The Boring PartsFederalLocal · USLocal · Canada
Victor, NY

Victor public meetings in 2025

192 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Mon Dec 22, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider High Point Business Park PDD amendment

The Victor Town Board will meet to review a planned development district amendment and an equipment lease agreement. The board will also address a letter of credit for the Norbut Solar Project and fuel contract access for 2026.

zoningsolarcontractsbusiness-parkpublic-safety
✓ Decided: Board approved negative SEQRA declaration for High Point zoning amendment

The Town Board approved payment of $496,616.10 in bills (motion carried). It approved the November 24, 2025 minutes (5-0) and the December 8, 2025 minutes (4-0-1 abstain). The board also approved Resolution No. 285, a negative SEQRA declaration for the proposed amendment to the High Point Business Park Planned Development District (5-0).

🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Motion was made by Councilman Condon, seconded by Councilman Guinan to approve the November 24, 2025 Town Board Meeting Minutes as presented by the Town Clerk. 5
4 yea
(Marren yea · Condon yea · Guinan yea · Cusimano yea
Mon Dec 22, 2025

Town Board After Meeting Reports

Town Board approves zoning amendment for Highpoint Woods at Valentown

The Victor Town Board met to approve several administrative items and zoning changes. The board adopted a local law to amend Chapter 211 Zoning regarding the Woods at Valentown PDD. Other actions included approving an equipment lease and a fuel contract for 2026.

zoningcontractssolarpublic-safetyland-use
Tue Dec 16, 2025

Conservation Board Agendas, Minutes & YouTube Videos

December 16 Conservation Board meeting cancelled

The Conservation Board meeting scheduled for December 16, 2025, has been cancelled. No items were scheduled for decision or discussion.

conservation-boardcancelled-meeting
Tue Dec 16, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks & Rec Committee to discuss playground and park improvements

The Parks and Recreation Citizens’ Advisory Committee will review reports from the Director of Parks and Recreation and the Recreation Center. The body will discuss several park improvement projects and one membership vacancy for a village position.

parksrecreationplaygroundspublic-works
✓ Decided: Committee approves November minutes and DRP Playground Replacement project

The Citizens' Advisory Committee approved the November meeting minutes with no changes. The committee also approved the purchase and design tweaks for the 2026 DRP Playground Replacement project, noting contracts have been issued and one signed. No updates were reported for Brace Road usage or Fischer’s Park improvements.

Thu Dec 11, 2025

Boughton Park Commission Agendas & Minutes

Commission will approve minutes, review finances, and set 2026 goals

The Boughton Park Commission will vote to approve the November 13, 2025 meeting minutes. Commissioners will hear the Treasurer’s report and consider payment of outstanding bills. The board will discuss a year‑in‑review and set goals for 2026. An executive session will follow the public portion of the meeting.

minutesfinanceplanningexecutive-session
Tue Dec 9, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review 156-unit apartment project and new hotel at Eastview Mall

The Planning Board will hold public hearings on several development projects, including multi-family housing and commercial expansions. The board is also reviewing requests for single-family home construction and a change of use for a performing arts center.

zoninghousingcommercial-developmentsubdivisionpublic-hearings
✓ Decided: Planning Board defers several applications and closes public hearing

The board postponed four pending development applications to a future meeting. It then voted to close the public hearing. No other approvals, denials, or actions were taken.

Tue Dec 9, 2025

Planning Board After Meeting Reports

Forte Studios LLC site plan approved to convert building into arts center

The Planning Board reviewed a series of development applications, most of which were postponed to future meetings. Two applications were approved: Forte Studios LLC’s request to change use of a 9,870‑sq‑ft building into a visual and performing arts center, and the Cheshire Ridge subdivision to create two single‑family lots on .74 acres. The board also noted public hearing procedures and provided updates from the Town Board and Planning Board.

zoningdevelopmenthousingcommercialartspublic-hearing
Mon Dec 8, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider new Commercial Center zoning district

The Victor Town Board will hold public hearings on building code amendments and definition updates. The board is deciding on budget amendments for grant revenue and property purchases, as well as a new zoning district for EVM.

zoningbudgetpublic-hearingland-usecontracts
✓ Decided: Board approved ambulance contract up to $305K for 2026 and $325K for 2027

The Victor Town Board adopted Resolution No. 269 authorizing a contract with Victor‑Farmington Volunteer Ambulance Corps for emergency services, costing up to $305,000 in 2026 and $325,000 in 2027. The motion passed unanimously (4 Ayes, 0 Nays). The Board also approved Manifest No.23 bills for $287,850.04 and appropriated a $44,000 state grant, each with a 4‑aye vote.

Mon Dec 8, 2025

Town Board After Meeting Reports

Town Board creates new CC Zoning District and updates building definitions

The Town Board is meeting to approve several budget amendments, service agreements, and zoning changes. Key actions include establishing a new CC Zoning District and updating local law definitions.

zoningbudgetlocal-lawpublic-healthinsurance
Tue Dec 2, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board meeting scheduled for Dec 2, 2025 has been cancelled

The Conservation Board meeting set for December 2, 2025 at Victor Town Hall was cancelled. No agenda items were considered or decided at this meeting. The public may submit written comments to the Planning & Building Office as noted in the notice.

meetingcancellationplanning
Mon Dec 1, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to hear variance and cannabis dispensary requests

The Victor Zoning Board of Appeals will meet to approve minutes and hold public hearings on four items: a variance for a pergola with lighting, a retail cannabis dispensary permit, a side setback variance for a garage, and an area variance for a kennel.

zoningvariancecannabispublic-hearingvictor-ny
✓ Decided: Board approved November minutes; lighting request remained unresolved

The Zoning Board of Appeals approved the minutes from the November 3, 2025 meeting by a 5‑0 vote. The board then heard a request from Phoenix Mills to add lighting to a pergola that was previously varianced without lights. Members discussed code requirements and timing limits, but no vote or final decision on the lighting amendment was recorded.

Mon Dec 1, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board approves garage setback relief for 6839 Valentown Road

The Zoning Board of Appeals reviewed four variance requests. One application was approved, one was withdrawn, and two were tabled until January 20, 2026.

zoningvariancesland-usecannabisresidential
Mon Nov 24, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to vote on speed limit reduction on Gillis Road

The Victor Town Board meeting on November 24, 2025 includes a public hearing and reports from town officials. Action items include a resolution to reduce the speed limit on Gillis Road, renewal of a professional services agreement with ESP Consulting, LLC, and a public hearing to amend the zoning map for an EVM mixed‑use overlay district. Additional items cover agreements for park signage, playground equipment, and an intermunicipal fire marshal sharing agreement with the Town of Farmington. The board will also consider contracts for generator replacement at PS6 and a county dog control contract for 2026.

zoningtransportationparksfinancepublic-safetyplanning
✓ Decided: Town Board adopts resolution to evaluate Gillis Road speed limit (5‑0)

The board entered and later adjourned an executive session (5‑0 each). It closed the public hearings, approved the November 10 minutes, and approved Manifest No. 22 bills totaling $271,137.87 (5‑0). The board also adopted a contract renewal with ESP Consulting for $4,000 per month for six months (5‑0) and adopted a resolution directing a petition to the NYS Department of Transportation to evaluate the speed limit on Gillis Road (5‑0).

Mon Nov 24, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks & Rec Committee to discuss playground replacement and road usage

The Parks and Recreation Citizens’ Advisory Committee is meeting to review the Director's report and the status of the Recreation Center. The body will also discuss the 2026 DRP Playground Replacement project and usage of Brace Road.

parks-and-recreationplaygroundsroadscommunity-facilities
✓ Decided: CAC approved purchase of recreation center and adjacent parcel at Lehigh Crossing

The committee approved the October meeting minutes without changes. It also passed the authorization to purchase the recreation center at 7891 Lehigh Crossing Road and the adjacent parcel at 7901 Lehigh Crossing Road. No other substantive actions were recorded.

Mon Nov 24, 2025

Town Board After Meeting Reports

Town Board will hold a public hearing to amend the zoning map for EVM Mixed‑Use district.

The Victor Town Board meeting includes approvals of November 10th pay bills and several reports from town officials. The board will consider multiple contracts and agreements, including a professional services agreement with ESP Consulting, LLC and a Graybar contract for a generator replacement at PS6. Several resolutions will be voted on, such as a speed limit reduction on Gillis Road and a public hearing to amend the zoning map for the EVM Mixed‑Use Overlay District.

zoningtransportationpublic-safetyparkscontractsfinance
Tue Nov 18, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board meeting cancelled

The Conservation Board meeting scheduled for November 18, 2025, has been cancelled. No items were decided or discussed.

procedural
Thu Nov 13, 2025

Boughton Park Commission Agendas & Minutes

Commission will review roofing quotes for Stirnie Pavilion

The Boughton Park Commission will approve the minutes from the October 9, 2025 meeting and consider the treasurer's report with payment of outstanding bills. Commissioners will discuss park improvement items, including reviewing roofing quotes for the Stirnie Pavilion, adding hardware cloth to bridges, planning gravel for 2026 trail upgrades, updating signage, and a water collection system update and storage.

parksfinancemaintenanceinfrastructurewater-management
✓ Decided: Commission approved payment of $5,800 to Knickerbocker Farms for mowing services

The commission voted to pay Knickerbocker Farms for two years of mowing services and to request a new quote for next year. It also approved $2,500 for trail gravel and $500 for hardware‑cloth slip protection. Additional items such as the treasurer’s report and several project ideas were approved or discussed.

Wed Nov 12, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review Chick-fil-A and Element hotel proposals at Eastview Mall

The Planning Board will hold public hearings on several commercial developments and a residential demolition. The board will also discuss local laws to establish a Commercial Center Zoning District and designate Eastview Mall within that district.

zoningcommercial-developmentpublic-hearingsdemolitionlocal-law
✓ Decided: Planning Board recommends demolition of 7432 Modock Road building

The Board approved the minutes from the August 26 and September 23 meetings. It voted 5‑0 to recommend approval of the demolition permit for 7432 Modock Road. The open public hearing for the Chick‑fil‑A site plan was formally closed.

Wed Nov 12, 2025

Planning Board After Meeting Reports

Planning Board approves Chick-fil‑A restaurant and several other projects

The Victor Planning Board reviewed and acted on multiple applications. It approved a 5,331‑square‑foot Chick‑fil‑A quick‑serve restaurant on Eastview Mall Drive, a Bow Wow Dog Salon on State Route 96, and an art‑gallery conversion at 7404 State Route 96. Several items, including the Cheshire Ridge subdivision and the ELEMENT hotel project, were removed or tabled for future meetings. The board also discussed two local‑law proposals to establish and map the Commercial Center zoning district.

zoningcommercialresidentialdevelopmentlocal-lawplanning
Mon Nov 10, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board meeting to approve minutes and pay bills (Manifest No. 21)

The Victor Town Board will approve the October 27th regular meeting minutes. It will process bill payments listed in Manifest No. 21. The agenda includes a public comment period and an executive session before adjournment.

financegovernancemeetingpublic-commentexecutive-session
✓ Decided: Town Board approved $629,737.99 fire protection bill and $400,166.38 general expenses

The board approved Manifest No.21A, paying $629,737.99 for fire protection services, with a 4‑aye vote and one absent member. It also approved Manifest No.21B, paying $400,166.38 for various town expenses, with the same vote count. The October 27th meeting minutes were approved, the board entered and later closed an executive session, and then adjourned the meeting.

Tue Nov 4, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board meeting cancelled

The scheduled Conservation Board meeting for November 4, 2025 at Victor Town Hall has been cancelled. No agenda items will be considered.

