakes, ponds, and estuaries. The body will also discuss the Baker Pond Management Plan and a related proposal for the Fall Town Meeting Warrant.

water-qualityenvironmentbaker-pondcedar-pondmonitoring
✓ Decided: Committee unanimously approved the August 25, 2025 meeting minutes

The Marine & Fresh Water Quality Committee approved the minutes from the August 25, 2025 meeting with a 4‑0‑0 vote. No other formal actions were voted on; the remainder of the meeting consisted of updates on water‑quality monitoring, wastewater management, cyanobacterial monitoring, and upcoming public outreach events.

Mon Sep 22, 2025

Fourth of July Committee

Orleans Fourth of July Parade Committee to debrief 2025 event

The committee will meet to review the 2025 parade and discuss open positions. The meeting includes time for new business and scheduling the next session.

community-eventsparadevolunteers
✓ Decided: Parade committee adjourned unanimously after debrief and planning

The Fourth of July Parade Committee met on September 22, 2025, debriefed the 2025 parade and identified several logistical challenges. Members discussed possible assistance from the Recreation Department, including police detail, storage space, and a flatbed truck for judges. No formal approvals or denials were recorded. The meeting was adjourned by a unanimous motion.

Thu Sep 18, 2025

Board of Health

Board may vote on the Crescendo Community Engagement Project

The Orleans Board of Health will discuss a possible vote on the Crescendo Community Engagement Project. It will also hold continued show‑cause hearings for properties ordered to connect to the municipal sewer, and consider a variance request for 13‑B Standish Road. Additional items include temporary food permit approvals for several vendors and a rabies vaccination exemption request.

healthsewerzoningpermitscommunity-engagementfestival
✓ Decided: Board approves 66‑ft pool fence variance and commits $3,750 to regional engagement

The Orleans Board of Health approved a 66‑foot variance for a pool fence at 13‑B Standish Road, allowing the fence to be placed 86 feet from the pool apron with required safety features. It also voted to allocate $3,750 of opioid‑abatement funds to a Crescendo Consulting community‑engagement study with neighboring towns. Several ongoing sewer‑connection show‑cause hearings were postponed to October dates, and temporary food permits for four vendors and a rabies‑vaccination exemption for a cat were approved. All votes were unanimous voice votes.

Thu Sep 18, 2025

Recreation Advisory Committee

Town reviews 2025 Open Space and Recreation Plan update

The joint Conservation Commission and Recreation Advisory Committee will hear a presentation of the 2025 Open Space and Recreation Plan update by Town Planner George Meservey. Committee members and the public will discuss the plan and ask questions. The meeting will conclude with a vote on the proposed updates.

recreationopen-spaceplanningconservationtown-meeting
✓ Decided: Recreation Advisory Committee unanimously backs 10‑Year Open Space Plan

The committee voted to formally support the Draft Open Space and Recreation Plan presented by George Meservey. The motion passed unanimously, 5‑0. The meeting was then adjourned at 6:30 PM.

Thu Sep 18, 2025

Open Space Committee

Town presents 2025 Open Space and Recreation Plan update for discussion

The Open Space Committee, meeting jointly with the Recreation Advisory Committee and the Conservation Commission, will hear a presentation of the 2025 Open Space and Recreation Plan update from Town Planner George Meservey. The agenda includes public comment, discussion and questions, and a vote on the plan update.

open-spacerecreationplanningcommitteepublic-comment
Thu Sep 18, 2025

Conservation Commission

Commission reviews 2025 Open Space and Recreation Plan update

The Conservation Commission and Recreation Advisory Committee will hear a presentation of the Open Space and Recreation Plan Update for 2025 by Town Planner George Meservey. Members of the public may comment. The bodies will discuss the plan and hold a vote.

open-spacerecreationplanningpublic-comment
Wed Sep 17, 2025

Zoning Board of Appeals

ZBA to consider special permit for additions at 9 Little Marsh Lane

The Zoning Board of Appeals will meet to review minutes from a previous meeting and continue a public hearing regarding a residential property. The board is considering a request to alter a nonconforming structure and adjust a front yard setback.

zoningspecial-permitresidential-constructionsetbacks
✓ Decided: Board unanimously approves Special Permit for 9 Little Marsh Lane

The Orleans Zoning Board of Appeals approved the September 3, 2025 meeting minutes, closed public comment on Case #2025-13, and approved a Special Permit for 9 Little Marsh Lane. The permit allows a six‑inch front‑setback increase and a second‑floor addition to the nonconforming residence. All three actions were approved by a unanimous 5‑0 vote.

Wed Sep 17, 2025

Open Space Committee

Open Space Committee will discuss updates and approve meeting minutes

The Orleans Open Space Committee will consider an update on the 22 Tonset project, hear announcements about CPC happenings, and vote to approve the August meeting minutes. The agenda also includes routine items such as public comment, chair business, and scheduling the next meeting for October 15, 2025. The meeting is set for September 17, 2025 at 9:00 AM in the Skaket Room of Orleans Town Hall, with remote access via Zoom.

open-spaceminutesplanningpublic-comment
✓ Decided: Open Space Committee approved the August 20 minutes and adjourned

The committee voted to approve the minutes from the August 20, 2025 meeting, with all members present voting in favor. A motion to adjourn the September 17 meeting was also approved by all members present. No other formal actions or votes were recorded.

Wed Sep 17, 2025

Board of Water & Sewer Commissioners

Board of Water & Sewer Commissioners to discuss Watershed Management Plan

The Board will meet to discuss the Watershed Management Plan and reorganize the Board. The meeting includes reports on wastewater infrastructure and water department updates regarding a September drought.

water-managementsewer-infrastructurewatershed-planningutilitiespublic-works
✓ Decided: Board approved public hearing for watershed management plan on Oct 15, 2025

The Board voted 7‑0‑0 to schedule a public hearing for the watershed management plan on October 15, 2025. It also extended mandatory water‑use restrictions through December 31, 2025 with a 7‑0‑0 vote. Several financial actions were approved, including committing sewer receivables of $44,789.50 and water/ sewer rate receivables of $4,772.54 for August 2025, and issuing refunds and shut‑off letters.

Tue Sep 16, 2025

Affordable Housing Trust Fund Board

Board to discuss rental housing RFP for 22 Old Tote Road

The Affordable Housing Trust Board will review project updates and discuss a Request for Proposals for four rental housing units at 22 Old Tote Road. The board will also hear a presentation on the Specialized Stretch Code and discuss funding availability criteria.

affordable-housingrental-housingzoningstretch-codehousing-trust
✓ Decided: Board approved August minutes and adjourned the meeting

The Affordable Housing Trust Fund Board approved the minutes from the August 18, 2025 meeting with a 5-0-2 vote. The board then adjourned the September 16, 2025 meeting unanimously (7-0-0). No other substantive actions were decided.

Tue Sep 16, 2025

Snow Library Board of Trustees

Snow Library Exhibition Committee to consider presentation by artist Darcy Herrington

The Marion Craine Gallery Exhibition Committee will meet to review the gallery schedule and hear a presentation from artist Darcy Herrington. The board will also review the financial and library director's reports.

libraryartsgallerypublic-meetings
✓ Decided: Committee approved the August 2025 meeting minutes

The board voted unanimously to approve the minutes from the August 2025 meeting. Library Director Tavi Prugno will email committee members suggested wording for a memorial plaque for founder Bobi Eldridge. The committee will follow up next month on artist Brian Ramsay’s submission for a future exhibit. The meeting was adjourned at 4:45 pm.

Tue Sep 16, 2025

Conservation Commission

Review of pool replacement and hardscape project at 21 Little Bay Rd

The Conservation Commission will consider a Notice of Intent to replace an existing pool and hardscape at 21 Little Bay Road, including vegetated buffer work within the 100‑foot coastal buffer and Pleasant Bay ACEC. It will also hear continuance requests for road improvements at 45 Old Field Road, a deck extension at 3 Shore View Drive, and a revised plan to replace an ornamental cherry with three tupelos at 27 Cheney Road. The meeting includes discussion of the Kents Point public hearing (8/27/25) on Land Management Plan updates. Public comment will be allowed.

conservationcoastalland-managementpublic-hearingenvironment
✓ Decided: Commission approved 45 Old Field Rd road and bank stabilization project

The Commission unanimously approved the road improvement and bank stabilization project at 45 Old Field Rd, attaching findings, standard conditions, and specific monitoring requirements. It also approved a revised planting plan for 27 Cheney Rd, replacing an ornamental cherry with three native tupelos. The Commission continued public hearings for the Little Bay Rd pool project, the Shore View Dr deck project, and set a new hearing date of October 7, 2025 for each. Additionally, the Commission directed staff to develop findings and a proposed motion for a seasonal sticker‑parking pilot at Kents Point and adjourned the meeting.

Mon Sep 15, 2025

Orleans School Committee

Orleans School Committee to discuss Special Education Stabilization Fund

The Orleans School Committee will meet to review administrator reports and the NRHS Building Project. The committee is scheduled to discuss and vote on the Special Education Stabilization Fund and approve gifts and grants.

educationbudgetspecial-educationschool-constructionpublic-finance
✓ Decided: Committee approved $124,139 transfer to Special Education Stabilization Fund

The Orleans School Committee voted to return the FY25 budget excess of $124,139 to the town and to place a warrant article to move those funds into the Special Education Stabilization Fund. The committee also accepted a $5,614 gift from the Orleans Conservation Trust, approved the 2025‑2026 PTC fundraisers, and approved the minutes from the June 9, 2025 meeting. All motions were adopted unanimously.

Thu Sep 11, 2025

Finance Committee

Finance Committee to discuss subcommittees and FY27 budget policy

The Orleans Finance Committee will meet to discuss the formation of subcommittees for capital planning and revenue/budget, review meeting schedules, and hold a joint meeting with the Select Board regarding the FY27 Budget Policy.

financebudgetsubcommitteesselect-boardbroadbandmeeting-schedule
✓ Decided: Finance Committee approved August minutes and adjourned the meeting

The Orleans Finance Committee unanimously approved the minutes from the August 28, 2025 meeting. The committee discussed the formation of working groups and received updates on various town projects, but no further actions were taken. The meeting was then adjourned by an 8‑0‑0 vote.

Thu Sep 11, 2025

Energy & Climate Action Committee

Committee considers appointment with RevEnergy LLC for energy monitoring

The Energy & Climate Action Committee will hear public comment, consider an appointment with Tom Boudreau of RevEnergy LLC on energy monitoring, receive updates from the Assistant Town Manager and local climate groups, review the Comprehensive Plan before its draft release, and vote to approve minutes from the August 14 and August 21 meetings.

energyclimateplanningpublic-commentminutestown-government
✓ Decided: ECAC approves meeting minutes and proceeds with up to $100K Climate Action Plan

The committee approved the minutes from the August 14, 2025 meeting. It decided to move forward with the Climate Action Plan, authorizing up to $100,000 in spending without further approvals. The sole solar‑project bidder was deemed acceptable and a contract is being finalized, and the EV‑charger package has been resubmitted to Eversource pending response.