Mon Nov 3, 2025

Historic Advisory Committee Agendas & Minutes

Committee will discuss demolition of 7432 Modock Road

The Historic Advisory Committee will review and potentially approve the demolition of the building at 7432 Modock Road. The committee will also consider a proposed telecommunications facility and updates on cemetery preservation, historic lecture series, and digitizing archival materials. Meeting dates for 2026 are being set, and the agenda includes observations of sites at 1301 East Victor Road and 6756 County Rd 41/Boughton Hill Rd.

historic-preservationdemolitiontelecommunicationsdigitizationmeetings
✓ Decided: Historic Advisory Committee approves 2025 minutes and sets 2026 meeting dates

The committee approved the September 8, 2025 meeting minutes. It adopted the 2026 meeting schedule (May 5, July 6, September 14, November 2). Babette and Wilma were tasked with contracting to digitize historic cassette tapes and microfilm. The genealogy collection will be reviewed and digitized while retaining hard copies.

Mon Nov 3, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board approves variances for Chick-fil-A and residential sheds

The Zoning Board of Appeals reviewed several area variance requests. The board approved requests for residential sheds and signage for a Chick-fil-A location, while one request regarding a pergola was tabled.

zoningvariancessignageland-use
Mon Nov 3, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board reviews multiple area variance requests at November 3 meeting

The Victor Zoning Board of Appeals will first approve the minutes from the October 6, 2025 meeting. It will then hold public hearings on several area variance applications, including requests for sheds at 766 Duck Hollow and 7730 Pine Tree Dr, an amendment for a pergola at 100-410 Phoenix Mills Plaza, and multiple sign variances for Chick‑Fil‑A at 7979 Pittsford Victor Rd.

zoningvariancespublic-hearingstown-of-victorplanning
✓ Decided: Zoning Board approves area variance for 766 Duck Hollow shed

The board approved the minutes from the October 6, 2025 meeting by a 5‑0 vote. It then approved an area variance for Julia DeMario’s shed at 766 Duck Hollow, allowing it to be three feet from the lot line with conditions that no combustibles be stored in the shed and that a new variance be required if the shed is removed. No vote was recorded for the variance request from 7730 Pine Tree Drive.

Thu Oct 30, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review 156-unit apartment project and solar farm

The Planning Board will consider several development applications, including a large multi-family housing complex and a solar energy facility. The board will also review a dog grooming facility and an art gallery conversion.

zoningsolarhousingcommercial-developmentsubdivision
✓ Decided: Planning Board approved special use permit for Norbut Solar Farm

The Victor Planning Board reviewed the revised site‑plan and special‑use permit application for a 4.43 MW solar photovoltaic project on a 34.9‑acre parcel on Main Street Fishers. After the chairman read the draft resolution, the board voted on a motion by Scott Harter, seconded by Joe Limbeck, and approved the resolution recommending approval of the permit. No other substantive actions were taken at this meeting.

Thu Oct 30, 2025

Planning Board After Meeting Reports

Planning Board approves Norbut Solar Farm and Nickoloff Subdivision

The Planning Board reviewed several land use applications, approving a solar facility and a residential subdivision. Multiple other projects, including a hotel and restaurant at Eastview Mall, were tabled or removed until the next meeting.

solarzoningsubdivisioncommercial-developmenthousing
Mon Oct 27, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to hold public hearings on 2026 budget and 2025 special assessments

The Town Board will conduct public hearings regarding the preliminary 2026 budget and the 2025 Special Assessment Roll for sewer, lighting, and water districts. The board will also consider several 2026 employee insurance contracts and the purchase of real properties.

budgetpublic-hearingspecial-assessmentreal-estatezoningemployee-benefits
✓ Decided: Town Board approved 2026 health, dental, vision insurance contracts and HSA funding

The Board approved payment of bills totaling $574,752.20 and closed two public hearings. It adopted resolutions authorizing contracts for MVP health insurance, ROBEX dental, Excellus retiree health, and ROBEX vision insurance for 2026. The Board also authorized funding of Health Savings Accounts for employees who select the 2026 High‑Deductible Health Plans. All votes were 4‑aye, 0‑nay.

Mon Oct 27, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks & Rec Committee to discuss DRP Playground replacement and Recreation Center

The Parks and Recreation Citizens’ Advisory Committee will meet to review updates on the Recreation Center and the 2026 DRP Playground Replacement project. The body will also discuss Brace road usage and committee membership.

parks-and-recreationplaygroundspublic-facilitiesinfrastructure
✓ Decided: September meeting minutes approved by the advisory committee

The Parks & Rec Citizens' Advisory Committee approved the September meeting minutes with no changes. The committee discussed several projects—including a dryer pump track proposal, a recreation‑center land purchase, a playground replacement, and dog‑park hose repairs—but no formal decisions or votes were recorded on those items.

Tue Oct 21, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review Nickoloff Final Subdivision

The Conservation Board will meet to review a subdivision project and approve previous meeting minutes. The primary item is a request to develop acreage into residential lots.

subdivisionland-useconservation
✓ Decided: Board approved two prior minutes and adjourned the meeting

The Conservation Board approved the September 16, 2025 and October 7, 2025 meeting minutes. The board discussed the Nickoloff Subdivision project, agreed on easement types for the lots, and recommended that the applicant finalize easement language and marker materials for Planning Board review. The meeting was then adjourned.

Wed Oct 15, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board reviews High Point Business Park PDD amendment for 255 units

The Victor Planning Board will consider a referral from the Town Board to amend the High Point Business Park Planned Development District, changing the number and type of residential units. The board will also discuss several site-specific applications, including a Walmart addition, a residential pool, a dog grooming facility, and a subdivision acknowledgment. Items marked as removed will be postponed to a future meeting.

zoningcommercialresidentialdevelopmentplanning
✓ Decided: Planning Board acknowledges complete sketch plan for Lehigh Place subdivision

The board approved the minutes from the August 12, 2025 meeting (3‑aye, 0‑nay, 2‑abstain). It then voted to acknowledge receipt of a complete sketch‑plan application for the Lehigh Place PDD Subdivision, approving the resolution 4‑aye, 0‑opposed, 1‑abstain. The Norbut Solar Farm application was removed from the agenda and will be reconsidered at the next meeting.

Wed Oct 15, 2025

Planning Board After Meeting Reports

Planning Board approves Walmart addition and several other projects

The Victor Planning Board reviewed a mix of applications, approving several projects and postponing or removing others. Approved items included a 1,974‑sq‑ft addition to a Walmart at 441 Commerce Drive, a 15‑by‑35‑ft in‑ground pool at 7885 Hidden Oaks, a single‑family home and barn on Strong Road, and parking for pickleball courts at 100 Cobble Creek Drive. The board also approved the recommendation to amend the High Point Business Park PDD to allow 255 residential units. Other items such as the Norbut Solar Farm, Bow Wow Dog Salon, Chick‑Fil‑A restaurant, and several subdivision proposals were tabled, removed, or withdrawn for future consideration.

zoningcommercialresidentialdevelopmentplanning
Tue Oct 14, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to set 2026 budget public hearing and discuss new zoning district

The Town Board will set the date for the 2026 budget public hearing and a hearing for the 2025 Special Assessment Roll. Members will also consider a local law to establish the Commercial Center Zoning District. Other business includes budget amendments for state programs and Southgate Hills subdivision matters.

budgetzoningpublic-hearinginfrastructureland-use
✓ Decided: Town Board increased 2025 highway CHIPS budget by $102,546.62

The board approved payment of $1,054,689.30 in bills for Manifest No. 19 and amended the 2025 CHIPS revenue line to $377,546.62, an increase of $102,546.62. It also adopted the preliminary 2026 budget and scheduled a public hearing for October 27, 2025, and set a public hearing for the 2025 special assessment roll. All three prior meeting minutes were approved unanimously.

Tue Oct 14, 2025

Town Board Draft Resolution Packets

Town of Victor proposes new Commercial Center zoning and 2026 budget

The Town Board is reviewing the 2026 preliminary budget and a proposal to create a 'Commercial Center' (CC) zoning district for larger commercial sites. The board is also addressing highway revenue increases and special assessments for water, sewer, and lighting districts.

zoningbudgetroadssewerwaterpublic-hearing
Tue Oct 14, 2025

Town Board After Meeting Reports

Town Board approves amendment to create Commercial Center Zoning District

The Victor Town Board approved several actions at its October 14 meeting, including a zoning amendment to establish a Commercial Center Zoning District. The board also amended the 2025 budget to add revenue for Chips, Pave NY, and EWR programs and set a public hearing for the 2026 budget on October 27. Additional approvals covered a planning board appointment, a record‑management grant agreement, and a dedication for Southgate Hills.

zoningbudgetfinanceplanningrecordspublic-hearing
Thu Oct 9, 2025

Boughton Park Commission Agendas & Minutes

Park commission to review roofing quotes and water system updates

The Boughton Park Commission will approve September minutes and pay bills. The meeting will also cover roofing quotes for the Stirnie Road pavilion, tree work, and a water collection system update.

parksroofingwater-systemmemorialsminutesbudget
✓ Decided: Commission approved prior minutes, treasurer report, and tree removal quote

The Boughton Park Commission unanimously approved the minutes from the previous meeting and the treasurer’s report. They also approved Kevin Holtz’s $875 quote for tree removal. The meeting was then adjourned. Other topics such as bridge repairs, pavilion roofing, and park improvements were discussed but no formal actions were taken.

Tue Oct 7, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review apartment complex site plan

The Conservation Board will meet to review a site plan for a proposed apartment complex at Lehigh Place. The applicant requests approval for three four-story buildings with 156 units, a clubhouse, and parking. The board will also approve the minutes from the previous meeting.

zoninghousingplanningsite-planconservation-board
✓ Decided: September 2025 minutes were tabled

The Conservation Board voted to table the minutes from the September 16, 2025 meeting. No other actions were approved, denied, or postponed. The board discussed the Lehigh Place PDD site plan but did not make a decision on it.

Mon Oct 6, 2025

Town Board Agendas, Minutes & YouTube Videos

✓ Decided: Town Board authorized lease of 700 Eastview Mall property to LTEVM, LLC

The board entered an executive session for pending litigation, then resumed the meeting. It adopted Resolution No. 227 authorizing the town to lease the 700 Eastview Mall Drive property to LTEVM, LLC for at least three years, subject to a permissive referendum and recording requirements. The supervisor was directed to execute the lease agreement and the clerk to advertise the referendum and record the resolution.

Mon Oct 6, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board approves Chick-fil-A variances and tables other applications

The Zoning Board of Appeals approved multiple variances for a Chick-fil-A at 7979 Pittsford Victor Rd, including open space and fence height, while tabling other applications including a shed variance for 766 Duck Hollow.

zoningvarianceschick-fil-apublic-hearingtown-hall
Mon Oct 6, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Chick‑Fil‑A seeks multiple zoning variances for its Pittsford Victor Rd site

The Victor Zoning Board of Appeals will hold public hearings on several variance requests. Applicants include a DeMario property seeking an area variance for a 10 × 12 ft shed and Chick‑Fil‑A requesting variances for open‑space, a retaining‑wall fence, and a meal‑delivery canopy at 7979 Pittsford Victor Rd. The agenda also lists several withdrawn applications covering drive‑thru canopies, flagpole lighting, and various signage proposals.

zoningvariancesdevelopmentsignageopen-spaceconstruction
✓ Decided: Board approved September 15 meeting minutes, 5‑0 vote

The Zoning Board of Appeals approved the minutes from the September 15, 2025 meeting with five votes in favor and none against. The board then held an extensive discussion about an area variance request for a shed at 766 Duck Hollow, but no vote or formal decision on that request was recorded. All other agenda items were procedural or informational.

Mon Sep 29, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board will discuss Rule #1 regarding litigation status

The Victor Town Board will hold an executive session on Monday, September 29, 2025 at the town hall. The agenda lists only Rule #1, noted as proposed, pending, or current litigation. No additional items or details are provided in the agenda.

legalgovernmentboardexecutive-session
✓ Decided: Town Board approved fire service contracts worth $3.7M and a lease of fire district assets

The board entered and later ended an executive session (4‑0 vote). It adopted Resolution 224 to reimburse Victor Fire District up to $1,701,500 and create a $500,000 reserve fund (4‑0). It adopted Resolution 225 to reimburse Bushnell’s Basin Fire Association up to $2,000,000 and create a $500,000 reserve fund (4‑0). It adopted Resolution 226 to approve a lease of former Fisher Fire District properties and equipment (4‑0).

Tue Sep 23, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review solar farm and Chick-fil-A proposals

The Planning Board will consider several site plans and special use permits, including a solar energy facility and a new restaurant. The board will also review a proposed amendment to the High Point Business Park PDD regarding residential unit counts.

solarzoningcommercial-developmenthousingshort-term-rentals
✓ Decided: Planning Board reviewed Norbut Solar Farm special use permit and site plan

The Town of Victor Planning Board held its September 23, 2025 meeting and listed several upcoming public hearings. On a motion by Scott Harter, seconded by Al Gallina, the board presented a draft resolution concerning the Norbut Solar Farm special use permit and site plan. No vote tally or final approval was recorded in the minutes. No other substantive actions were taken.

Tue Sep 23, 2025

Planning Board After Meeting Reports

Planning Board tables the Norbut Solar Farm 4.428 MW project

The Victor Planning Board reviewed a range of development applications. Several items were approved, including a residential fence and a short‑term rental, while major projects such as the Norbut Solar Farm and a High Point Business Park amendment were tabled for future consideration. The board also noted the removal of applications for a Walmart addition and other proposals.

zoningsolardevelopmentpublic-hearingplanning
Mon Sep 22, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to review budget and approve equipment purchases

The Victor Town Board will review tentative budget documents, approve payments, and authorize contracts for ambulance services and highway equipment. The meeting will also address zoning and surplus property items.

budgethighwayparksplanningsupervisortown-clerkequipmentcontracts
✓ Decided: Town Board approves EMS ambulance contract worth $311,317

The board approved an amendment to the 2025 budget to appropriate $119,374 in ARPA federal aid. It also authorized a contract with Victor‑Farmington Volunteer Ambulance Corps to provide EMS services for the new fire districts at a cost up to $311,317. Additionally, the board approved the September 8 and 16 meeting minutes and authorized payment of $561,678.03 for Manifest No. 18.

Mon Sep 22, 2025

Town Board Draft Resolution Packets

Town Board approves $311k ambulance contract and ARPA budget amendment

The Town Board is deciding to amend the 2025 budget to include $119,374 in American Rescue Plan Act (ARPA) revenue and expenses, and to authorize a contract with the Victor-Farmington Volunteer Ambulance Corps for up to $311,317.26 to provide emergency services.

budgetarpaambulanceemscontractequipmentgrantsvictor
Mon Sep 22, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Discussion of the DRP Playground Replacement 2026 Project

The Victor Parks & Rec Citizens' Advisory Committee will review and approve the July meeting minutes. The committee will hear a report from the Director of Parks and Recreation and updates on the recreation center and the DRP Playground Replacement 2026 Project. Additional topics include road usage, an e‑bike educational opportunity, the Helen’s Way extension, and future CAC projects.

parks-recreationcommunityprojectsplaygrounde-bikeroads
✓ Decided: July meeting minutes approved by the advisory committee

The Parks & Rec Citizens' Advisory Committee approved the July meeting minutes with no corrections. No other actions were voted on; the committee discussed program updates, project ideas, and future topics but did not make any additional decisions.

Mon Sep 22, 2025

Town Board After Meeting Reports

Town Board approves budget amendments and equipment purchases

The Victor Town Board approved a series of agenda items including budget amendments, the authorization of a contract with the Victor Farmington Ambulance, and the purchase of a new grader and plow. The meeting also included the approval of a Halloween party agreement and the declaration of a generator as surplus.

budgetambulanceequipmentparksplanningtown-board
Tue Sep 16, 2025

Town Board Agendas, Minutes & YouTube Videos

✓ Decided: Board approves $3.9M eminent‑domain purchase of 700 Eastview Mall Drive

The Victor Town Board entered and then ended an executive session unanimously. It adopted Resolution No. 206, approving the appropriation of $3.5 million grant funds and the use of capital reserves for the acquisition of the 8.4‑acre parcel at 700 Eastview Mall Drive. The board also authorized a $3.9 million payment to HBC Victor LLC for the purchase and accepted $400,000 from Wilmorite Construction toward the acquisition. All votes were 4‑0 in favor.

Tue Sep 16, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Victor Conservation Board to review site plans for new homes and a Chick-fil-A

The Victor Conservation Board will meet to review site plans for a new single-family home on Sheldon Road and a Chick-fil-A restaurant at Eastview Mall. The board will also approve the minutes from the August 5, 2025, meeting.

conservationzoningsite-planchick-fil-aeastview-mallvictor
✓ Decided: Board approved prior meeting minutes and supported Sheldon site plan

The board approved the August 5, 2025 meeting minutes. The board expressed support for the Sheldon Site Plan, which proposes a new single‑family home, well, septic system, barn and pool on a 12.10‑acre parcel and an increase of the conservation easement from 6.04 to 7.10 acres. No formal decision was recorded on the Chick‑Fil‑A restaurant project. The meeting was adjourned at 7:08 pm.

Mon Sep 15, 2025

Zoning Board of Appeals After Meeting Reports

Chick‑fil‑A variances tabled for further review

The Victor Zoning Board of Appeals approved an area variance for a fence at 439 Fisher Road and a relief from the 2‑acre dog‑kennel requirement at 7235 SR 96. It tabled multiple Chick‑fil‑A variance applications (applications 17‑Z‑2025 through 23‑Z‑2025) for consideration on October 6, 2025. No other agenda items were listed.

zoningvariancesrestaurantssignagepublic-hearings
Mon Sep 15, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to hear requests for area variances and sign permits

The Victor Zoning Board of Appeals will hear requests for area variances and sign permits at the September 15 meeting. The board will consider a fence variance for a home on Fisher Road, a dog kennel variance for a property on SR 96, and multiple variances for a Chick-fil-A on Pittsford Victor Road.

zoningvariancessignagechick-fil-apublic-hearingvictor-ny
✓ Decided: Board approved September 2 minutes; variance request not decided

The Zoning Board of Appeals approved the minutes from the September 2, 2025 meeting with a vote of 4 ayes, 0 nays, and 1 abstention. The board heard a variance request for a fence at 439 Fisher Road, but no vote or final decision on the variance was recorded.

Thu Sep 11, 2025

Boughton Park Commission Agendas & Minutes

Boughton Park Commission to vote on the 2026 budget

The commission will approve the August 14, 2025 meeting minutes and hear the treasurer’s report with bill payments. Commissioners will vote on the town’s 2026 budget that was submitted on August 17, 2025. Additional items include reviewing an estimate for a Stirnie Road pavilion, planning pollinator plant installations, considering the Neenan Family proposal for new benches and picnic tables, and receiving an update on an Eagle Scout project.

budgetparkspavilionbenchespollinator-plantseagle-scout
✓ Decided: Commission approved $500 winch purchase for tree removal

The commission approved the minutes from the August 14, 2025 meeting and the treasurer’s report, both unanimously. It also approved a $500 purchase of a six‑ton pulling winch from Harbor Freight to remove a downed tree before the Eagle Scout project can begin, with a unanimous vote. The fall picnic was rescheduled to next month at Parkview Fairways with indoor backup plans. The meeting was adjourned unanimously.

Tue Sep 9, 2025

Planning Board Agendas, Minutes & YouTube Videos

September 9, 2025 Planning Board meeting cancelled

The Town of Victor Planning Board meeting scheduled for September 9, 2025, has been cancelled. No items were scheduled for decision or discussion.

proceduralplanning
Mon Sep 8, 2025

Town Board Agendas, Minutes & YouTube Videos

Victor considers splitting Fishers Fire District into two new protection districts

The Victor Town Board will hold a public hearing on creating two new fire protection districts to replace the existing Fishers Fire District. The board will also vote on accepting air duct cleaning bids, purchasing a new compactor, and transferring operating funds, along with other routine approvals and reports.

fire-protectionbudgetrezoningtown-boardpublic-hearing
✓ Decided: Victor Town Board establishes two new fire protection districts

The board voted 4‑0 (1 recused) to create Victor Fire Protection District No. 1 and No. 2, issuing a Negative Declaration and making the resolution effective immediately. It also approved $419,848.64 in bills for Manifest No. 17, awarded the air‑duct cleaning contract to On The Spot Cleaners for $21,415, and authorized funding for a $46,706 recycle‑compactor purchase. Additional actions included budget transfers for operating funds and approval of a conservation‑easement swap that expands protected land to 7.10 acres.

Mon Sep 8, 2025

Town Board Draft Resolution Packets

Town Board to establish two new fire protection districts

The Town Board will establish Victor Fire Protection District No. 1 and No. 2 to replace the dissolved Fisher Fire District. The board also plans to award a $21,415 air duct cleaning contract and approve budget transfers totaling $85,000 for staff and equipment.

fire-protectionbudgetcontractsequipmentparkstown-board
Mon Sep 8, 2025

Town Board After Meeting Reports

Victor Town Board approves creation of two new fire protection districts

The Victor Town Board held a public meeting on September 8, 2025, approving several items including the establishment of two new fire protection districts to replace the existing Fishers Fire District. The board also approved routine financial reports, bids, and rezoning applications.

fire-protectionzoningbudgettown-boardrezoning
Mon Sep 8, 2025

Historic Advisory Committee Agendas & Minutes

Historic Advisory Committee to discuss preservation and local history

The Historic Advisory Committee is meeting to review updates on cemetery preservation and the town's historian. The body will also discuss the historic lecture series and the ongoing process of interviewing farming families to document Victor's agricultural history.

historic-preservationlocal-historyagriculturecemeteries
✓ Decided: Historic Advisory Committee approved May 6 minutes and adjourned

The committee approved the minutes from the May 6, 2025 meeting after a motion by Bob Kelly and a second by Lisa Roberts. The meeting was then adjourned following a motion by Bob Kelly, seconded by Michael Boester. No other actions were voted on during the session.

Tue Sep 2, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board tables two area-variance requests for setback and lot-size relief

The Victor Zoning Board of Appeals will meet on September 2, 2025, at Town Hall to approve minutes and hold public hearings. Two area-variance requests are scheduled but will be tabled to later dates.

zoningarea-variancesetbacklot-sizepublic-hearing
Tue Sep 2, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board of Appeals to review variance requests for shed and dog kennel

The Zoning Board of Appeals will hold public hearings regarding two property variance requests. The board will consider a request for a shed location and a request for dog kennel acreage requirements.

zoningvariancespublic-hearingsland-use
✓ Decided: Board approved August 4 minutes; no decision on shed variance

The Zoning Board of Appeals approved the minutes from the August 4, 2025 meeting with a vote of 4-0-1. The board then held a public hearing on an area variance request for a 10‑by‑12 shed located on the property line at 766 Duck Hollow. After discussion, the board took no vote and did not grant or deny the variance.