Thu Sep 11, 2025

Architectural Review Committee

Committee will decide on a windows, deck and chimney project at 143 Rt 6A

The Architectural Review Committee will consider two property improvement applications. One is from George Davis Inc for windows, a deck, and a chimney replacement at 143 Rt 6A. The other is a continued application from Idle Times Bike Shop for a window replacement at 29 Main Street. The committee will also approve the minutes from the August 28, 2025 meeting and may discuss any other matters the chair raises.

architectural-reviewbuilding-permitsconstructiontown-meetingorleans
✓ Decided: ARC approved deck, chimney work at 143 Route 6A and modified window plan for Idle Times

The Architectural Review Committee approved George Davis Inc.'s application to replace the deck, railing, and chimney at 143 Route 6A with a 4‑0‑0 vote. The committee also approved Idle Times' submission A2 for 29 Main Street, adding specific window framing, mullion, color, plantings, and lighting modifications, also by a 4‑0‑0 vote. Minutes from the August 28, 2025 meeting were approved, and the meeting was adjourned.

Wed Sep 10, 2025

Historical Commission

Commission will vote to approve minutes from June, July, and August 2025 meetings

The Orleans Historical Commission will consider several routine items. Commissioners will vote to approve the meeting minutes from the June 11, July 9, and August 13, 2025 sessions. They will also discuss updates on signage, the CPC projects budget, open Form Bs, and the town’s marketing and branding initiative. New business includes reviewing the regular meeting time and setting the next meeting for October 8, 2025.

historical-commissionminutessignagebudgetmarketingmeetings
✓ Decided: Commission approves multiple RFPs and shifts meeting time to 3 pm

The Orleans Historical Commission approved the minutes from June, July and August 2025 (3‑0‑0). It voted to issue a request for proposals for archaeological services (3‑0‑0) and for updating about 28 Form Bs at an estimated $40,000 (3‑0‑0). The commission also moved its regular meeting time to 3:00 pm, pending room availability (3‑0‑0).

Wed Sep 10, 2025

Select Board

Board to discuss next steps for Eldredge Park renovation funding

The Select Board will interview candidates for several town committees and consider resignations. It will review updates to the Rental Registration Program and discuss possible next steps for the town's CPC application to fund the FY26 Eldredge Park Renovation project. The board will also update a warrant article for the Fall Special Town Meeting, vote on amendments to Select Board Policies, and approve recent meeting minutes.

parksbudgetcommitteespoliciesappointments
Wed Sep 10, 2025

Select Board

Select Board to discuss non-union personnel strategy and Finance Director contract

The board will hold an executive‑session strategy meeting on upcoming negotiations with non‑union personnel. It will then vote on whether to consider the Finance Director’s contract. Finally, the board will review Select Board Policies Sections C and D.

personnelcontractspolicy-reviewselect-boardgovernance
Wed Sep 10, 2025

Transportation and Bikeways Advisory Committee

Committee will decide on prioritizing the Old Colony sidewalk project

The Orleans Transportation and Bikeways Advisory Committee will discuss safety improvements on Barley Neck Road, Nauset Heights Road, and the bike crossing at West Road and Salty Ridge Road. They will review a draft crosswalk policy and consider a field survey warrant for Main Street. A key decision will be whether to continue pursuing the Old Colony sidewalk project as a priority.

transportationbikewayssafetysidewalkscrosswalksplanning
✓ Decided: Committee postpones $350K Old Colony engineering to FY‑29 and $3M construction to FY‑31

The committee approved Stephanie Gaskill as clerk by unanimous vote. It voted unanimously to defer the $350,000 FY‑26 engineering and design budget for the Old Colony project to FY‑29 and to shift the $3 million construction budget to FY‑31. A warrant article to fund a Main Street field survey was also approved unanimously. Minutes of the August 13 community meeting and the adjournment motion were each approved unanimously.

Tue Sep 9, 2025

Economic Development Committee

Discussion of wastewater management advisory committee's sewer project correspondence

The Orleans Economic Development Committee will review the minutes from its June 10, 2025 meeting. It will receive a staff update from Economic Development Coordinator Amanda Converse and a zoning update from the Planning Department. The committee will discuss correspondence from the Wastewater Management Advisory Committee regarding a sewer project. The meeting also includes public comment, membership updates, and scheduling of the next meeting.

economic-developmentsewerzoningpublic-commentstaff-update
✓ Decided: EDC approved June 10 minutes unanimously and adjourned the meeting

The Economic Development Committee approved the minutes from the June 10, 2025 meeting by a 4‑0 vote. The meeting was then adjourned at 10:22 a.m. after a motion by David Currier. No other actions were decided.

Tue Sep 9, 2025

Board of Assessors

Board of Assessors will discuss MV Abatements report and sales data

The Orleans Board of Assessors will review and approve the meeting minutes. It will consider the Monthly Sales Report and the MV Abatements Report. The board will then enter an executive session to discuss abatements, exemptions, and Chapter 61 applications under confidentiality requirements.

assessorsabatementssalesbudgetexecutive-session
✓ Decided: Board unanimously approved 21 motor vehicle tax abatements totaling $1,993.55

The Board of Assessors unanimously approved 21 motor vehicle excise tax abatements that total $1,993.55. The assessors also approved the minutes from the August 12 open session. The meeting was called to order at 4:05 p.m. and adjourned at 4:15 p.m.

Tue Sep 9, 2025

Conservation Commission

Conservation Commission holds on-site meeting in Orleans

The Orleans Conservation Commission will hold an on-site meeting at Town Hall to discuss a Notice of Intent for a property at 21 Little Bay Rd. The proposal involves replacing an existing pool and hardscape with new features, installing a vegetated buffer along a Coastal Bank, and managing invasive plants.

conservationenvironmentcoastal-bankinvasive-plantsnotice-of-intent
Tue Sep 9, 2025

Shellfish & Waterways Improvement Advisory Committee

Committee will discuss the Pleasant Bay eel grass study

The Shellfish & Waterways Improvement Advisory Committee will review the August 2025 minutes, hear a presentation on the Pleasant Bay eel grass study from Holly K. Plaisted, receive a report from Natural Resources Manager, Harbormaster, and Shellfish Constable Nate Sears, and open the floor for public comments and announcements. No formal decisions are indicated on the agenda.

environmentwaterwaysshellfishpublic-comment
✓ Decided: Committee unanimously adjourned after accepting minutes

The Shellfish & Waterways Improvement Advisory Committee accepted the prior meeting's minutes. After reports on eelgrass, shellfish closures, and ongoing projects, the members voted unanimously to adjourn the meeting.

Tue Sep 9, 2025

Cultural Council

Council will discuss grant opportunities for the town

The Orleans Cultural Council will open with a call to order and review the previous meeting minutes. Members will discuss grants and brainstorm ideas for 2026. The meeting will conclude with an adjournment. Items listed are anticipated topics and may be adjusted as permitted by law.

culturalgrantsplanningcommunitymeeting
✓ Decided: Council approved the May meeting minutes

The Cultural Council approved the minutes from the May meeting. The council received notice that it will receive $5,700 from the Mass Cultural Council for the next grant cycle. Action items were assigned: Ellen Snyder‑Grenier will write and submit an article about grant applications and contact teachers about blackout dates; Heather Morin will update the members list and website with term limits; Brian Smith will email agenda copies to members before meetings; each member will review project ideas and report back at the October meeting.

Thu Sep 4, 2025

Community Preservation Committee

✓ Decided: CPC defers Eldredge Park renovation decision to Oct 2 meeting

The committee unanimously approved the August 7, 2025 minutes and then adjourned the meeting. A motion to bond $2.5 million for the Eldredge Park Renovation was withdrawn. The committee decided to continue discussion of the renovation at the October 2, 2025 meeting.

Wed Sep 3, 2025

Zoning Board of Appeals

✓ Decided: Board approves minutes, amends decision language, and sets continuation date

The Zoning Board of Appeals unanimously approved the August 20, 2025 meeting minutes. It also unanimously amended the language of the decision for Case #2025-08/14 Hayward Lane. Finally, the board unanimously approved a continuation of the Little Marsh Lane special permit case to September 17, 2025.

Tue Sep 2, 2025

Snow Library Board of Trustees

Snow Library Board to vote on temporary affordable housing model

The Snow Library Board of Trustees will meet to discuss physical plant priorities and parking restrictions at 56 Main Street. The board is scheduled to vote on a temporary affordable housing model on library property to advertise a Lifelong Learning (LTL) course.

libraryaffordable-housingparkingpublic-facilities
✓ Decided: Board approves prior meeting minutes and elects new Friends officers

The trustees approved the July 1 2025 meeting minutes unanimously. They elected Gerry Grenier as vice‑president of the Friends of Snow Library and Linda Reed as member‑at‑large, each by board vote. The board then moved to adjourn the meeting, which passed unanimously. No other motions were decided.

Tue Sep 2, 2025

Conservation Commission

✓ Decided: Conservation Commission unanimously approved multiple coastal and property projects

The Orleans Conservation Commission approved a positive determination for 158 Tonset Rd, a revised plan for 48 Horseshoe Ln with a hand‑installation condition for a sauna, certificates of compliance for 21 Tanglewood Terrace and 16 Hayward Ln, and the project at 1 Ruggles Rd. All motions passed with a 7‑0‑0 vote.

Thu Aug 28, 2025

Finance Committee

Orleans Finance Committee to discuss liaison assignments and fiscal management

The Finance Committee will meet to appoint liaison assignments and discuss Select Board goals regarding fiscal management. The meeting also includes updates from liaisons and the establishment of a September meeting schedule.

financebudgetgovernment-administration
✓ Decided: Finance Committee unanimously approved the August 7 meeting minutes

The Orleans Finance Committee approved the minutes from the August 7, 2025 meeting by a 7‑0 vote. The committee discussed liaison assignments for various town departments and committees. It set three upcoming meeting dates in September, confirming a preferred start time of 5:30 pm. The meeting was adjourned with a unanimous 7‑0 vote.

Thu Aug 28, 2025

Architectural Review Committee

✓ Decided: Committee continued review of 29 Main St window project to Sep 11

The Architectural Review Committee unanimously approved the minutes from the August 14 meeting. The committee also unanimously voted to adjourn the August 28 meeting. Members asked the applicant to submit revised drawings to address window asymmetry and directed that the matter be continued to the September 11, 2025 meeting.