Tue Aug 26, 2025

Planning Board Agendas, Minutes & YouTube Videos

Victor Planning Board to hold public hearings on six development projects

The Victor NY Planning Board will meet on August 26, 2025, to hold public hearings on six development applications, including a solar farm, a Walmart expansion, and a Chick-fil-A restaurant. The board will also consider sketch and site plan applications for subdivisions and modifications, with several items carried over from previous meetings.

zoningplanning-boardpublic-hearingsolar-farmretail-expansionsubdivisioncommercial-development
✓ Decided: Planning Board approved Thomas Tria’s duck‑coop and fence site plan

The Town of Victor Planning Board approved the Tria Site Plan Modification, allowing an 8‑by‑4‑foot duck coop and a 200‑foot, 6‑foot‑high fence, with conditions on fees, design standards, and a building permit. The vote was 4 Ayes, 0 Opposed, 1 Absent. The board also approved the minutes of the July 22, 2025 meeting (4 Ayes, 0 Nays, 1 Absent) and formally closed the public hearing on the Tria application.

Tue Aug 26, 2025

Planning Board After Meeting Reports

Planning Board approves antenna pole and duck coop modification

The Planning Board reviewed several site plan modifications and subdivision requests. The board approved a new antenna pole and a small residential modification, while declaring a lead agency for a solar farm project.

zoningsolartelecommunicationscommercial-developmentsubdivision
Mon Aug 25, 2025

Town Board After Meeting Reports

Town Board sets public hearing for new Fire Protection District

The Victor Town Board met to approve several administrative resolutions and personnel appointments. The board scheduled a public hearing for September 8th regarding the creation of a Fire Protection District.

fire-protectioninfrastructureappointmentsroadspublic-hearing
Mon Aug 25, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to set public hearing for new Fire Protection District

The Victor Town Board will meet to consider several resolutions, including the appointment of residents to boards and committees. The board is also scheduling a public hearing for September 8th regarding the creation of a Fire Protection District.

fire-protectionzoningroadsappointmentspublic-safety
✓ Decided: Town Board approved $2.6M Letter of Credit for Bluestone Trail project

The board approved payment of $558,358.37 for Manifest No. 16 bills. It adopted two resolutions: one to petition the NYS Department of Transportation to study the speed limit on Brownsville Road, and another to accept a $2,626,602.17 Letter of Credit and $83,410.65 fee for the Bluestone Trail development. The board also accepted the High Point Business Park amendment application as complete and approved several prior meeting minutes.

Mon Aug 25, 2025

Town Board Draft Resolution Packets

Town Board to consider new fire protection districts and Bluestone Trail credit

The Town Board is reviewing several resolutions, including the establishment of two new fire protection districts and the acceptance of a multi-million dollar letter of credit for a townhouse development. The board is also addressing local appointments and infrastructure easements.

fire-protectionzoninginfrastructureappointmentspublic-safetywater-service
Mon Aug 25, 2025

Agendas & Minutes

Victor Cemetery committee to dissolve and fold duties into Historic Advisory Committee

The Victor Cemetery Preservation and Restoration Committee will discuss dissolving its board and transferring responsibilities to the Historic Advisory Committee. The group will also review plans for fall 2025, including monument cleanings and participation in the Explore Victor Fest.

cemeteryhistoric-preservationcommitteevillage-hallexplore-victor-festlibrary
✓ Decided: Committee recommends dissolving cemetery committee and shifting duties to Historic Advisory Committee

The committee approved the March 31, 2025 meeting minutes. It passed a resolution recommending that the Victor Village Cemetery Preservation and Restoration Committee be dissolved and that its duties and funding be transferred to the Victor Historic Advisory Committee. The motion carried and the meeting was adjourned.

Tue Aug 19, 2025

Town Board Agendas, Minutes & YouTube Videos

Victor Town Board begins 2026 budget workshops on August 19

The Victor Town Board opens a series of workshops to draft the 2026 budget. The first session provides an overview of the Capital Plan on August 25, with additional meetings scheduled if needed through October 27.

budgetcapital-planningtown-boardworkshop
Tue Aug 19, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board meeting cancelled

The August 19, 2025 meeting of the Victor Conservation Board has been cancelled. The meeting was scheduled to take place at the Victor Town Hall, 85 East Main Street.

cancelledconservationmeeting
Mon Aug 18, 2025

Town Board Agendas, Minutes & YouTube Videos

Executive session to discuss confidential personnel and property matters

The Victor Town Board will hold a special executive session to discuss confidential personnel matters and potential real estate transactions under New York Open Meetings Law exceptions. No decisions will be made during this closed session.

executive-sessionpersonnelreal-estateconfidentiality
✓ Decided: Board entered and later ended executive session on personal matters

The Victor Town Board voted to enter executive session to discuss personal matters and potential real‑property transactions. The motion passed unanimously with three votes in favor and none against. The board later voted to end the executive session, also unanimously (3‑0). No other actions were taken.

Mon Aug 18, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to decide on 1.055-acre dog kennel relief request

The Victor Zoning Board of Appeals will hold a public hearing on a request for relief from the 2-acre zoning requirement for a dog kennel at 7235 SR 96 (12-Z-2025). The board will also approve minutes from the August 4 meeting and conduct routine procedural items.

zoningpublic-hearingdog-kennelproceduralzba
Thu Aug 14, 2025

Boughton Park Commission Agendas & Minutes

Victor park commission to review 2026 budget and park improvements

The Boughton Park Commission will meet to approve July minutes, hear the treasurer’s report, discuss the 2026 budget, and consider updates to the equipment barn water system and a new pollinator garden plan.

budgetparksinfrastructureenvironmentlocal-government
✓ Decided: Forest maintenance budget raised to $15,000

The commission approved the July meeting minutes and the treasurer's report. It voted to increase the forest maintenance budget to $15,000 and the payroll providers budget to $1,200. Materials and supplies were budgeted up to $8,500. The meeting was then adjourned.

Tue Aug 12, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review solar farm and dog salon proposals

The Planning Board will hold public hearings for two active site plan applications. Several other projects, including a hotel and restaurant, have been removed from this meeting's agenda.

zoningsolar-energybusiness-permitsland-use
✓ Decided: Planning Board approves July 8 minutes and removes two applications

The board approved the minutes of the July 8, 2025 meeting by a vote of 4 Ayes, 0 Nays, 1 Absent. Chairman Logan removed the Stewart Tree Service site‑plan application and the Tria site‑plan modification from consideration. No decision was made on the Bow Wow Dog Salon application; discussion continued.

Tue Aug 12, 2025

Planning Board After Meeting Reports

Planning Board items removed or tabled for August 12 meeting

The Planning Board meeting was scheduled to review several site plans and a subdivision application. All listed public hearing items and the preliminary application were either removed or tabled until the next meeting.

zoningsite-planssolar-energycommercial-developmentsubdivision
Mon Aug 11, 2025

Town Board Agendas, Minutes & YouTube Videos

Victor Town Board meeting scheduled for bill payment

The Town Board is meeting to process the payment of bills. No other business items are listed on the agenda.

financetown-board
✓ Decided: Board approved $346,048.28 payment of Manifest No. 15

The Town Board voted to approve Manifest No. 15 for $346,048.28, covering general town, highway, and other expenses. The board also adopted Resolution No. 185 proclaiming Constitution Week (Sept 17‑23). Both actions passed with four ayes and no nays; one member was absent.

Tue Aug 5, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review Cheshire Ridge subdivision request

The Conservation Board will review a request to create two new single-family lots at 100 Cobble Creek Rd. The board will also consider the approval of minutes from the June 3, 2025 meeting.

zoningland-usehousingsubdivision
✓ Decided: Board approved June 3 minutes and adjourned meeting

The Conservation Board approved the minutes from the June 3, 2025 meeting. No substantive project decisions were made. The board then adjourned the meeting at approximately 6:38 p.m.

Mon Aug 4, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to hear request for dog kennel acreage variance

The Zoning Board of Appeals will hold a public hearing regarding a zoning requirement for a dog kennel. One other requested area variance for a fence has been withdrawn.

zoningpublic-hearingvariancesanimal-services
✓ Decided: Board approved June 16, 2025 minutes with a 5-0 vote

The Zoning Board of Appeals approved the minutes from the June 16, 2025 meeting. The approval passed unanimously, with five ayes and zero nays. The board discussed a variance request for a decorative fence at 436 Cline Road, but no decision was recorded on that application.

Mon Aug 4, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board reviews dog kennel and fence variances

The Zoning Board of Appeals met to review requests for relief from zoning requirements. One application was tabled for a future date, and another was withdrawn.

zoningvariancesland-use
Mon Jul 28, 2025

Town Board After Meeting Reports

Victor Town Board approves sewer agreement and multiple park contracts

The Town Board decided on several agreements for Parks & Recreation programming and authorized the Supervisor to execute a Village Sewer Agreement. The board also approved three frontage easements for the MCWA.

sewerparks-and-recreationeasementstown-policycontracts
Mon Jul 28, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider sewer agreement and multiple frontage easements

The Victor Town Board will meet to approve various Parks & Recreation agreements and a Village sewer agreement. The board is also reviewing three frontage easements for the MCWA and an updated Town Hall meeting room usage policy.

sewereasementsparks-and-recreationtown-policycontracts
✓ Decided: Town Board approved $657,674.16 in bills for Manifest No. 14

The board approved the minutes from the July 14 meeting and authorized payment of $657,674.16 in bills listed in Manifest No. 14. It also authorized the Finance Director to seek competitive bids for air‑duct cleaning services up to $27,300. Several contracts for Parks & Recreation programs were approved, including a $700 music show, a revenue‑share Spanish instruction agreement, a $600 concert contract, and magic‑show agreements.

Mon Jul 28, 2025

Town Board Draft Resolution Packets

Town of Victor to seek bids for $27,300 air duct cleaning project

The Town Board is considering several service agreements for parks and recreation programs and a sewer agreement with the Village of Victor. The board will also review easement approvals and a drainage agreement for a property on Heather Lane.

budgetsewerparks-and-recreationeasementsinfrastructure
Mon Jul 28, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks & Rec Committee to review preliminary 2026 budget

The Parks and Recreation Citizens’ Advisory Committee will discuss the preliminary 2026 operating and capital budget. The body will also review updates regarding the Recreation Center and various park improvements.

parksbudgetrecreationinfrastructure
✓ Decided: CAC approves June minutes, signage purchase, and membership updates

The committee approved the June meeting minutes with no corrections. Signage for the VHT pathway was approved for purchase, and the vendor design is being finalized. The CAC website membership list was updated, removing two former members and adding three new members. The committee noted there will be no meeting in August.

Tue Jul 22, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review Chick-fil-A and Norbut Solar Farm proposals

The Planning Board will hold public hearings for a new quick-serve restaurant and a solar energy facility. Several other site plans and a subdivision application have been removed from the agenda until the next meeting.

zoningcommercial-developmentsolar-energypublic-hearingsite-plans
✓ Decided: Planning Board approved June 10 meeting minutes

The board approved the minutes from the June 10, 2025 meeting by a vote of 4 ayes, 0 nays, and 1 absent. Two pending applications – Stewart Tree Service site plan and Tria site plan modification – were removed and will be reconsidered at the next meeting. No vote was recorded on the Chick‑Fil‑A proposal or other items discussed.

Tue Jul 22, 2025

Planning Board After Meeting Reports

Planning Board takes no action on several site plans and subdivisions

The Planning Board reviewed several applications for commercial and residential developments. No decisions were reached as items were either removed, tabled, or saw no action taken.

zoningcommercial-developmentsolar-energyhousingsite-plans
Mon Jul 21, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to review fence variance and dog kennel size requirements

The Zoning Board of Appeals will hold public hearings regarding two area variances. The board will consider requests for a fence installation and a reduction in minimum acreage for a dog kennel.

zoningvariancespublic-hearingsfencinganimal-services
✓ Decided: Board unanimously approved June 16, 2025 meeting minutes

The Zoning Board of Appeals approved the minutes from the June 16, 2025 meeting with a 5‑0 vote. The board then heard a variance request for a decorative fence at 436 Cline Road, but no vote or decision on the request was recorded. The discussion focused on aesthetic impact and easement considerations.

Mon Jul 21, 2025

Zoning Board of Appeals After Meeting Reports

ZBA approves fence variance for 436 Cline Road

The Zoning Board of Appeals reviewed two variance requests. One application for a fence installation was approved, while a request for a dog kennel was tabled.

zoningvariancesfencinganimal-services
Tue Jul 15, 2025

Conservation Board Agendas, Minutes & YouTube Videos

July 15 Conservation Board meeting cancelled

The Conservation Board meeting scheduled for July 15, 2025, has been cancelled. No items were scheduled for decision or discussion.

procedural
Mon Jul 14, 2025

Town Board Agendas, Minutes & YouTube Videos

Victor Town Board to meet July 14 for bill payments

The Town Board will meet to process bill payments via Manifest #13. The agenda consists of procedural items and a scheduled executive session.

town-boardfinanceadministration
✓ Decided: Town Board approved $1,499,547.42 payment of Manifest No.13

The board voted 4‑0 to approve Manifest No.13 for $1,499,547.42, covering various town expenses. A motion to enter executive session was adopted 3‑0, and the session was later closed by another 3‑0 vote. The meeting was adjourned by a 3‑0 vote.

Mon Jul 14, 2025

Town Board After Meeting Reports

Victor Town Board approves payment of bills

The Town Board met to handle routine financial approvals and held an executive session. The meeting primarily consisted of procedural items.

financetown-board
Thu Jul 10, 2025

Boughton Park Commission Agendas & Minutes

Boughton Park Commission to discuss equipment barn water system

The Boughton Park Commission will meet to review the treasurer's report and approve previous minutes. The body will discuss a water collection system for the equipment barn and review trail counter data.

parksinfrastructuremaintenance
✓ Decided: Commission approved up to $800 for water collection system

The commission approved the June 2025 meeting minutes. They approved the treasurer’s report and authorized payment of outstanding bills. They authorized up to $800 for a water‑collection system, including a gutter and downspout diverters.

Tue Jul 8, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review solar farm and tree service site plans

The Town of Victor Planning Board will hold public hearings for two site plan applications. Several other projects, including a hotel and restaurant at Eastview Mall, have been removed from this meeting's agenda.

solarzoningland-usebusiness-development
✓ Decided: Planning Board approved June 10, 2025 meeting minutes

The board voted to approve the minutes from the June 10, 2025 meeting, with four Ayes, zero Nays and one member absent. No other motions were adopted. The board discussed the Stewart Tree Service site plan and requested a revised, professionally stamped site and landscaping plan before any approval can be considered.

Tue Jul 8, 2025

Planning Board After Meeting Reports

Planning Board tables or removes all scheduled project reviews

The Planning Board met to review several site plans and a subdivision application. All listed items on the agenda were either tabled or removed until the next meeting.

zoningsolarcommercial-developmenthousingsite-plans
Mon Jul 7, 2025

Historic Advisory Committee Agendas & Minutes

Historic Advisory Committee to review preservation and local history projects

The Historic Advisory Committee is meeting to discuss updates on cemetery preservation and the town's agricultural history. The body will also review the historic lecture series and Erie Canal artwork.

historic-preservationlocal-historyagriculturecommunity-outreach
✓ Decided: Committee approved May 2025 minutes and adjourned

The Historic Advisory Committee approved the May 6, 2025 meeting minutes after a motion by Bob Kelly, seconded by Michael Boester, which carried. The meeting was then adjourned by a motion from Bob Kelly, seconded by Karen Spawton, which also carried. No other substantive actions were decided at this meeting.

Mon Jul 7, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

July 7 Zoning Board of Appeals meeting cancelled

The Zoning Board of Appeals meeting scheduled for July 7, 2025, has been cancelled. No items were listed for discussion or decision.

zoning
Mon Jun 30, 2025

Agendas & Minutes

Committee to review cemetery monument conditions and fall 2025 plans

The Victor Cemetery Preservation and Restoration Committee is meeting to assess the condition of cemetery monuments. Members will also discuss scheduling monument cleanings and participation in upcoming community events.

cemeterypreservationcommunity-eventsvolunteers
Wed Jun 25, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to hold public hearing on auto sales facility at 7447 State Route 96

The Planning Board will review site plans for a wholesale/retail auto sales facility, a personal use barn, and residential property modifications. Several major projects, including a hotel and restaurant at Eastview Mall, have been removed from this meeting's agenda.

zoningsite-plancommercial-developmentresidentialpublic-hearing
✓ Decided: Planning Board approved Hoselton Enterprises site plan with conditions

The Board voted to approve the Hoselton Enterprises Site Plan & Change of Use submitted by 7447 Route 96 LLC. The approval was granted with five specific conditions and requires compliance before the chairman’s signature. The vote tally was 4 Ayes, 0 Opposed, and 1 Absent. The Warner Pole Barn application was discussed but no decision was made.

Wed Jun 25, 2025

Planning Board After Meeting Reports

Planning Board approves auto sales facility and residential barn

The Planning Board reviewed several site plans and subdivisions. Two projects were approved, while others were removed from the agenda or saw no action.

zoningsite-plansolarhousingcommercial-development
Mon Jun 23, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider budget amendment for pump station improvements

The Victor Town Board will meet to vote on personnel appointments, budget amendments, and various Parks & Recreation instructional agreements. The board is also reviewing planning decisions for street connectivity and infrastructure at Eastview Mall.

budgetpersonnelparks-and-recreationinfrastructurezoning
✓ Decided: Town Board approved $51,344.38 EV Ford F-150 purchase for Planning & Building

The board entered an executive session (5‑0) and later adjourned it (4‑0). It approved the May 27 and June 9 meeting minutes, approved $132,443.06 in bills (5‑0), and authorized the purchase of a 2025 EV Ford F‑150 pickup for $51,344.38 (5‑0). The board also amended the 2025 budget to fund a pump‑station improvement project (5‑0).

Mon Jun 23, 2025

Town Board Draft Resolution Packets

Town Board to consider $2.5 million budget amendment for pump station improvements

The Town Board is reviewing draft resolutions including a $2.5 million budget amendment for sewer pump station improvements and the purchase of an electric Ford F-150. The board is also considering several personnel appointments and agreements for Parks & Recreation instructors.

budgetsewerpersonnelparks-and-recreationvehiclesplanning
Mon Jun 23, 2025

Town Board After Meeting Reports

Victor Town Board approves budget amendment for pump station improvements

The Town Board decided on several personnel appointments, including a new Special Events Coordinator, and approved various instructional agreements for Parks & Recreation. The board also approved a budget amendment for pump station improvements and a positive decision for the Street Connectivity and Access Plan.

budgetpersonnelinfrastructureparks-and-recreationplanning
Mon Jun 23, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks & Rec Committee to discuss Recreation Center and playground projects

The Parks and Recreation Citizens’ Advisory Committee will meet to review reports and project updates. Discussions include the Recreation Center, VHT signage, and the DRP Playground 2026 Project.

parksrecreationplaygroundsinfrastructurepublic-facilities
✓ Decided: May minutes approved; DPR Playground 2026 project scope agreed

The committee approved the May meeting minutes after correcting a spelling error. It agreed on the title and scope of the DPR Playground 2026 project and created a draft request for proposals to be issued by July 25. The committee set the July meeting to be held in person and said the August meeting will be canceled if there are no urgent agenda items.

Tue Jun 17, 2025

Conservation Board Agendas, Minutes & YouTube Videos

June 17 Conservation Board meeting cancelled

The Conservation Board meeting scheduled for June 17, 2025, has been cancelled. No items were scheduled for decision or discussion.

conservation
Mon Jun 16, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

ZBA to consider area variance for fencing at 7447 SR 96

The Zoning Board of Appeals will hold a public hearing regarding a request from Hoselton Enterprises. The board is reviewing a proposal to install fencing across a sanitary sewer easement.

zoningvariancefencingeasement
✓ Decided: Board approves June 2, 2025 meeting minutes (5‑0 vote)

The Zoning Board of Appeals approved the minutes from its June 2, 2025 meeting with a unanimous 5‑0 vote. No vote or final decision was recorded on the Hoselton Enterprises area variance request discussed later in the meeting.

Mon Jun 16, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board approves area variance for Hoselton Enterprises

The Zoning Board of Appeals met to review and vote on pending area variances. The board approved one request regarding fencing installation.

zoningarea-variancefencingland-use
Thu Jun 12, 2025

Boughton Park Commission Agendas & Minutes

Boughton Park Commission to review dam updates and Eagle Scout project

The Boughton Park Commission will meet to discuss park maintenance and infrastructure. The session includes updates on dams from the Supervisors of Victor and East Bloomfield.

parksinfrastructurecommunity-projectsmaintenance
✓ Decided: Commission approved Max Houle’s Eagle Scout land‑bridge project in Boughton Park

The commission voted to approve the Eagle Scout project that will build a land bridge over a muddy trail section in Boughton Park. It also approved the May 8, 2025 meeting minutes, increased the cash‑draw limit to $60,000, and accepted the treasurer’s report and related bill payments. The board agreed to let each town clerk define park‑resident eligibility for parking permits.

Tue Jun 10, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review solar farm and subdivision applications

The Planning Board will hold public hearings on several site plans, including fireworks tents and a solar facility. The board will also consider a preliminary application for a residential subdivision on Blazey Road.

solarzoningsubdivisioncommercial-developmentresidential
✓ Decided: Planning Board approved May 28 minutes and postponed Hoselton site plan

The board approved the minutes from the May 28, 2025 meeting with a 4‑aye, 0‑nay, 1‑absent vote. The Hoselton Enterprises site‑plan application was removed from the agenda and will be considered at a future meeting. No other formal actions were taken during this session.

Tue Jun 10, 2025

Planning Board After Meeting Reports

Planning Board approves Nickoloff subdivision and seasonal fireworks tents

The Planning Board reviewed several site plans and subdivision applications. The board approved a 7-lot residential subdivision and two temporary fireworks tents, while several other projects were tabled or removed from the agenda.

zoningsubdivisionsolarcommercial-developmentresidential
Mon Jun 9, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider EDPL Section 303 offer

The Victor Town Board will meet to pay bills and discuss a resolution regarding an EDPL Section 303 offer. The meeting includes a period for public comment.

town-boardbillslegal
✓ Decided: Town Board approved offer for just compensation on 700 Eastview Drive property

The Board approved payment of $332,108.41 in bills, with a unanimous 3‑0 vote. It also adopted Resolution 144 authorizing a written offer of the appraised value for the 700 Eastview Drive property, contingent on receipt of funds, with three yeas and two members absent. The meeting was then adjourned.

Mon Jun 9, 2025

Town Board After Meeting Reports

Town Board authorizes EDPL Section 303 offer

The Town Board met to process bill payments and address a specific resolution. The board approved a payment manifest and an offer under EDPL Section 303.

financelegaltown-board
Tue Jun 3, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review Norbut Solar Farm proposal

The Conservation Board will review a request to develop a solar energy facility. The board will also vote on the approval of the May 20, 2025 minutes.

solar-energyland-useconservation
✓ Decided: Conservation Board approves minutes and backs Norbut solar farm proposal

The board approved the May 20, 2025 meeting minutes. The board expressed support for the Norbut Solar Farm project as presented, though no formal vote was recorded. The meeting was adjourned at approximately 7:04 pm.

Mon Jun 2, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to review area variances for storage shed and fence

The Town of Victor Zoning Board of Appeals will hold public hearings regarding two area variance requests. The board will determine if structures may remain or be placed forward of the frontline of primary buildings.

zoningvariancespublic-hearingsresidential
✓ Decided: Zoning Board unanimously approved May 19 meeting minutes

The Town of Victor Zoning Board of Appeals approved the minutes from the May 19, 2025 meeting with a 5‑0 vote. The board then heard a request for an area variance to keep an 8 × 12 ft shed at Champion Reserve Townhomes in its current location. Board members discussed site constraints and possible landscaping buffers, but no vote or formal decision on the variance was recorded.