Wed Aug 27, 2025

Conservation Commission

✓ Decided: Commission closed public hearing, allowing written comments until Sep 9 2025

The Conservation Commission voted 7‑0‑0 to close the public hearing on the Kent’s Point Land Management Plan, but will accept written public comments through September 9, 2025. A second unanimous vote 7‑0‑0 adjourned the meeting. No substantive action on the proposed sticker‑parking requirement was taken at this meeting.

Tue Aug 26, 2025

Cultural District Committee

Cultural District Committee to discuss FY 26 budget and upcoming events

The Cultural District Committee will review the FY 26 budget and coordinate several community projects. The body is discussing logistics for events including Arts Week and the Orleans Block Party. Members will also seek to set a date to update the strategic plan.

artsculturebudgetcommunity-eventsstrategic-planning
✓ Decided: Committee unanimously approves FY26 budget and Pop‑Up Practices expenses

The Cultural District Committee unanimously approved the July 22, 2025 minutes, the FY26 budget allocating about $6,670 for Solstice and Arts Week, and the projected expenses of $5,246.64 for the Pop‑Up Practices series. The Orleans Block Party was noted as cancelled, and new banners will be installed for the Solstice event. The meeting adjourned unanimously and set the next meeting for September 23, 2025.

Tue Aug 26, 2025

Veterans Committee

Veterans Committee to discuss war memorials and markers

The Veterans Committee will review designs for a Vietnam memorial and an Indigenous marker. The body will also discuss the approval of a podium reflecting the War of 1812 and provide updates on construction and brick sales.

veterans-affairsmemorialspublic-arttown-maintenance
Mon Aug 25, 2025

Marine & Fresh Water Quality Committee

✓ Decided: Committee approved July 29 minutes with unanimous vote

The Marine & Fresh Water Quality Committee approved the July 29, 2025 meeting minutes with a 6‑0‑1 vote (Carol abstained). The committee confirmed the reappointments of Carolyn Auty as Vice Chair, Rich Levy as Chair through CY 2025, and Bob Mullin as Clerk through CY 2025, leaving one seat vacant. Members discussed volunteer recruitment, pond and estuary monitoring updates, and plans for an alum treatment at Baker Pond pending town approval. The committee also noted actions to improve web‑page postings of open positions and water‑quality data.

Thu Aug 21, 2025

Board of Health

✓ Decided: Board grants one‑year continuance for 167A Route 6A sewer connection

The Orleans Board of Health continued show‑cause hearings for several Phase 1 sewer properties, voting to postpone each case to the October 2 or September 18 meetings. It approved a one‑year continuance for 167A Route 6A to explore easement and alternative‑system options. The board also approved waivers for Title 5 inspections at 21 Little Bay Road and 22 Pilgrim Lake Terrace. All votes were unanimous voice votes (5‑0‑0).

Thu Aug 21, 2025

Energy & Climate Action Committee

✓ Decided: Energy & Climate Action Committee adjourned meeting with no substantive actions

The committee met on August 21, 2025, reviewed contributions to the Energy Navigator program, and then moved to adjourn. A motion to adjourn was made by John Londa, seconded by Roger McDaniel, and approved. No other decisions were taken.

Wed Aug 20, 2025

Zoning Board of Appeals

✓ Decided: Board approves special permit for Happy Clam LLC with tree‑planting condition

The Zoning Board of Appeals approved the minutes from the August 6 meeting (5‑0). It approved a special permit for Happy Clam LLC at 14 Hayward Lane, requiring the planting of 6‑foot mature trees along the driveway before a Certificate of Occupancy (vote 4‑1). The board also approved a special permit for Jason and Amy Beard’s project at 62 Countryside Drive (5‑0). Finally, Matt Cole was appointed as the board’s representative to the Zoning Bylaw Task Force (5‑0).

Wed Aug 20, 2025

Open Space Committee

✓ Decided: Open Space Committee appoints new chair and officers

The committee voted to appoint Lynn O'Connell as Chair, David Herrick as Vice Chair, Christopher Keating as Clerk, and Hardie Truesdale as liaison to the CPC. The minutes from the June 25, 2025 meeting were approved. The meeting was then adjourned.

Wed Aug 20, 2025

Board of Water & Sewer Commissioners

Board holds public hearing on Phase 3 utility easements

The Board of Water & Sewer Commissioners will hold a public hearing regarding proposed easements for the Phase 3 Lakes and Ponds Area Sanitary Sewer and Pump Station Project. The board will also review water and sewer department reports and discuss a flow request for Nauset Farms.

sewerwaterutility-easementsinfrastructurepublic-hearing
✓ Decided: Board commits $901,510.37 for July water and sewer receivables

The Board recommended that the Select Board execute utility easement orders and a pump station easement. It directed staff to reconcile the commission charter and affirmed prior votes. The Board approved financial commitments totaling $964,689.37 for July water and sewer receivables and approved several minutes and abatement actions. The meeting adjourned at 2:16 p.m.

Tue Aug 19, 2025

Snow Library Board of Trustees

✓ Decided: Committee approved November exhibition of artist Julie Brooks

The Marion Craine Gallery Committee approved two artist exhibitions—Julie Brooks for November and Derrick Roese for October—by unanimous vote. The board also approved the minutes from the July 15, 2025 meeting, a June 2026 exhibition by the Outercape Pride group, and a memorial plaque for founder Bobi Eldridge. All motions passed with all members in favor.

Tue Aug 19, 2025

Conservation Commission

✓ Decided: Commission approves west‑side barn location at Putnam Farm (4‑3 vote)

The Orleans Conservation Commission voted 4‑3 to approve alternative 2, the west‑side barn site closest to the wetland at Putnam Farm. The commission also approved a negative determination for the Putnam Farm project, approved the garage/ADU and farm shed at 128 Monument Rd with conditions, and approved the pool and shed project at 317 S Orleans Rd with a contractor‑change condition. All public hearings were formally closed by unanimous motions.

Mon Aug 18, 2025

Affordable Housing Trust Fund Board

Affordable Housing Trust Board to review project updates and rental housing

The Affordable Housing Trust Board will discuss updates on several housing projects and the development of four rental units at 22 Old Tote Road. The board will also review funding availability criteria and the current trust balance.

affordable-housingrental-housingcommunity-developmenthousing-trust
✓ Decided: Board approved July 15 minutes and adjourned the meeting

The Affordable Housing Trust Fund Board approved the minutes from the July 15, 2025 meeting with a 5‑0 vote. The board then adjourned the August 18 meeting at 4:02 pm, also by a 5‑0 vote. No other motions were adopted.

Thu Aug 14, 2025

Energy & Climate Action Committee

✓ Decided: Andy O’Neill appointed ECAC representative for solar bid evaluation

The committee voted to appoint Andy O’Neill as the ECAC member for participation on the solar bid evaluation, with the motion carried after a vote in favor and O’Neill abstaining. The minutes of the July 10, 2025 meeting were approved, with one abstention. The meeting was then unanimously adjourned. No other substantive actions were decided.

Thu Aug 14, 2025

Architectural Review Committee

✓ Decided: ARC approves multiple renovation projects for Academy and 41 Main Street

The ARC retroactively approved the prior restoration (siding, roof, fire escape, windows) at the Academy of Performing Arts, passing 3-1-0. The committee also approved the Academy’s roof shingle repair, vinyl siding replacement, and chimney removal, with a unanimous 4-0-0 vote. New windows and doors for 41 Main Street were approved unanimously (4-0-0). The July 24, 2025 minutes were approved (3-0-1) and the meeting was adjourned unanimously (4-0-0).

Wed Aug 13, 2025

Historical Commission

✓ Decided: Commission elects new Chair and Vice Chair, approves website funding

The Orleans Historical Commission elected Ed Marcarelli as Chair and Bill Wibel as Vice Chair, each vote passing 3‑aye, 0‑no, 1‑abstain. The commission also agreed to retain its external website and fund the associated bill using the CPC grant. The meeting was adjourned by a 5‑0‑0 vote.

Wed Aug 13, 2025

Select Board

Select Board to review board policies

The Select Board will hold a workshop meeting to review and discuss specific sections of the Select Board Policies. The agenda focuses on Section B and potentially Section C.

governancepolicyadministration
Wed Aug 13, 2025

Transportation and Bikeways Advisory Committee

✓ Decided: Committee approves July 9 minutes and adjourns meeting

The Transportation and Bikeways Advisory Committee approved the July 9 meeting minutes, with a unanimous vote and abstentions from three members. A motion to adjourn the August 13 meeting was also unanimously approved. No other formal decisions or votes were recorded; the committee discussed several future actions and agenda items.

Tue Aug 12, 2025

Board of Assessors

✓ Decided: Board approved FY2026 Environmental Protection Fund Tax assessment of $182,938

The Board unanimously approved 19 motor‑vehicle tax abatements for 2025 totaling $2,101.68 and 3 abatements for 2024 totaling $732.66. It also unanimously signed off on FY2026 assessments for the Environmental Protection Fund Tax ($182,938) and the Barnstable County Tax ($170,629). Additionally, the Board approved the 2025 Motor Vehicle Commitment #4 covering 323 bills for $71,063.23 and approved the minutes from the July 8 sessions.

Tue Aug 12, 2025

Shellfish & Waterways Improvement Advisory Committee

Shellfish & Waterways Committee to discuss commercial striped bass fishery

The Shellfish and Waterways Improvement Advisory Committee will meet to elect officers and review previous minutes. The committee will also receive a report from Nate Sears and discuss updates regarding the commercial striped bass fishery.

shellfishwaterwayscommercial-fishingstriped-bass
✓ Decided: Committee elected new officers and unanimously adjourned the meeting

The Shellfish & Waterways Improvement Advisory Committee elected Kyle Von Iderstein as Recording Secretary, Bob as Vice President, and Craig Poosikian as Chair. All three accepted their positions. The board then voted unanimously to adjourn the meeting. No other formal actions were decided at this session.

Thu Aug 7, 2025

Community Preservation Committee

✓ Decided: Committee elected new chair, vice chair and clerk unanimously

The Community Preservation Committee elected Ms. Francolini as Chair, Ms. Gaskill as Vice Chair, and Mr. Lipman as Clerk, each receiving an 8-0-0 vote. The committee also approved a $4,350 payment of dues to the Community Preservation Coalition with an 8-0-0 vote. Minutes from the June 5, 2025 meeting were approved, and the meeting was adjourned unanimously.