Mon Jun 2, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board approves variances for storage shed and fence

The Zoning Board of Appeals met to review and vote on area variance requests. The board approved two requests regarding the placement of structures forward of primary building frontlines.

zoningvariancesland-use
Wed May 28, 2025

Planning Board Agendas, Minutes & YouTube Videos

Victor Planning Board to decide on noise-abatement berm and townhome grades

The Victor Planning Board will review and decide on several site plans and subdivision applications, including a noise-abatement berm along I-90, driveway slope waivers for townhomes, and final approval for a 59-unit townhome subdivision. The board will also hear updates from town committees and receive correspondence regarding the Bluestone Trail.

zoningsite-plansubdivisionnoise-abatementtraffic-noisedriveway-slopetownhomespublic-hearing
✓ Decided: Planning Board approves Collett berm site plan with conditions

The Board approved the minutes from the April 22 and May 13 meetings (4‑0‑1). It then approved Mitch Collett’s site‑plan for a ten‑foot earthen berm to reduce I‑90 noise, waiving a slope design standard and attaching several conditions (4‑0‑1). The Hoselton Enterprises site‑plan was postponed to a later meeting.

Wed May 28, 2025

Planning Board After Meeting Reports

Planning Board approves berm, townhomes, and final subdivision plan

The Victor Planning Board met on May 28, 2025, to review and vote on several site plans, subdivisions, and a field change. The board approved items including a noise-abatement berm, final approval for a 59-unit townhome subdivision, and a single-family home. Several applications were removed or tabled for further review.

zoningsubdivisionsite-plannoise-abatementtownhomessingle-familycommercial
Tue May 27, 2025

Town Board Draft Resolution Packets

Town Board to hold public hearing on sewer connection fees

The Town Board will hold a public hearing on May 27 to consider revising one-time charges for new connections to the Consolidated Sewer District. The board is also considering several personnel appointments and equipment purchases.

sewerfeeshighway-departmentparks-and-recreationpublic-hearing
Tue May 27, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to hold public hearing on Consolidated Sewer District one-time charge

The Town Board will conduct a public hearing regarding a one-time charge for the Consolidated Sewer District. The board will also consider setting this charge for commercial parcels within the district following the hearing.

sewerpublic-hearinghighwayparks-and-recreationappointments
✓ Decided: Board approved $398,946.72 in bills and adopted several resolutions

The Town Board approved bills totaling $398,946.72 for various expenses. It also adopted resolutions to purchase a $46,706 compactor, to contract music instruction with Amy Oldfield, to grant an insurance‑waiver for that contract, and to appoint members to the Parks & Recreation Citizens Advisory Committee. The public hearing on the Consolidated Sewer District charge was closed and the meeting minutes were approved.

Tue May 27, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Victor Parks & Rec committee reviews park projects and updates

The Parks and Recreation Citizens’ Advisory Committee will meet to approve April meeting minutes and hear updates from the Director of Parks and Recreation. The agenda includes progress reports on Harlan Fisher Park Phase 2, the Dryer Road Park Playground 2026 project, Mead Square Master Plan, and the Recreation Center. Additional items cover VHT signage, pathway improvements, Brace Road usage, and committee membership.

parks-and-recreationharlan-fisher-parkdryer-road-parkmead-squarerecreation-centervht-signagepathway-improvementsbrace-road
✓ Decided: Committee approved April meeting minutes with no changes

The Parks & Recreation Citizens’ Advisory Committee approved the April meeting minutes, noting no changes were requested. The remainder of the meeting consisted of project updates, event announcements, and discussion of committee membership, but no additional formal actions were taken.

Tue May 27, 2025

Town Board After Meeting Reports

Town Board sets one-time charge for Consolidated Sewer District commercial parcels

The Town Board held a public hearing and approved a one-time charge for commercial parcels within the Consolidated Sewer District. The board also approved a vehicle purchase for the Recycle Department and a music instruction agreement. An executive session was held regarding the acquisition, sale, or lease of real property.

sewerpublic-hearingequipmentparks-and-recreationreal-estate
Tue May 20, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review Bluestone Trail townhouse project with 59 units

The Victor Conservation Board will review the Bluestone Trail project, a proposed 59-unit multi-family townhouse development on 18.5 acres at 7200 Rawson Road. The applicant seeks approval for the project, which includes two private roads and dedicates approximately 74% of the parcel as open space. The board will also consider approval of the May 6, 2025 meeting minutes.

conservationzoninghousingopen-spacetownhouse
✓ Decided: Board approved May 6 minutes; no project decisions taken

The Conservation Board approved the minutes from the May 6, 2025 meeting after a motion and second. No formal approval, denial, or amendment was made regarding the Bluestone Trail development or its conservation easement.

Mon May 19, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to review sign, shed, and apartment variances

The Zoning Board of Appeals will hold public hearings to consider three variance requests. These include a request for a subdivision sign, a shed placement, and an in-law apartment.

zoningvarianceshousingsigns
✓ Decided: Board approves April 21, 2025 meeting minutes

The Town of Victor Zoning Board of Appeals approved the minutes from the April 21, 2025 meeting by a vote of 3 ayes, 0 nays, and 2 abstentions. Afterward the board heard a variance request for a Highline Park sign, but no decision or vote on that request was recorded. No other actions were taken during the meeting.

Mon May 19, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board approves sign and shed variances

The Zoning Board of Appeals reviewed three variance requests. Two requests were approved, and one request regarding an in-law apartment was tabled.

zoningvariancessignshousing
Tue May 13, 2025

Planning Board Agendas, Minutes & YouTube Videos

Board to consider Hoselton auto sales facility at 7447 Route 96

The Planning Board will hold public hearings on two applications: a Verizon antenna modification at 600 Fishers Station Drive and Hoselton Enterprises' request to open a wholesale/retail auto sales facility at 7447 State Route 96. Several other items (Collett berm, Timberview subdivision, Element by Westin hotel, and Chick-fil-A restaurant) have been removed until the May 28 meeting. The board will also review the preliminary application for the Nickoloff subdivision on Blazey Road.

planning-boardpublic-hearingsite-plansubdivisionauto-salesantennas
✓ Decided: Planning Board approves Verizon antenna site plan with conditions

The Town of Victor Planning Board approved the Bell Atlantic d/b/a Verizon Wireless site plan and special use permit (Application No. 11‑SP‑2025 and 03‑SU‑2025) after a public hearing. The approval was granted with three conditions: compliance with the town’s design and construction standards, addressing LaBella Associates’ comments, and obtaining a building permit before construction begins. The motion passed with three Ayes, no Opposed, and two members absent. The April 22, 2025 meeting minutes were tabled.

Tue May 13, 2025

Planning Board After Meeting Reports

Planning Board approves antenna modifications at 600 Fishers Station Drive

The Planning Board reviewed several site plans and subdivision applications. One request for antenna modifications was approved, while multiple other projects were tabled or removed from the agenda.

zoningtelecommunicationscommercial-developmentsubdivisionshousing
Mon May 12, 2025

Town Board Draft Resolution Packets

Town Board sets public hearing on amending one-time sewer connection fees

The Victor Town Board will set a public hearing for May 27, 2025 to consider amending the fee schedule for one-time charges on new connections to the Consolidated Sewer District. The board also will vote on an amended bid award for pedestrian and bicycle safety improvements on Auburn Trail, appoint a code enforcement officer, and approve changes to the Zoning Board of Appeals. Several letter of credit releases for subdivision improvements are also on the agenda.

town-boardsewerfeespublic-hearingappointmentscode-enforcementzoningpedestrian-safety
Mon May 12, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to set public hearing on sewer connection fee changes

The Victor Town Board will meet to discuss the 2026 School Budget and consider several appointments. The board is scheduled to set a public hearing regarding amendments to the fee schedule for new connections to the Consolidated Sewer District.

sewerfeesappointmentszoningpublic-safetybudget
✓ Decided: Board approved $570,806.49 in bills for Manifest No. 9

The board approved the April 28, 2025 meeting minutes and authorized payment of $570,806.49 for Manifest No. 9. It awarded the $23,001.40 bid to Road Safe Traffic Systems for flashing beacons and bicycle signage on the Auburn Trail. The board appointed Joseph Georgia as a full‑time Code Enforcement Officer and Patrick Coates to the Zoning Board of Appeals. It also authorized a signal‑warrant analysis for High Street intersections, to be done after bridge work is completed.

Mon May 12, 2025

Town Board After Meeting Reports

Town Board sets public hearing on sewer connection fee changes

The Victor Town Board will hold a regular meeting including an executive session for litigation and real property matters. The board will consider approvals of minutes and bills, hear a presentation on the 2026 school budget, and vote on several resolutions. Key actions include setting a public hearing to amend the fee schedule for new connections to the Consolidated Sewer District and approving appointments and a resignation for the Zoning Board of Appeals.

town-boardexecutive-sessionsewer-feespublic-hearingappointmentszoningcrosswalksschool-budget
Thu May 8, 2025

Boughton Park Commission Agendas & Minutes

BP Dam Project update and Eagle Scout proposal on May 8 agenda

The Boughton Park Commission will hear an update on the BP Dam Project from Victor and East Bloomfield town supervisors, review an Eagle Scout project proposal by Max Houle, and discuss park maintenance, restroom annual maintenance, trail counter updates, and DEC regulations.

parksdam-projecteagle-scoutmaintenancetrailsregulationstown-supervisors
✓ Decided: Commission approved restroom cleaning contract and financial report

The commission approved the minutes from the April 10 meeting. It also approved the financial report and authorized payment of outstanding bills. A contract was approved to hire Scott from Vernon and Valence Septic to pump park restroom toilets, not to exceed $600. The meeting was then adjourned.

Tue May 6, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board reviews 59-unit townhouse development on Rawson Road

The Conservation Board will review a proposal for the Bluestone Trail Final project at 7200 Rawson Road, which seeks approval to build 59 for-sale multi-family townhouse units on an 18.5-acre parcel with approximately 74% open space. The board will also consider approving meeting minutes from March 18 and April 1, 2025.

housingdevelopmentconservationtownhomesmultifamilyopen-spaceplanning
✓ Decided: Conservation Board approved March and April 2025 meeting minutes

The board approved the minutes from the March 18, 2025 meeting and the April 1, 2025 meeting. The meeting was then adjourned at about 6:51 p.m. No formal action was taken on the Bluestone Trail development proposal.

Mon May 5, 2025

Historic Advisory Committee Agendas & Minutes

Historic Advisory Committee to discuss cemetery, farming history, and plaque source

The Victor Historic Advisory Committee will approve minutes from September 2024 and welcome new members. Old business includes updates on cemetery preservation, the historian's report, a historic lecture series, the completed barns inventory, and continuing interviews with farming families. New business covers sourcing new historic plaques, Erie Canal art and lectures, and a fourth-grade field trip to Valentown. No votes or binding decisions are scheduled.

historic-preservationcemeteryfarming-historyplaqueseducationerie-canalplanningzoning
✓ Decided: Historic Advisory Committee approved prior minutes and adjourned

The committee voted to approve the meeting minutes from September 9, 2024. A motion to adjourn the May 5, 2025 meeting was also carried. No other formal actions were taken.

Mon May 5, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board of Appeals May 5 meeting cancelled

The May 5, 2025 meeting of the Victor Zoning Board of Appeals has been cancelled. No items will be discussed or decided.

cancelled-meetingzoning-board-of-appealsvictor-ny
Mon Apr 28, 2025

Town Board Draft Resolution Packets

Town of Victor seeks $1.26 million grant for sewer force main replacement

The Town Board is considering a grant application for the County Road 9 Sanitary Sewer Force Main replacement project. The meeting also includes several personnel appointments and the sale of surplus equipment.

infrastructuregrantszoningpersonnelequipment
Mon Apr 28, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to authorize ESP Consulting contract and federal grant application

The Victor Town Board will hold an executive session for litigation, personnel, and real property matters before the regular meeting. At the regular meeting, they will consider 17 resolutions including a professional services contract with ESP Consulting, a Community Project Funding grant application, personnel appointments and resignations, sale of town equipment, purchase of an EV Ford F-150, and various park and software agreements.

contractsgrantspersonnelequipmentparksroadsev-vehiclesfederal-funding
✓ Decided: Board approved submission of $1.26 M sewer grant application

The Victor Town Board approved several items, including payment of $293,219.86 in bills (Manifest No. 8) and the town’s minutes from April 14, 2025. It authorized a six‑month professional services agreement with ESP Consulting, LLC at $3,500 per month. The Board approved the submission of a Community Project Funding grant application for the County Road 9 sanitary‑sewer force‑main replacement project, estimated up to $1.26 million. It also acknowledged the resignation of Nicholas Bodine and appointed Jorge Coria as a full‑time cleaner and Dustin Green as heavy‑equipment mechanic.

Mon Apr 28, 2025

Town Board After Meeting Reports

Town Board approves new hires, equipment purchases, and professional contracts

The Victor Town Board met to approve several personnel appointments and resignations. The board authorized a professional services contract with ESP Consulting LLC and a grant application for fiscal year 2025. Other decisions included the purchase of a 2025 EV Ford F-150 and the sale of highway equipment to the Town of East Bloomfield.

economic-developmentpersonnelhighwaygrantsequipment
Mon Apr 28, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks committee to discuss recreation center update and VHT signage

The Victor Parks and Recreation Citizens’ Advisory Committee will review March meeting minutes, hear a director's report, and discuss updates on the recreation center, VHT signage and pathway improvements, Project Dryer 2026, Brace Road usage, and committee membership. This is a discussion and update meeting with no final decisions or votes listed.

parksrecreationcommunity-centersignagepathwaysproject-dryerbrace-roadmembership
✓ Decided: March meeting minutes approved with no changes

The Citizens' Advisory Committee approved the March 2025 meeting minutes without any changes. No other items were formally decided; the remaining topics were discussed or noted for future action.

Tue Apr 22, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review building additions and new subdivisions

The Planning Board will hold public hearings on three site plan requests and one preliminary subdivision application. Several items, including hotel and restaurant projects at Eastview Mall, have been removed from the agenda until May 13th.

zoningsubdivisionssite-planscommercial-developmentresidential-development
✓ Decided: Planning Board approves PMD South Building Addition site plan with conditions

The Planning Board approved the site plan for the PMD South Building Addition at 727 Rowley Road. The board adopted a negative environmental declaration and allowed a reduction of parking spaces from 273 to 146. Approval was granted subject to several conditions, including payment of fees, addressing LaBella Associates’ comments, compliance with design standards, water‑impact mitigation, exterior lighting compliance, a pre‑construction meeting, a Letter of Credit, and obtaining building permits.

Tue Apr 22, 2025

Planning Board After Meeting Reports

Planning Board declares lead agency for 24-lot Timberview Estate subdivision

The Planning Board approved two site plans (a 19,870 sq ft building addition on Rowley Road and a 1,040 sq ft garage on Pine Tree Drive), tabled a berm project on Brownsville Road, and declared itself lead agency for the Timberview Estate subdivision (24 lots on 74.5 acres on Cline Road). Three items—the Element by Westin hotel, Chick-fil-A restaurant, and Nickoloff subdivision—were removed and rescheduled to the May 13 meeting.

planning-boardsite-planssubdivisionspublic-hearingseastview-malltimberview-estateshousingcommercial-development
Mon Apr 21, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

ZBA to hear three variance requests: garage setback, sprinkler waiver, sign lighting

The Victor Zoning Board of Appeals will hold public hearings on three variance requests: a proposed garage at 7600 North Road, a sprinkler waiver for a pole barn at 830 Phillips Road, and a sign variance for a subdivision sign at 7652 Main St. The board will also approve minutes from April 7, 2025.

zoningvariancespublic-hearingsarea-variancesprinkler-waivergaragessigns
✓ Decided: Board discussed a garage variance request but took no action

The Zoning Board of Appeals heard the Harriff application for an area variance to place a detached garage on 7600 North Road. Board members reviewed site conditions, setbacks, and cost implications, but no vote or final decision was recorded. The matter was left open for further consideration.

Mon Apr 21, 2025

Zoning Board of Appeals After Meeting Reports

ZBA approves area variance for garage, sprinkler waiver for pole barn

This document reports the results of the Victor Zoning Board of Appeals meeting on April 21, 2025. The Board approved two public hearing requests: an area variance for a detached garage at 7600 North Road, and a sprinkler waiver for a pole barn at 830 Phillips Road. A third request for a sign at Highline Park was tabled to May 19, 2025.

zoningarea-variancesignspublic-hearingplanning
Tue Apr 15, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board meeting cancelled

The Conservation Board meeting scheduled for April 15, 2025, has been cancelled. No items were discussed or decided.

cancelledconservation-boardtown-of-victor
Mon Apr 14, 2025

Town Board Draft Resolution Packets

Town Board to consider $92,335 highway trailer purchase and connectivity plan

The Town Board will review the 2024 financial and court audit reports and consider the adoption of the 2022 Victor Connectivity and Access Plan. The meeting includes appointments for ADA compliance and the Deputy Town Clerk, as well as contracts for summer park concerts.

budgethighwaysparks-and-recreationappointmentstraffic-planningaudits
Mon Apr 14, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider Street Connectivity and Access Plan lead agency status

The Victor Town Board will meet to review 2024 financial and court audit reports. The board is considering the appointment of a Deputy Town Clerk and the purchase of a Low Boy trailer. Members will also discuss classifying the Street Connectivity and Access Plan as a Type 1 project.

auditsappointmentshighwayparks-and-recreationplanninginfrastructure
✓ Decided: Town Board approved $579,537.26 in bills for Manifest No.7

The board approved the March 24, 2025 minutes and authorized $579,537.26 in payments for Manifest No.7. It accepted the 2024 town court and financial audit reports and appointed an ADA Compliance Officer and a Deputy Town Clerk. Additional actions included purchasing a highway trailer and entering a $750 summer concert agreement.

Mon Apr 14, 2025

Town Board After Meeting Reports

Victor Town Board approves street connectivity plan, audits, appointments

This after-meeting report summarizes actions taken by the Victor Town Board at its April 14, 2025 regular meeting. The board approved the 2024 town court and financial audits, appointed Frank Mueller as ADA compliance officer and Jenna Wernert as deputy town clerk, purchased a low boy trailer, and classified the Street Connectivity and Access Plan as a Type I action with the board as lead agency.

town-boardfinanceauditsappointmentshighwaysparksplanning
Thu Apr 10, 2025

Boughton Park Commission Agendas & Minutes

✓ Decided: Commission approved moving up to $30,000 into a 30‑day CD at 3.5% interest

The board approved a motion to place up to $30,000 in a revolving 30‑day certificate of deposit earning 3.5% interest. It also approved the treasurer's report, set a $2,500 limit for tree and supply purchases, and authorized several small purchases including a boat‑rack sign and volunteer T‑shirts. An executive session was called and later closed, and the meeting minutes from March 13 were approved.

Tue Apr 8, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to hold public hearings on four development projects

The Planning Board will conduct public hearings for a commercial building addition, a residential subdivision, a pole barn amendment, and EV charging stations. Several other applications, including a hotel and restaurant at Eastview Mall, have been removed from this meeting.

zoningcommercial-developmentresidential-subdivisionev-charging
✓ Decided: Planning Board approved prior minutes and closed the public hearing

The board approved the minutes from six previous meetings with a vote of 4 Ayes, 0 Nays, and 1 absent. A motion was then passed to close the public hearing for the applications on the agenda.

Tue Apr 8, 2025

Planning Board After Meeting Reports

Planning Board approves EV charging stations, subdivision, pole barn; defers hotel and Chick-fil-A

The Victor Planning Board approved several items at this meeting, including a minor subdivision, a pole barn expansion, and installation of 14 electric vehicle charging stations. It tabled one site plan for a building addition and removed preliminary applications for two subdivisions, a hotel, and a Chick-fil-A restaurant until the April 22 meeting.

planning-boardvictor-nyelectric-vehiclessubdivisionssite-planshotelsrestaurantspublic-hearings
Mon Apr 7, 2025

Zoning Board of Appeals After Meeting Reports

Zoning Board of Appeals reviews business operations and area variances

The Zoning Board of Appeals is reviewing a request regarding business operations in a Light Industrial Zoning District. The board is also considering area variances for storage sheds and garages.

zoningarea-variancelight-industrialpublic-hearing
Mon Apr 7, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board to review business operations and residential variances

The Zoning Board of Appeals will determine if business operations at 7548 CR 42 comply with Light Industrial Zoning District regulations. The board will also hold public hearings for two residential area variances regarding the placement of structures.

zoningarea-variancelight-industrialpublic-hearing
✓ Decided: Board approved March 3 minutes and ordered sign removal at 7548 CR 42

The Zoning Board of Appeals approved the minutes from the March 3, 2025 meeting by a 3‑0 vote (1 absent). The board reviewed the Stewart application for a tree‑service business at 7548 CR 42 and determined the existing sign is non‑compliant and must be taken down. Members noted the use may fit within Light Industrial zoning but could require a special permit from the Planning Department.

Thu Apr 3, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board holds executive session for real property discussion

This is a special meeting consisting solely of an executive session to discuss the proposed acquisition, sale, or lease of real property under Rule #3. No public business or decisions are scheduled.

executive-sessionreal-propertytown-board
✓ Decided: Town Board entered and exited executive session, then adjourned

The Board voted 5‑0 to enter an executive session to discuss a real‑property matter. Later, it voted 4‑0 to end the executive session. The meeting was then adjourned.

Tue Apr 1, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to rule on hunting in conservation easement

The Victor Conservation Board will review a proposal to subdivide 6.395 acres at 364 Fisher Road into two lots, and will interpret conservation easement language to determine if hunting and tree stands are allowed. The board will also approve minutes from its March 18 meeting.

conservationsubdivisionhuntingeasementsland-usetree-stands
✓ Decided: Board ruled permanent tree stands prohibited in conservation easements

The board acknowledged the Bell Minor Subdivision application as complete and asked for more detail on conservation easements before any building proceeds. It interpreted the easement language, deciding that permanent or affixed tree stands are not allowed, while temporary carry‑in‑carry‑out stands may be used, and that hunting is not expressly prohibited but subject to state law. The minutes from March 18, 2025 were tabled and the meeting was adjourned at about 6:59 pm.

Mon Mar 31, 2025

Agendas & Minutes

Cemetery committee to plan spring tour, reenactment with Key Club

The Victor Cemetery Preservation and Restoration Committee will meet on March 31, 2025, to approve minutes from September 2024 and conduct old and new business. They will introduce Michael Boester as a new member, review committee responsibilities, and discuss plans for a spring tour and reenactment with Key Club members. The committee also plans to walk the cemetery to check conditions and outline goals for 2025. The next meeting is scheduled for June 30, 2025.

cemeterypreservationrestorationcommitteevillagespring-tourreenactment
✓ Decided: Cemetery committee approved prior minutes and adjourned meeting

The Victor Village Cemetery Preservation and Restoration Committee approved the September 30, 2024 meeting minutes. The committee then adjourned the March 31, 2025 meeting. No other actions were decided; upcoming tours and events were discussed for future meetings.