Thu Aug 7, 2025

Finance Committee

✓ Decided: Finance Committee appoints new chair, vice chair and clerk, and approves minutes

The committee approved the amended minutes from July 10, 2025 by an 8‑0 vote. It then appointed Elaine Baird as Chair, Nick Athanassiou as Vice Chair, and David Abel as Clerk, each confirmed by unanimous 8‑0 votes. No other substantive actions were taken.

Wed Aug 6, 2025

Zoning Board of Appeals

✓ Decided: Board approves special permit for 12 Deacons Way addition

The Zoning Board of Appeals approved the July 30, 2025 meeting minutes. It voted to continue Case #2025-09 to the August 20, 2025 meeting. It also approved a Special Permit for a 624‑sq‑ft addition at 12 Deacons Way. All three actions passed unanimously with a 5‑0 vote.

Wed Aug 6, 2025

Board of Water & Sewer Commissioners

✓ Decided: Board approved sending Phase 3 easement proposal to public hearing

The Board voted unanimously to forward the proposed Phase 3 easements for the Lakes and Ponds Area Sewer Collection System to a public hearing on August 20, 2025. The motion passed 6‑0‑0. The meeting was then adjourned by a unanimous vote. Board membership updates were noted, with Tim Counihan becoming a full member and Lynn Bruneau an associate member.

Tue Aug 5, 2025

Conservation Commission

✓ Decided: Conservation Commission approved four projects and a compliance certificate

The commission unanimously approved the projects at 124 Hopkins Lane and 30 Hayward Lane, each with specific conditions, and issued a Certificate of Compliance for 8 Kescayogansett Road with a hand‑pulling invasive‑control condition. It also approved negative determinations for the projects at 118 Freeman Lane and 0 Herring Brook Way. All motions passed with a 7‑0‑0 vote.

Wed Jul 30, 2025

Recreation Advisory Committee

✓ Decided: Recreation Advisory Committee adjourned meeting unanimously

The committee discussed design elements, costs, and community benefits for the Eldredge Park project but made no formal approvals or policy changes. The only formal action was a motion to adjourn, which passed unanimously (7-0-0). No other decisions were recorded.

Wed Jul 30, 2025

Zoning Board of Appeals

✓ Decided: Board elected new chair, vice chair and secretary for next year

The Zoning Board approved the July 2 and July 16 meeting minutes (5‑0). It accepted the withdrawal of the Biggers special permit application without prejudice (4‑0) and postponed the Happy Clam case to August 20, 2025 (5‑0). The Board also elected Gerald Mulligan as chair, Austin Higgins as vice chair, and a secretary as clerk for the next calendar year (each 4‑0). No zoning bylaw changes were decided.

Tue Jul 29, 2025

Marine & Fresh Water Quality Committee

✓ Decided: Committee elected new Vice Chair and confirmed leadership through 2025

The committee voted unanimously to nominate Carolyn Auty as Vice Chair. They also voted unanimously to keep Richard Levy as Chair and Bob as Clerk through calendar year 2025. The June 23, 2025 meeting minutes were approved by a 5‑0‑1 vote, with Ed Hafner abstaining.

Thu Jul 24, 2025

Architectural Review Committee

✓ Decided: ARC approves skylight replacement at 6 Route 6A and keeps policy unchanged

The committee approved Gibson Realty's application to replace skylights and reroof 6 Route 6A. A motion to leave the ARC application policy unchanged was also carried. The minutes from July 10, 2025 were approved, and the committee agreed that a building permit should not be issued without ARC review. The meeting was then adjourned.

Wed Jul 23, 2025

Council on Aging

✓ Decided: COA Board voted to move meetings to Town Hall for public remote participation

The board elected Denise Dunlap as Chair and Mark Kaminsky as Vice Chair by a unanimous 4‑0‑0 vote. A motion to approve the June 25 minutes failed after a quorum question was raised. The board approved moving future meetings to Town Hall to allow remote public participation, also by a 4‑0‑0 vote. The meeting was adjourned with a 4‑0‑0 vote.

Tue Jul 22, 2025

Cultural District Committee

✓ Decided: Committee unanimously approved June minutes and adjourned

The Cultural District Committee accepted the June 2025 minutes with a unanimous vote. The meeting was then adjourned by unanimous approval. No other motions were recorded as decided during this session.

Thu Jul 17, 2025

Board of Health

✓ Decided: Board extended sewer hearings, approved food permits and several septic variances

The Orleans Board of Health granted an indefinite stay on the sewer hookup requirement for 15 Cottage Street and extended show‑cause hearings for multiple properties to August 21 or September 18, 2025. It approved the Sharkcuterie food‑services establishment retroactively and authorized temporary food permits for First Friday events with an allergen‑warning condition. The board also approved a septic‑system upgrade at 7 Little Cove Road and a setback variance for the septic system at 1 Namskaket Road.

Wed Jul 16, 2025

Zoning Board of Appeals

✓ Decided: Zoning Board approved Orleans Plaza special permit and other motions

The board unanimously approved a special permit amendment for Orleans Plaza, LLC to construct 29 apartments and 12,000 sq ft of commercial space, contingent on meeting all Site Plan Review requirements. The board also approved the withdrawal without prejudice of a liquor‑license variance petition filed by Michelle Lamy. Additionally, the board approved a special hearing scheduled for July 30, 2025.

Wed Jul 16, 2025

Board of Water & Sewer Commissioners

✓ Decided: Virginia Farber elected Chair and Robert Rich elected Vice Chair

The Board unanimously approved Virginia Farber as Chair and Robert Rich as Vice Chair. It also approved the June 25, 2025 meeting minutes, and committed June sewer receivables of $83,667.10 and water receivables of $8,947.00. The meeting was adjourned by a unanimous vote.

Tue Jul 15, 2025

Affordable Housing Trust Fund Board

✓ Decided: Board approved June 17 minutes and adjourned the meeting

The Affordable Housing Trust Board voted to approve the minutes from the June 17, 2025 meeting with a 5‑0‑2 vote. The board then adjourned the July 15 meeting unanimously (7‑0‑0). No other substantive actions were decided.

Tue Jul 15, 2025

Snow Library Board of Trustees

✓ Decided: Board approved December exhibit, new label process, and eliminated form

The board approved the minutes from the June 17 meeting. It approved artist Doug Fraser’s exhibit scheduled for December 2. It adopted a new removable label process for art displays. It voted to eliminate the exhibit confirmation form. All motions passed unanimously.

Tue Jul 15, 2025

Conservation Commission

✓ Decided: Commission voted to continue the public hearing to Aug 5, 2025

The Conservation Commission approved a motion to continue the public hearing to August 5, 2025, with a unanimous 6‑0‑0 vote. Later the same day, a motion to adjourn the public hearing also passed unanimously (6‑0‑0). The meeting was adjourned at 9:43 a.m.

Thu Jul 10, 2025

Finance Committee

✓ Decided: Finance Committee approved two year‑end transfers totaling $4,350.61

The Orleans Finance Committee unanimously approved the minutes from the June 26 meeting. It also approved two year‑end transfers: $3,988.02 for Veterans’ Benefits and $362.59 for the Zoning Board of Appeals, each passing with a 7‑0‑0 vote.

Thu Jul 10, 2025

Energy & Climate Action Committee

✓ Decided: ECAC unanimously recommended a warrant article to adopt the Specialized Energy Code

The committee voted unanimously to submit an amended letter to the Select Board recommending a warrant article for adopting the Specialized Energy Code, with an effective date of July 1, 2026. The minutes from the June 10, 2025 meeting were also approved unanimously. The committee appointed David Jacobson as Orleans’ representative to the Cape Light Compact and as liaison to the New Fire Station Advisory Committee. The meeting was adjourned unanimously.

Thu Jul 10, 2025

Architectural Review Committee

✓ Decided: ARC approves access ramp for 31 Main Street

The Architectural Review Committee approved the application for an access ramp at 31 Main Street, urging the applicant to consider an alternative door that matches the historic façade. The motion passed unanimously with a 5-0-0 vote. The committee also approved the minutes from the June 26, 2025 meeting and adjourned the session.

Wed Jul 9, 2025

Historical Commission

✓ Decided: Commission elected Francis Mustaro as Acting Chair

The Orleans Historical Commission met on July 9, 2025. Members elected Francis Mustaro as Acting Chair by a unanimous 5‑0 vote. The meeting was adjourned at 5:10 p.m. by a 3‑0 vote. No other substantive actions were taken.

Wed Jul 9, 2025

Transportation and Bikeways Advisory Committee

✓ Decided: Peter Ryder appointed chair of Transportation and Bikeways Committee

The committee approved the June 11 minutes unanimously. It deferred the crosswalk policy to the August meeting. Leadership was reorganized: Peter Ryder will become chair beginning in September and Scott MacDonald will chair the August meeting. The meeting was then adjourned unanimously.

Tue Jul 8, 2025

Board of Assessors

✓ Decided: Board approved 21 motor vehicle tax abatements totaling $3,555.35

The Board unanimously approved 21 motor vehicle excise tax abatements totaling $3,555.35. It also unanimously approved the minutes from the June 10, 2025 meeting. A motion to enter executive session to discuss exemption and abatement applications was made, seconded, and approved unanimously (3‑0).

Tue Jul 8, 2025

Shellfish & Waterways Improvement Advisory Committee

✓ Decided: Committee unanimously adjourned and set next steps for bulkhead bid

The committee made and seconded a motion to change “hell” to “he’ll” in the June minutes, though no vote result was recorded. Nate Sears agreed to consult counsel about possible violations of family permit area regulations. The group planned to issue a bid for the Goose Hummock Bulkhead within a week. The meeting was adjourned by a unanimous vote.

Wed Jul 2, 2025

Zoning Board of Appeals

✓ Decided: Board granted a continuation for the 62 Countryside Drive special permit request

The Zoning Board of Appeals approved the minutes from the April, May, and June 2025 meetings by a 5‑0 vote. It granted a continuation for the Happy Clam LLC special permit at 14 Hayward Lane to July 16, 2025 by a 3‑0 vote. It also granted a continuation for the Beard family special permit at 62 Countryside Drive to August 6, 2025 by a 4‑0 vote.

Tue Jul 1, 2025

Snow Library Board of Trustees

✓ Decided: Board awarded carpet replacement contract to Capital Carpet and Flooring Specialists

The trustees approved the June 4 minutes (4‑0) and awarded a contract to Capital Carpet and Flooring Specialists, Inc. to replace carpet in several library areas within 90 days of June 30, 2025. New policies and forms were posted on the library website, and the four desktop computers in the Children’s area were removed while a Chromebook replacement is pending.

Tue Jul 1, 2025

Conservation Commission

✓ Decided: Commission directs working group to amend Kents Point LMP for sticker parking

The Conservation Commission voted unanimously to direct the working group to change the Kents Point Local Master Plan to implement sticker parking. The commission also approved the meeting minutes and elected Drusy Henson as commission chair, both by unanimous vote. Nominations for the chair position were opened during the meeting.

Thu Jun 26, 2025

Finance Committee

✓ Decided: Finance Committee approved $17,605 police reserve fund transfer

The committee unanimously approved the minutes from the May 22 meeting. It then approved a $17,605 reserve‑fund transfer for a new police biometric and license‑plate reader, and also approved the year‑end transfer requests listed in the June 25 letter. The meeting was adjourned after an 8‑0‑0 vote.

Thu Jun 26, 2025

Human Services Advisory Committee

✓ Decided: HSAC approved $2,000 BB&BS grant and FY 2027 application form

The committee unanimously approved the June 12, 2025 minutes, the $2,000 grant to Big Brothers and Big Sisters, and the revised FY 2027 grant application form. It also unanimously accepted the schedule to post the application information on September 8 and begin reviews on October 1, with submissions due by October 31. The meeting was adjourned unanimously at 11:55 AM.

Thu Jun 26, 2025

Architectural Review Committee

✓ Decided: ARC approved Grady Consulting sign and kept current leadership

The Architectural Review Committee approved the sign application for Grady Consulting LLC at 56 Main Street with a 4-0 vote. The committee also voted to keep Stephen Salley as Chair and Tom Coleman as Vice Chair, again 4-0. Minutes from the June 12 meeting were approved unanimously.

Wed Jun 25, 2025

Open Space Committee

✓ Decided: Committee approved drafting a letter to the Select Board requesting reconsideration

The Open Space Committee voted to draft a letter to the Select Board asking that the recent decision not to renew two members’ terms be reconsidered, and assigned Stephanie Gaskill to write the letter. The committee also approved the minutes from the May 21, 2025 meeting. A motion to adjourn the meeting was approved.

Wed Jun 25, 2025

Board of Water & Sewer Commissioners

✓ Decided: Board approved amendments to sewer use rules and regulations

The Board entered an executive session and then approved a series of amendments to the sewer use rules and regulations, including date changes and revisions to privilege fee provisions. It also committed $65,995.20 in sewer receivables and $4,758.00 in water receivables for May 2025. All votes were unanimous (7‑0‑0).

Tue Jun 24, 2025

Cultural District Committee

✓ Decided: Committee approved FY 2026 marketing and social‑media contracts

The Cultural District Committee approved the minutes from May 27, 2025 and the Treasurer’s Report unanimously. It authorized $700 for First Fridays music, accepted a Chronicle advertisement, and assigned staff to set up a MailChimp outreach template. The committee also approved FY 2026 contracts with Ally for website and marketing work and with Candace for twice‑weekly social‑media postings. Additional items such as continuing the Fall Pop‑Ups series and a new “found art” contest were discussed but not formally decided.

Mon Jun 23, 2025

Marine & Fresh Water Quality Committee

✓ Decided: Bob reappointed to WMAC; minutes approved; Cedar Pond report tabled

The committee voted 4‑0‑0 to reappoint Bob as the Marine & Fresh Water Quality Committee representative to the Wastewater Management Advisory Committee. The same vote approved the revised May 27, 2025 meeting minutes. The Cedar Pond Management Monitoring Program annual technical report was postponed (tabled) for discussion at the next meeting.

Tue Jun 17, 2025

Affordable Housing Trust Fund Board

✓ Decided: Board approved $50,000 expansion of Rental Assistance Program

The Affordable Housing Trust Board voted unanimously to allocate up to $50,000 to expand the Rental Assistance Program for additional households. It also approved the Request for Proposals for 22 Old Tote Road, appointed Ms. Mathison as Chair and Mr. Jurkowski as Vice Chair, and authorized a $7,000 payment to HAC for annual monitoring. The board approved the May 19 minutes and adjourned the meeting.

Tue Jun 17, 2025

Snow Library Board of Trustees

✓ Decided: Board unanimously approved May minutes and adjourned the meeting

The committee approved the May 2025 meeting minutes with a 4‑0 vote. A motion to adjourn was also passed unanimously (4‑0). The board announced a carpet replacement project in the gallery slated for July to September and noted the departure of a part‑time employee.

Tue Jun 17, 2025

Conservation Commission

✓ Decided: Conservation Commission unanimously approved eight actions, including several project permits

The Orleans Conservation Commission voted unanimously on multiple items. It approved the dock repair at 36 Crystal Lake Drive with a negative determination and a width condition, approved projects at 22 Indian Fort Hill Rd, 19 Whippoorwill Ln, and 12 Deacon’s Wy with special conditions, continued the hearing for the 27 Cheney Rd bulkhead project to July 1, and approved a Certificate of Compliance for 45 Nichols Rd. The commission also approved the meeting minutes and adjourned the hearing.

Thu Jun 12, 2025

Board of Health

✓ Decided: Board allocates $34,424 to opioid recovery coach program

The Orleans Board of Health voted 4‑0‑0 to allocate $34,424 from the opioid settlement to a Recovery Coach program. It also approved a 1.7‑foot variance for the pool fence at 106 Beach Road (3‑0‑0) and a waiver for 27 Long View Drive pending additional details (4‑0‑0). Additional approvals included a nomination to the Wastewater Advisory Committee, seating and setback changes for Cooke’s Seafood, and relief for two mobile food units.

Thu Jun 12, 2025

Human Services Advisory Committee

✓ Decided: Committee appointed new leadership slate unanimously

The Human Services Advisory Committee approved its leadership slate for the next year, naming Susan as Chair, Fran K. as Vice Chair, and Barb as Clerk. The motion was moved by Barb, seconded by Fran M, and passed unanimously. The meeting was then adjourned by a unanimous motion.

Thu Jun 12, 2025

Energy & Climate Action Committee

✓ Decided: Committee unanimously approved co‑sponsorship of the Energy Navigator Coaching Program

The Energy and Climate Action Committee voted unanimously to become a co‑sponsor and co‑brand of the Energy Navigator Coaching Program being developed with Cape Light Compact, the Orleans Climate Action Network, and the Eastham committee. The committee also approved a unanimous recommendation that it be represented on the Fire‑Rescue Building Committee, naming David Jacobson as the representative. Officers for the next fiscal year were elected (John Londa chair, Hakim Janah vice‑chair, Andrew O’Neill clerk) and the minutes from the May 8 meeting were approved. The meeting was adjourned unanimously.

Thu Jun 12, 2025

Architectural Review Committee

✓ Decided: ARC approved new signage for Christie’s Atlantic Brokerage and Cape Cod Charcuterie

The Architectural Review Committee approved sign applications for Christie’s Atlantic Brokerage and Cape Cod Charcuterie, each with unanimous support. The committee also approved the minutes from the May 8 and May 22 meetings, with some members abstaining. A consensus was reached to deny any new signs whose lighting does not meet the lighting bylaw. The meeting was adjourned at 7:20 p.m.

Wed Jun 11, 2025

Historical Commission

✓ Decided: Commission voted 5-0 to allow demolition at 124 Hopkins Lane

The Historical Commission approved the demolition of portions of the building at 124 Hopkins Lane by a 5‑0‑0 vote. Members also nominated Charles Ellis as the CPC Liaison, which passed 4‑0‑1 with Ellis abstaining. The minutes from the May 14 meeting were approved 5‑0‑0, and the commission adjourned at 4:51 p.m. by a unanimous 5‑0 vote.

Wed Jun 11, 2025

Recreation Advisory Committee

✓ Decided: Committee approves minutes and elects new officers

The Recreation Advisory Committee approved the May 2025 meeting minutes. The committee elected Jamie Balliett as chair, Shannon Heth as vice‑chair, and Tracy Murphy as clerk, each with unanimous votes. The meeting was then adjourned.

Wed Jun 11, 2025

Transportation and Bikeways Advisory Committee

✓ Decided: Committee scheduled a public meeting on Main Street for Aug. 18

The committee approved the minutes from its April 9, April 28 and May 14 meetings. It agreed to seek Town Meeting funding again for a Main Street field study and to hold an open community meeting on Main Street on Aug. 18 at 4 p.m. A planning sub‑committee meeting was set for July 17, and members were tasked with contacting the Cape Cod Commission and circulating a Harwich crosswalk policy.

Tue Jun 10, 2025

Economic Development Committee

✓ Decided: Orleans launches Local Impact Grant pilot to support businesses

The committee approved the May 13, 2025 minutes (4‑0‑0) and re‑elected the current officers for FY26 (6‑0‑0). It announced the Orleans Local Impact Grant pilot program, set to launch the week of June 16. The committee also suspended July and August meetings and will draft a letter to the Select Board and Water Sewer Commission about sewer project costs.

Tue Jun 10, 2025

Board of Assessors

✓ Decided: Board approved $125,769.39 motor vehicle tax commitment

The Board approved several tax abatements and a $125,769.39 motor vehicle tax commitment, and approved the prior meeting’s minutes. In executive session, the Board denied a real‑estate abatement application for 24 Old Timers Ln because it was filed late. All votes were unanimous.

Tue Jun 10, 2025

Shellfish & Waterways Improvement Advisory Committee

✓ Decided: Committee approves memorial bench for Pilgrim Lake and appoints new assistant constable

The Shellfish & Waterways Improvement Advisory Committee approved a memorial bench to be installed at Pilgrim Lake, with the motion passing unanimously. Nick Sanders was named the new assistant shellfish constable, succeeding Stephanie Sykes. The meeting was then adjourned unanimously.

Mon Jun 9, 2025

Orleans School Committee

✓ Decided: Committee elects new Chair and Vice‑Chair

The Orleans School Committee voted unanimously to appoint Sassandra Roche as Chair and Gail Briere as Vice‑Chair. Amanda Lapierre was named Secretary. Additional role assignments were made, including Ginger Marks as Warrant Authorizer and various policy and program responsibilities for each member.

Thu Jun 5, 2025

Community Preservation Committee

✓ Decided: Committee approved March 6 minutes and adjourned the meeting

The Community Preservation Committee voted to approve the minutes from the March 6, 2025 meeting. The motion passed with seven votes in favor and one abstention. The committee then moved to adjourn the meeting at approximately 5:45 p.m., which also passed with the same vote tally.

Wed Jun 4, 2025

Zoning Board of Appeals

✓ Decided: Board approved continuation of Biggers special permit hearing to July 16

The Zoning Board of Appeals unanimously approved the language in the decision for Case #2025-05/Perseverance Coast, LLC. The board also unanimously approved a continuation of the special permit hearing for Rolf and Laurie Biggers (Case #2025-07) to July 16, 2025.

Wed Jun 4, 2025

Snow Library Board of Trustees

✓ Decided: Board pauses membership in Philanthropy Partners for a year

The trustees approved the May 6 minutes unanimously (6-0). They elected Jamie Balliett as chair, Mark Ziomek as vice chair, Bill Powers as treasurer, and Lindsey Goodman as secretary, each with a 6-0 vote. The board voted to pause membership in Philanthropy Partners Cape Cod and the Islands for one year. The meeting was adjourned unanimously (6-0).

Tue Jun 3, 2025

Conservation Commission

✓ Decided: Commission unanimously approved project revisions, certificates, and hearing continuations

The commission voted unanimously to continue the public hearings for the 12 Deacon’s Way and 27 Cheney Road applications to June 17, 2025. It approved revised plans for the 78 Great Oak Road dwelling project and the Lavender Hill septic‑system relocation. Certificates of compliance were issued for projects at 5 Asa’s Landing and 45 Nichols Road. The commission denied a fire‑pit project at 88 Rock Harbor Road and approved a vista‑corridor maintenance at 317 South Orleans Road with a condition prohibiting herbicide use.

Thu May 29, 2025

Human Services Advisory Committee

✓ Decided: Committee unanimously accepted a revised committee charge

The Human Services Advisory Committee approved the May 1, 2025 minutes and unanimously accepted a revised committee charge. The board tabled discussion of using unexpended funds for emergency assistance and agreed to review the grant application process at the next meeting. Members also agreed to elect new officers for FY 26 at a future meeting.

Tue May 27, 2025

Select Board

✓ Decided: Board entered executive session and approved letter to school district

The Select Board voted unanimously to go into executive session to discuss strategy for negotiations with non‑union personnel. After reconvening, the board unanimously approved sending a letter from the Chair and Town Manager to the Nauset Regional School District Committee. The meeting was then adjourned unanimously.

Tue May 27, 2025

Marine & Fresh Water Quality Committee

✓ Decided: Committee approved meeting minutes unanimously (6-0-0)

The Marine & Fresh Water Quality Committee approved the April 28, 2025 meeting minutes with a 6‑0‑0 vote. Discussion of the Auty Fund was tabled for a future meeting. The Wastewater Management Advisory Committee update was deferred. No other formal actions were voted on.

Tue May 27, 2025

Cultural District Committee

✓ Decided: Committee unanimously approved minutes, treasurer’s report, and adjourned

The Cultural District Committee approved the April 29, 2025 meeting minutes with a unanimous vote. The Treasurer’s Report was accepted unanimously. The meeting was then adjourned by unanimous support.

Thu May 22, 2025

Finance Committee

✓ Decided: Finance Committee approves two sets of minutes and sets June meeting dates

The committee unanimously approved the amended minutes from the April 24 and May 12 meetings (7-0-0 on each). It also adopted the schedule for the next Finance Committee meetings, setting dates for June 12 and June 26, 2025 at 5:30 pm. The meeting was then adjourned by a unanimous vote.

Thu May 22, 2025

Architectural Review Committee

✓ Decided: ARC approves new signs for Birchouse Botanicals and Gemini Art Gallery

The Architectural Review Committee unanimously approved the sign applications for Birchouse Botanicals at 48R Main Street and for Gemini Art Gallery at 7 South Orleans Road. Both motions passed with a 3-0-0 vote. The meeting was then adjourned.

Wed May 21, 2025

Select Board

✓ Decided: Select Board elects Kevin Galligan as Chair and approves multiple licenses

The Orleans Select Board entered an executive session to discuss non‑union personnel negotiations, then reconvened and approved a series of seasonal outdoor entertainment, liquor, and vendor licenses. The Board also adopted exemptions to the Native Plantings Policy and elected new officers, including Kevin Galligan as Chair. All motions carried with unanimous or recorded vote counts.

Wed May 21, 2025

Zoning Board of Appeals

✓ Decided: Board approved a special permit to change office use to storage at 260 Cranberry Hwy

The Zoning Board of Appeals approved three actions. It granted a continuation of the Biggers special‑permit hearing to June 4, 2025. It approved the appeal decision for Jennie Hutton Jacoby with a filing condition. It also approved a special permit to convert the office at 260 Cranberry Highway to storage, subject to conditions.

Wed May 21, 2025

Open Space Committee

✓ Decided: Open Space Committee moved next meeting to June 25, 2025

The committee approved the minutes from the April 16, 2025 meeting. It voted to change the date of the next meeting to June 25, 2025 at 9 AM. The meeting was then adjourned.

Wed May 21, 2025

Board of Water & Sewer Commissioners

✓ Decided: Board recommends 5% water rate increase and schedules SURR public hearing

The Board voted unanimously (7-0-0) to recommend a 5% water rate increase to the Select Board. It also voted unanimously (7-0-0) to hold a public hearing on proposed changes to the Sewer Use Rules and Regulations (SURR). Additional unanimous actions included approving April 16 minutes, committing April receivables for water and sewer, abating a small town‑owned property charge, and approving a drain‑layer license for Lynch Development Corp.

Tue May 20, 2025

Snow Library Board of Trustees

✓ Decided: Board approved moving library portion of capital plan to FY 2028

The trustees approved the minutes from the April 2025 meeting unanimously. They passed a motion to amend the Capital Improvement Plan, moving the library’s share into fiscal year 2028. A motion to approve artist Louise Couillard Zipperman for the September gallery exhibit was made and seconded, but the vote result was not recorded. The meeting was adjourned unanimously.

Tue May 20, 2025

Conservation Commission

✓ Decided: Commission approved projects at Great Oak Rd and Priscilla Rd, continued bulkhead hearing

The Commission voted to continue the public hearing on the 27 Cheney Rd bulkhead project to June 3, 2025. It approved the demolition and replacement project at 78 Great Oak Rd with a stone base for a rinse station and a planting protocol. It also approved the deck expansion at 29 Priscilla Rd with conditions, despite one dissenting vote. All related public hearings were formally closed.

Mon May 19, 2025

Affordable Housing Trust Fund Board

✓ Decided: Board approved $1.5 M funding for Phase 1 of Governor Prence redevelopment

The Affordable Housing Trust Board voted unanimously to approve a $1,500,000 request for Phase 1 of the Governor Prence redevelopment at 66‑76 Route 6A. The board also approved the April 15, 2025 meeting minutes. The meeting was then adjourned.

Mon May 19, 2025

Orleans School Committee

✓ Decided: School Committee approves FY2026 transportation contract with Cape Cod Collaborative

The Orleans Elementary School Committee voted to approve exercising the first option term of the Transportation Memorandum of Agreement with the Cape Cod Collaborative for Fiscal Year 2026. All committee members voted in favor. No other formal actions were taken during the meeting.

Thu May 15, 2025

Board of Health

✓ Decided: Board approved a six‑foot septic setback variance for 51 Great Oak Road

The Orleans Board of Health approved a six‑foot variance to the required ten‑foot septic setback at 51 Great Oak Road. It also approved a six‑month deferral for the sewer connection at 7 Brewster Cross Road. Several ongoing show‑cause hearings were continued to later dates, each with a 3‑0‑0 voice vote.

Wed May 14, 2025

Historical Commission

✓ Decided: Commission approved a 12‑month demolition delay for 20 South Orleans Road

The Historical Commission voted unanimously to impose a twelve‑month demolition delay on the property at 20 South Orleans Road. The commission also approved the minutes from the April 9, 2025 meeting with a minor amendment. After those actions, the meeting was adjourned.

Wed May 14, 2025

Transportation and Bikeways Advisory Committee

✓ Decided: Committee assigns crosswalk study, speed table install, and August Main St outreach

The advisory committee tasked Calvin Sutton with providing crosswalk spacing regulations and, with Rich Waldo, presenting Cape Cod Commission data on pedestrian beacons at the next meeting. A speed table at Skaket Beach is being installed this week, and DPW will start town‑wide line striping next week. Several members were assigned to prepare graphics, gather field‑survey data, contact VHB, and plan an August public meeting on Main Street.

Tue May 13, 2025

Economic Development Committee

✓ Decided: Committee approved April 29 minutes unanimously

The Economic Development Committee approved the minutes from the April 29, 2025 meeting with a 6‑0‑0 vote. The committee also voted to adjourn the May 13 meeting unanimously. Discussions included wastewater project relief and technology collaboration, but no further actions were decided.

Tue May 13, 2025

Board of Assessors

✓ Decided: Board approved 42 motor vehicle tax abatements totaling $5,378.98

The Board of Assessors unanimously approved 42 motor vehicle excise tax abatements for 2025 totaling $5,378.98. They also approved additional abatements: 17 motor vehicle abatements for $2,220.79, 2 motor vehicle abatements for $20.95, 1 motor vehicle abatement for $11.81, and one boat excise tax abatement each for $25.00 in 2025 and 2024. The minutes from the April 8, 2025 open and executive sessions were both approved unanimously.

Tue May 13, 2025

Cultural Council

✓ Decided: Brian Smith appointed President of Orleans Cultural Council

The council approved the March meeting minutes. Brian Smith was appointed President, with Heather Morin remaining Treasurer and Ellen Snyder‑Grenier remaining Secretary. Ellen will contact the town to change the meeting time on the website, and each member will bring one actionable project idea to the August meeting. The next meeting is set for August 11, 2025.

Mon May 12, 2025

Finance Committee

✓ Decided: Finance Committee confirmed agenda and set next meeting date

The committee approved the talking points document to be read at the Town Meeting and scheduled the next Finance Committee meeting for May 22, 2025. The meeting was then adjourned by an 8‑0‑0 vote.

Thu May 8, 2025

Energy & Climate Action Committee

✓ Decided: Committee approved past minutes and adjourned the meeting

The Energy & Climate Action Committee approved the March 13 minutes unanimously and approved the revised April 10 minutes by a 5‑0 vote, with one member abstaining. A motion to adjourn was made and approved unanimously. No other substantive actions were taken.

Thu May 8, 2025

Architectural Review Committee

✓ Decided: ARC approved several sign applications, waiving a site plan for one

The committee approved the Bank of America monument sign with downward lighting and approved new signs for Check Point East Recording Studio after waiving the site‑plan requirement. It also approved the Phare sign at 19 West Road with lighting that meets town standards. All motions passed unanimously (4‑0‑0).

Wed May 7, 2025

Select Board

✓ Decided: Select Board approved eminent domain to take 5 Academy Place for Veterans Memorial Park

The board voted 5‑0‑0 to execute an Order of Taking by eminent domain for the 0.25‑acre parcel at 5 Academy Place, designated Veterans Memorial Park. It also instructed the Affordable Housing Trust Board to pursue a purchase of 22 Old Tote Road for up to $500,000, awarded five $1,000 Sarah Brown scholarships, and approved a slip transfer to Mark Shakliks. Additional actions included two new Common Victualler licenses, a shellfish grant transfer, and the appointment of Elizabeth Jenkins to the Barnstable County HOME Consortium.

Wed May 7, 2025

Zoning Board of Appeals

✓ Decided: Board approved conditional pool variance for 14 Harris Road (4-1)

The Zoning Board approved the minutes from the April 16 meeting by a 5-0 vote. It also approved a motion to modify the Building Commissioner’s decision, allowing an in‑ground pool on 14 Harris Road provided the two adjoining lots stay under common ownership, with a 4-1 vote.

Tue May 6, 2025

Snow Library Board of Trustees

✓ Decided: Board approved April 5 minutes and adjourned the meeting (6‑0 votes)

The trustees approved the April 5, 2025 meeting minutes with a unanimous 6‑0 vote. They recognized the departing trustees, Sue Lynch and Pamela Ritchie, with gift cards. The board heard reports on a new partnership with the Orleans Conservation Trust, library staffing, technology upgrades, finances, and upcoming gallery exhibit. The meeting was adjourned by a unanimous 6‑0 vote.

Tue May 6, 2025

Conservation Commission

✓ Decided: Commission unanimously approved 112 Freeman timber stairway project

The commission voted 7-0-0 to continue the deck hearing for 29 Priscilla Rd to May 20, 2025. It then closed and approved the 112 Freeman Lane timber stairway project with a 7-0-0 vote. A continuation was approved for the 19 Whippoorwill Lane hearing to June 17, 2025, also 7-0-0. Finally, the commission approved an amended order of conditions for 77 Keziah’s Lane with a unanimous 7-0-0 vote.

Thu May 1, 2025

Board of Health

✓ Decided: Board approves 47 Daley’s Terrace variance for fourth bedroom with I/A system

The Board continued show‑cause hearings for four Phase 1 sewer properties, setting a July 17, 2025 deadline for each. It accepted the Aqua Fund’s new rule that condominium owners with fewer than 10 units may qualify for sewer grants. The Board also approved variances for 47 Daley’s Terrace (four bedrooms with an I/A nitrogen‑removing system) and for 24 Collins Lane’s pool fence distance.

Thu May 1, 2025

Human Services Advisory Committee

✓ Decided: Committee agreed to support $20,000 Recovery Coach funding

The Human Services Advisory Committee unanimously approved its minutes and agreed to write a letter of support to the Board of Health for a $20,000 Recovery Coach program. It tasked members with drafting a revised committee charge, developing precise language for a new rolling‑admission application process, renaming the regional group, and creating a streamlined application form. The committee also noted the need to recruit a fifth member.

Wed Apr 30, 2025

Select Board

✓ Decided: Board signs labor agreements with police and fire unions

The Select Board voted unanimously to sign Memoranda of Agreement with the Orleans Police Officers Federation and the Permanent Firefighters Association. It also approved two stabilization fund appropriations, adopted a revision to the Multi Member Body policy, and appointed a student officer for the police department. Additional actions included approving seasonal licenses, accepting commission resignations, and elevating a conservation commissioner.

Tue Apr 29, 2025

Economic Development Committee

✓ Decided: Committee approved March 11, 2025 meeting minutes unanimously

The Economic Development Committee approved the minutes from the March 11, 2025 meeting with a 5‑0‑0 vote. No other formal actions were taken; the committee discussed wastewater phases, a village‑center parking proposal, and draft Local Comprehensive Plan goals but recorded no votes on those items. The meeting was adjourned unanimously at 10:56 a.m.

Tue Apr 29, 2025

Cultural District Committee

✓ Decided: Committee approved up to $2,500 for promotional materials and signage

The Cultural District Committee appointed Honah Lee Milne as Vice Chair and accepted the Treasurer’s Report, both unanimously. It approved encumbrances of $2,000 for design and printing of promotional materials, $500 for FLAG signage, and any remaining funds to sponsor the June Pride Weekend or Cape Noir, all with unanimous votes. The committee also approved the March 25, 2025 minutes by majority with one abstention and agreed to pursue a $5,120 AFCC grant for the Fall ’25/Spring ’26 Pop‑Up Music series.

Mon Apr 28, 2025

Marine & Fresh Water Quality Committee

✓ Decided: MFWQC unanimously supports Article 26 for Mill Pond nitrogen evaluation

The Marine & Fresh Water Quality Committee voted 7‑0‑0 to support Article 26, which funds a nitrogen evaluation for Mill Pond. Chair Rich Levy will revise the committee’s draft letter of support and circulate it for review. No other substantive actions were voted on at this meeting.

Mon Apr 28, 2025

Transportation and Bikeways Advisory Committee

✓ Decided: Transportation and Bikeways Advisory Committee held informational meeting, no decisions made

The committee presented a PowerPoint on planned roadway projects to improve pedestrian and bicyclist safety. Attendees asked questions about accident history, funding, and walkability, expressing mixed feelings about safety. The committee said it will collect more data and increase community engagement before any actions are taken. No formal decisions or votes were recorded.

Thu Apr 24, 2025

Finance Committee

✓ Decided: Finance Committee approved $3,660.97 Veterans Benefits reserve fund transfer

The committee voted 8-0-0 to approve a $3,660.97 reserve fund transfer for a Veterans Benefits Assessment. It also approved the amended minutes from 4/10/25 with a 7-0-1 vote. The committee unanimously approved a letter recommending a single statement of concern for the entire Town Meeting warrant.

Thu Apr 24, 2025

Architectural Review Committee

✓ Decided: ARC approved new ladder sign for Pleasant Bay Realty at 57 Route 6A

The committee waived the site‑plan requirement and approved the new ladder sign for Pleasant Bay Realty at 57 Route 6A, with a 5‑0 vote. The review of the monument sign for Phare at 19 West Road was postponed pending site review and building‑department input, also by a 5‑0 vote. The minutes from the April 10, 2025 meeting were approved with a minor wording change, 5‑0. The meeting was then adjourned.

Thu Apr 17, 2025

Board of Health

✓ Decided: Board adopts higher Transfer Station fees and rescinds fine for 86‑88 Route 6A

The Orleans Board of Health voted 5‑0‑0 to adopt proposed increases to the Transfer Station fee schedule, making the new rates effective upon publication (estimated April 27). The board also rescinded a previously issued fine for the properties at 86 & 88 Route 6A and granted them a six‑month extension to complete sewer connection. Several pending sewer‑connection cases were continued to future dates for further review.

Thu Apr 17, 2025

Recreation Advisory Committee

✓ Decided: Committee approved prior minutes and adjourned the meeting

The Recreation Advisory Committee approved the minutes from the December 19, 2023, January 16, 2025, and March 20, 2025 meetings with a 4‑0‑0 vote. The committee then adjourned the April 17, 2025 meeting with a 6‑0‑0 vote. No other actions were decided.

Wed Apr 16, 2025

Zoning Board of Appeals

✓ Decided: Board unanimously approved extensions and permits for two property appeals

The Zoning Board of Appeals approved an extension to May 7, 2025 for Jennie Hutton Jacoby’s appeal concerning an accessory swimming pool. It also approved a special permit and a variance to divide the lot at 43 Kenneth Lane into two parcels. All motions passed with a 5‑0 vote.

Wed Apr 16, 2025

Open Space Committee

✓ Decided: Open Space Committee approves prior meeting minutes

The committee voted to approve the minutes from the March 19, 2025 meeting. All members present voted in favor. The meeting was then adjourned by a unanimous motion.

Wed Apr 16, 2025

Board of Water & Sewer Commissioners

✓ Decided: Board approves grease‑tank variance for The Knack and commits March water and sewer revenues

The Board approved a variance allowing The Knack (Whole Clam LLC) to pump its external grease tank every four months. It also committed $50,644.50 in sewer receivables and $153,021.93 in water receivables for March 2025. A sub‑committee was formed to study a possible rate increase of up to 5% effective July 1. The minutes of the March 19, 2025 meeting were approved.

Tue Apr 15, 2025

Affordable Housing Trust Fund Board

✓ Decided: Board encumbers $550,000 for Old Tote Road acquisition

The Affordable Housing Trust Board accepted a Notice of Funding Availability for the 22 Old Tote Road property (8‑0‑0). It voted to encumber $550,000 to cover the potential acquisition, plans, and sewer connection for that site (8‑0‑0). The board also approved the March 18, 2025 minutes (7‑0‑1) and adjourned the meeting (8‑0‑0).

Tue Apr 15, 2025

Snow Library Board of Trustees

✓ Decided: Board approves Erika Zvilnaite exhibit for August and adopts March minutes

The Snow Library Marion Craine Gallery Committee approved the minutes from the March 18, 2025 meeting. The board also approved Erika Zvilnaite’s exhibition to be held in August. Both motions passed with all members in favor.

Tue Apr 15, 2025

Conservation Commission

✓ Decided: Conservation Commission unanimously approves 19 Childs Homestead Rd project

The commission voted 7‑0‑0 to approve the 19 Childs Homestead Rd project, attaching its findings, standard conditions, and a special condition for a pre‑construction meeting about chain‑link fence removal. It also approved a Certificate of Compliance for the same site (vote recorded as 7). The hearings for three other applications were each continued to May 6 2025 by unanimous vote.

Thu Apr 10, 2025

Finance Committee

✓ Decided: Finance Committee approved FY26 budget and 13 town‑meeting articles

The Orleans Finance Committee unanimously approved the FY26 budget as amended. It recommended and approved a series of Town Meeting warrant articles covering fire‑station design, beaches, sewer and transfer station funds, solar development, bulkhead work, community preservation, wastewater projects, and housing and veterans provisions. The only article rejected was the residential exemption budget request. All votes were recorded as shown.

Thu Apr 10, 2025

Energy & Climate Action Committee

✓ Decided: Committee adjourned after deferring March 13 minutes review

The Energy & Climate Action Committee discussed upcoming solar projects, grant articles, and community initiatives but made no substantive approvals. Review of the March 13, 2025 minutes was deferred to the May 8 meeting. A motion to adjourn was made, seconded, and approved unanimously.

Thu Apr 10, 2025

Architectural Review Committee

✓ Decided: ARC approves two new business signs and March minutes

The Architectural Review Committee approved the signage application for Wildflower Hair at 80‑82 Route 6A with a 5‑0‑0 vote. It also approved the signage application for Flowers by the Bay at 31 Main Street with a 5‑0‑0 vote. The committee approved the minutes of the March 18, 2025 meeting, also by a 5‑0‑0 vote.

Wed Apr 9, 2025

Select Board

✓ Decided: Select Board approves FY26 budget, COLA, beach pact and multiple licenses

The Orleans Select Board accepted the FY26 operating budget of $64,069,780 and a 3% cost‑of‑living adjustment for non‑union staff. It also approved the three‑year Nauset Beach Agreement with Chatham and a lease amendment for the Center for Culture and History. Filing fees for Special One Day Liquor Licenses were eliminated and several liquor and outdoor entertainment licenses were granted. Additional ballot questions, including debt‑exclusion items and a $5 million solar development, were placed on the May 20, 2025 election.

Wed Apr 9, 2025

Transportation and Bikeways Advisory Committee

✓ Decided: Committee adds three new actions to transportation plan, including Route 6A study

The advisory committee approved the February 12, 2025 meeting minutes. It agreed to add “pedestrians and bicyclists” to the vulnerable‑user references in the Comprehensive Plan and to include three new action items: a public‑road layout, a traffic study of the Route 6A corridor, and improvements to the Route 6A, Eldredge Parkway, West Road intersection. The committee also decided to adjust the location of the seasonal speed table on Skaket Beach Road and to install the tables in late May/early June, using new electronic message boards during the adjustment period. A community meeting to review Main Street, Old Colony Way, and Beach Road projects was scheduled for April 28.

Wed Apr 9, 2025

Historical Commission

✓ Decided: Commission voted unanimously to recommend removal of the Main St. flashing sign

The commission unanimously approved a motion finding the flashing road sign at Main Street and Meetinghouse Road visually intrusive and recommending its removal. They also approved the creation of a public‑education subcommittee composed of Commissioner Marcarelli and Associate Member Mustaro. The board approved the minutes from the March 12, 2025 meeting.

Tue Apr 8, 2025

Board of Assessors

✓ Decided: Board approved $196,009.41 in motor vehicle excise commitments

The Board approved a motor vehicle excise commitment of $196,009.41 for 2025‑2. It also approved several abatements and exemptions, including motor vehicle abatements, real estate and personal property abatements, and elderly exemptions. The March 11, 2025 minutes were adopted.

Tue Apr 8, 2025

Shellfish & Waterways Improvement Advisory Committee

✓ Decided: Committee accepted minutes and scheduled a May 15 meeting

The committee unanimously approved the meeting minutes after a wording change. They agreed to look into Thursday, May 15 as the date for the next meeting. The meeting was adjourned by unanimous vote.

Mon Apr 7, 2025

Orleans School Committee

✓ Decided: School Committee approved Policy Manual Sections A‑D for second reading

The committee voted unanimously to approve Policy Manual Sections A through D for a second reading. They also approved the February 3 and February 10, 2025 meeting minutes. The meeting was then adjourned at 5:13 pm.

Mon Apr 7, 2025

Registrar

✓ Decided: Town Clerk authorized to hold in‑person early voting for elections

Beverly Fuller was sworn in for a three‑year term as registrar. The board approved, by unanimous vote, a motion allowing the Town Clerk to conduct in‑person early voting at Town Hall for two weeks (May 5‑16) for the annual town election. The board also approved, unanimously, a motion permitting in‑person early voting for any special election in 2025.

Thu Apr 3, 2025

Board of Health

✓ Decided: Board approves Fox Ridge variance and sets multiple sewer deadlines

The Orleans Board of Health approved a variance for 9 Fox Ridge Drive despite the septic tank size requirement (voice vote 4-0-0). It granted a deferral for 43 Canal Road until the April 17, 2025 meeting and issued fines or conditional deadlines for several properties that have not complied with sewer connection orders. Additional deadlines were set for permit and plan submissions, with fines of $200 for missed dates.

Thu Apr 3, 2025

Finance Committee

✓ Decided: Finance Committee recommended $45 M fire station design article

The committee approved the amended warrant letter for the May Town Meeting by a 7‑0‑0 vote. It also recommended the Consent Calendar for the town meeting with a 7‑0‑0 vote. Finally, the committee recommended Article 12 for fire station design and construction, a $45 million project, with a 6‑0‑1 vote (one abstention).

Thu Apr 3, 2025

Human Services Advisory Committee

✓ Decided: Committee approves $20,000 for Community Services Navigator Program

The Human Services Advisory Committee unanimously approved a $20,000 allocation for the Community Services Navigator Program. A motion to require an individual up‑or‑down vote on each eligible grant application passed with a 3‑to‑2 vote. The committee also approved the meeting minutes as amended.

Wed Apr 2, 2025

Select Board

✓ Decided: Select Board approved all warrant articles for the upcoming Town Meeting

The board placed Articles 1‑11, 14‑18, the capital budget article, Article 20 on solar energy, the bulkhead at Rock Harbor article, and Article 33 on the warrant, and removed Articles 28 and 29. Each motion passed unanimously with a 4‑0‑0 vote. The board also entered executive session to discuss collective‑bargaining strategy, which was approved 4‑0‑0. Capital debt was noted as $8 million, lower than the previously projected $11 million.

Wed Apr 2, 2025

Zoning Board of Appeals

✓ Decided: Board denied the appeal to overturn the zoning enforcement order

The board approved the March 19 meeting minutes after a motion and second. It upheld three ZEO findings on storage, change‑of‑use size, and setback requirements, and it overturned the ZEO finding about parking spaces. The board rejected the applicant’s request to overturn the enforcement order. It also approved a unanimous continuation of the case to May 19, 2025 for site‑plan review.

Tue Apr 1, 2025

Snow Library Board of Trustees

✓ Decided: Board unanimously approves March minutes

The trustees approved the March 5, 2025 meeting minutes with a 4‑0 vote. They then adjourned the April 1 meeting unanimously. No other actions were voted on.

Tue Apr 1, 2025

Conservation Commission

✓ Decided: Commission denied septic system at 4 Driftwood Lane with unanimous vote

The Conservation Commission voted 7‑0‑0 to issue a negative determination for the Title 5 septic system proposed at 4 Driftwood Lane, effectively denying the project. It also denied a deck expansion at 29 Priscilla Rd and directed the applicant to seek a Resource Development Agreement. Approvals were granted for the Kents Point workday at 39 Keziahs Ln and an osprey pole at 654 S. Orleans Rd, and the commission ordered a cease‑and‑desist letter to an abutter encroaching on town conservation land. The public hearing on the 54 Tonset Rd invasive‑species project was continued to April 15, 2025.

Tue Apr 1, 2025

Personnel Advisory Board

✓ Decided: Board approved changes to personnel bylaw and compensation plan

The board reviewed proposed changes to the personnel bylaw and compensation plan, including a reduction in steps over three years and new titles. Members voted their agreement with the proposed changes. The board also unanimously approved the minutes from the November 13, 2024 meeting and unanimously adjourned the session.

Thu Mar 27, 2025

Finance Committee

✓ Decided: Finance Committee approved a $4,195 reserve fund transfer for unemployment benefits

The committee approved the minutes from the March 12 and March 13 meetings by unanimous vote. It then approved a $4,195 reserve fund transfer to cover unemployment benefits for two town employees, also by unanimous vote. The remainder of the meeting consisted of discussion on housing initiatives and upcoming Town Meeting materials, with no further decisions made. The meeting adjourned at 7:20 pm.

Wed Mar 26, 2025

Select Board

✓ Decided: Board adopts new shellfish regulation limiting harvest below 28°F

The Select Board approved several appointments, accepted a committee resignation, and renewed seasonal licenses. It adopted a change to Section 3.8 of the Orleans Shellfish Regulations that prohibits dry harvesting or harvesting in shoal areas when water temperature is under 28 degrees. The Board also approved FY26 beach fee changes and granted an annual indoor entertainment license to Town Cove Tap House.

Tue Mar 25, 2025

Cultural District Committee

✓ Decided: Committee approved February minutes and wording change to Treasurer's report

The Cultural District Committee unanimously approved the February 25, 2025 meeting minutes. It also unanimously approved changing the Treasurer’s report wording from “ENCUMBERED?” to “ALLOCATED.” The meeting was then adjourned by motion. No other substantive actions were decided.

Mon Mar 24, 2025

Select Board

✓ Decided: Select Board adjourned meeting; joint health meeting agreed, no other votes

The Select Board discussed the Orleans Campus Plan and short‑term rental requirements. The board agreed to hold a joint meeting with the Board of Health. Both the Orleans Elementary Committee and the Select Board voted to adjourn their respective meetings.

Mon Mar 24, 2025

Marine & Fresh Water Quality Committee

✓ Decided: Committee tables Orleans Citizen Forum item and assigns comment compilation

The committee temporarily tabled the Orleans Citizen Forum on fresh water quality (Agenda Item 5). Rich Levy will compile the Marine & Fresh Water Quality Committee’s comments on the Comprehensive Plan goals and forward them to Town Planner George Meservey. The FY26 water‑quality funding request was noted at a total of $154,000 after revisions.

Thu Mar 20, 2025

Recreation Advisory Committee

✓ Decided: No substantive decisions made at the Open Space and Recreation Plan hearing

The Recreation Advisory Committee held a public hearing on the Open Space and Recreation Plan on March 20, 2025. A formal presentation was given by Weston and Sampson outlining the plan's background, purpose, and goals. Community survey feedback included 568 respondents, with 33% residing in Orleans for over 20 years and 40% feeling their needs are met. No decisions, approvals, or votes were recorded during this meeting.

Wed Mar 19, 2025

Zoning Board of Appeals

✓ Decided: Board approved language change for 15‑17 High Street case

The Zoning Board of Appeals unanimously approved a language change in the decision for Case 2025‑02 covering 15‑17 High Street. The board also unanimously voted to continue consideration of the Harris Road variance and appeal case to the April 16, 2025 meeting. The minutes from the February 5, 2025 meeting were approved.

Wed Mar 19, 2025

Open Space Committee

✓ Decided: Next Open Space Committee meeting set for April 16, 2025

The committee approved the February 19, 2025 minutes and scheduled its next meeting for April 16, 2025. A motion to adjourn was passed unanimously. No policy or project decisions were made; members discussed the upcoming CROS plan.

Wed Mar 19, 2025

Board of Water & Sewer Commissioners

✓ Decided: Board approves 5% water rate hike and $50 sewer charge for eligible properties

The Board voted unanimously to support a $50 basic sewer service charge for phase 1 and a water rate increase of up to 5% effective July 1 2025. It also conditionally approved extra water flow for 191 Route 6A and approved a $33,793.76 flow abatement for 2 Academy Place, while denying betterment abatement requests for 195 Route 6A and 37 S Orleans Road. Additionally, the Board recommended deferring the sewer connection for 18 Old Colony Way until Dec 31 2025 and adopted a mandatory two‑day‑a‑week watering restriction.