Tue Mar 25, 2025

Planning Board Agendas, Minutes & YouTube Videos

Guilfoil subdivision public hearing, Chick-fil-A site plan on agenda

The Victor Planning Board will hold a public hearing on the Guilfoil Minor Subdivision to create two lots from 86.2 acres on Strong Road, and will consider a site plan application for a new Chick-fil-A restaurant with a double-lane drive-thru at Eastview Mall. Several other applications have been removed to future meetings, including the Nickoloff and Timberview Estate subdivisions and a proposed Westin hotel.

planning-boardsubdivisionpublic-hearingsite-plancommercial-developmentresidentialeastview-mallchick-fil-a
✓ Decided: Planning Board approves Guilfoil Minor Subdivision with conditions

The Town of Victor Planning Board held a public hearing on the Guilfoil Minor Subdivision and, after discussion, approved the subdivision application with a series of conditions. The approval includes requirements for fee payment, electronic file submission, and compliance with design standards. The board also moved to formally close the public hearing.

Tue Mar 25, 2025

Planning Board After Meeting Reports

Planning Board approves Guilfoil minor subdivision on Strong Road

The Planning Board approved a minor subdivision creating two lots from 86.2 acres on Strong Road (Guilfoil Irrevocable Trust). Several other applications were removed or tabled: the Nickoloff and Timberview Estate subdivisions, the Element by Westin hotel, and the Chick-fil-A restaurant were all postponed to future meetings.

planning-boardsubdivisionscommercial-developmenthotelchick-fil-azoningpublic-hearing
Mon Mar 24, 2025

Town Board Draft Resolution Packets

Town Board to shift $2.25M to capital reserves for future highway and recreation facilities

The Victor Town Board will consider a resolution to amend the 2024 budget by moving $2,252,742 from unassigned fund balance to a capital reserve for future Town Highway and Recreation facilities. Other business includes awarding a $618,859.55 bid for Cobblestone Creek Phase 1 reconstruction, authorizing a wheel loader purchase with trade-in, and entering an organic food scrap recycling agreement with Natural Upcycling. The board also will accept a donation for Harlan Fisher Park and appoint a new Clerk to Town Justice.

financebudgetcapital-reservehighwayparkscompostingpublic-worksappointments
Mon Mar 24, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to vote on Cobblestone Creek bid and Dryer Road Park playground project

The Victor Town Board will consider several personnel appointments and budget amendments. The board is deciding on contracts for organic food scrap recycling and the Dryer Road Park Playground Replacement Project. The meeting includes the purchase of a 2025 Milton Caterpillar 962 wheel loader.

budgetpersonnelhighwayparks-and-recreationcontracts
✓ Decided: Town Board allocates $2.25 M to capital reserve and appoints new officials

The Board approved the March 10 and 18 meeting minutes and authorized payment of $256,309.68 for Manifest No. 6. It appointed Caitlyn Bailey and Bridget Bartholomay as full‑time Recreation Leaders and amended the 2024 budget to move $2,252,742 into the Capital Reserve – Buildings and Land Fund. The Board also accepted the resignation of Kelli Kubinski as Clerk to the Town Justice and appointed Amanda Curry to that position.

Mon Mar 24, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks committee to discuss recreation center update, Brace Road uses

The Victor Parks and Recreation Citizens’ Advisory Committee will review January and February meeting minutes, receive a director's report, and discuss a recreation center update. Other topics include VHT signage and pathway improvements, a connectivity report, and potential uses for Brace Road such as disc golf or an RC track. The committee will also address membership and co-chair positions.

parksrecreationadvisory-committeevictor-nytrailsconnectivitymembership
✓ Decided: Two new full‑time staff members appointed to Parks & Rec team

The committee approved the January and February meeting minutes without changes. Anna Sullivan and Trevor Knapp were appointed to full‑time positions on the parks and trails team. Brian Emelson, Corey Smith and Dirk Endres scheduled a follow‑up meeting for April 8 to review the recreation center update. An Arbor Day tree‑planting volunteer event was announced for April 26 at 10 a.m.

Mon Mar 24, 2025

Town Board After Meeting Reports

Town Board approves Cobblestone Creek project bid and new equipment

The Victor Town Board met to approve several personnel appointments and highway projects. The board authorized a new wheel loader purchase and an organic food scrap recycling agreement. Additionally, the board approved multiple performance agreements for Parks & Recreation.

highwayparks-recreationpersonnelwaste-managementbudget
Tue Mar 18, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board holds executive session on real property deal

The Victor Town Board is meeting in a closed executive session on March 18, 2025, to discuss the proposed acquisition, sale, or lease of real property. This session is held under Rule #3 to avoid affecting property value through premature publicity. No public decisions or votes are expected during this session.

town-boardexecutive-sessionreal-propertyvictor
✓ Decided: Victor Town Board holds executive session on property deal, no action taken

The Victor Town Board met in a special session on March 18, 2025, and unanimously voted to enter executive session to discuss a proposed acquisition, sale, or lease of real property. After the closed session, the board adjourned without taking any formal action. No substantive decisions were made during the public portion of the meeting.

Tue Mar 18, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review Chik-Fil-A proposal at Eastview Mall

The Conservation Board will review a proposal for a 5,331-square-foot quick-serve restaurant (Chik-Fil-A) with a double-lane drive-thru and outdoor patio on a 1.96-acre portion of the Eastview Mall parcel. The board will also vote on minutes from the March 4, 2025 meeting.

conservation-boardplanningzoningchick-fil-aeastview-mallvictor-ny
✓ Decided: Conservation Board reviews Chick-fil-A proposal at Eastview Mall

The Conservation Board reviewed the Chick-fil-A site plan (06-SP-2025) for a 5,331-square-foot restaurant with a double-lane drive-thru at Eastview Mall. No formal decision was made; the board discussed details and requested that landscape architect comments be addressed. The minutes for March 4, 2025, were approved.

Thu Mar 13, 2025

Boughton Park Commission Agendas & Minutes

Boughton Park Commission discusses tree removal and replacement plans

The Boughton Park Commission will meet on March 13, 2025, to approve minutes from February, review the treasurer's report and bills, and discuss tree removal progress, tree and shrub replacement planning, and trail maintenance. A new member from East Bloomfield, Rokhsanna Sadeghi, will be welcomed.

parkscommissiontreestrailsmaintenance
✓ Decided: Boughton Park Commission discusses Eagle Scout bridge project, approves minutes and treasurer's report

The Boughton Park Commission met on March 13, 2025, and discussed a proposed Eagle Scout bridge project for a muddy area near the boat launch, with details on materials, permitting, and funding to be finalized. The commission approved the February 13th minutes and the treasurer's report, including paying bills. No formal decisions were made on the bridge project or tree replacement, which remain under discussion.

Tue Mar 11, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to review 24-lot Timberview Estate subdivision on Cline Road

The Board will hold public hearings for three minor site plans: two pole barns and a site modification for a chimney business. A preliminary application for a 24-lot single-family subdivision on Cline Road will be discussed. Two items (a 123-room hotel at Eastview Mall and an 8-lot subdivision on Blazey Road) have been removed until the March 25 meeting.

planning-boardpublic-hearingsubdivisionsite-planpole-barnhotelresidential-development
✓ Decided: Planning Board approves three site plans, advances 24-lot subdivision

The Victor Planning Board approved three site plan applications: a 60x40 pole barn at 6415 Bortle Road (3-0, 2 absent), a Four Winds Chimney site modification and special use permit at 770 Canning Parkway (4-0, 1 absent), and a 32x36 barn at 1075 Strong Road (4-0, 1 absent). The board also declared its intent to act as lead agency for the proposed 24-lot Timberview Estates subdivision on Cline Road, initiating a 30-day coordination period with involved agencies. Two applications (Element by Westin hotel and Nickoloff subdivision) were removed from the agenda.

Tue Mar 11, 2025

Planning Board After Meeting Reports

Hotel, subdivision proposals tabled to March 25 meeting

The Planning Board held public hearings and approved three minor site plans (pole barns and a chimney site modification). Two major applications—a 123-room Element by Westin hotel at Eastview Mall and the Nickoloff 8-lot subdivision—were removed from the agenda and rescheduled to the March 25 meeting. A preliminary application for the 24-lot Timberview Estate subdivision was advanced with lead agency designation approved.

planning-boardpublic-hearingsubdivisionhotel-developmentspecial-use-permitsite-planvictor-ny
Mon Mar 10, 2025

Town Board Draft Resolution Packets

Victor Town Board to vote on park Phase 2, new hires, and concert deals

The Victor Town Board will consider ten resolutions at its March 10, 2025 meeting, including appointments to the Parks Department, acceptance of a retirement, authorization for equipment purchases, four summer concert agreements with insurance waivers, and a key contract for Harlan Fisher Park Phase 2 improvements. A stormwater update and public comment are also scheduled. The board will also vote on an easement acquisition by the Monroe County Water Authority.

parkspersonnelcapital-improvementshighwaycontractseasementsummer-concerts
Mon Mar 10, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider contract for Harlan Fisher Park Phase 2 improvements

The Victor Town Board will hold a regular meeting on March 10, 2025, to discuss a stormwater update, appoint two motor equipment operators to the Parks Department, accept a retirement, authorize highway equipment purchases, and approve several agreements including a capital improvements contract for Harlan Fisher Park Phase 2. The board will also consider an easement acquisition by the Monroe County Water Authority at specific addresses on Pittsford Victor Road and Old Dutch Road.

town-boardappointmentsparkscapital-improvementseasementhighwaystormwater
✓ Decided: Victor Town Board approves $687,176 in bills, including three new highway trucks

The Victor Town Board approved Manifest No. 5, paying $687,176.07 in bills, which includes the purchase of three highway trucks for $462,763.20. The board also made several appointments, including Trevor Knapp and Annalyse Sullivan to Motor Equipment Operator positions in the Parks Department, and accepted the retirement of Victor Gaspar. Additionally, the board authorized agreements for four Summer Concert in the Park performers and granted them waivers for liability insurance certificates.

Mon Mar 10, 2025

Town Board After Meeting Reports

Town Board approves Harlan Fisher Park improvements and water authority easement

The Victor Town Board approved several personnel appointments and equipment purchases. The board authorized agreements for park performances and capital improvements at Harlan Fisher Park. An easement for the Monroe County Water Authority was also approved.

parksinfrastructurepersonnelwater-authorityhighway
Tue Mar 4, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Review of Timberview Estate Subdivision, 24 homes on Cline Road

The Conservation Board is reviewing the Timberview Estate Subdivision application for 24 single-family home lots on a 74.5-acre parcel off Cline Road. The applicant seeks approval for 20 lots on a dedicated town road and 4 lots on a private drive. The board will also vote on minutes from February 18, 2025.

conservation-boardsubdivisionhousingland-usemeeting-minutes
✓ Decided: Conservation Board reviews Timberview Estate subdivision, recommends site-specific easements

The Conservation Board reviewed the Timberview Estate Subdivision proposal for 24 single-family homes on Cline Road, offering comments on conservation easement layout and language. The board recommended site-specific easement language and straight boundary lines for clear marking, and agreed to join the Planning Board on a future site walk. The board also approved the minutes from the January 7, 2025 meeting.

Mon Mar 3, 2025

Zoning Board of Appeals After Meeting Reports

ZBA approves Four Winds Chimney interpretation in light industrial zone

This is a results report from the March 3, 2025 Zoning Board of Appeals meeting. The board approved minutes from December 2, 2024 and granted an interpretation allowing Four Winds Chimney at 770 Canning Parkway to operate within Light Industrial Zoning District regulations. A public hearing for an area variance at Champion Reserve Townhomes (552 Championship Dr) was tabled to April 7, 2025.

zoningzoning-board-of-appealsinterpretationvariancetownhomeslight-industrialchimney
Mon Mar 3, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

ZBA to decide if Four Winds Chimney business fits Light Industrial zoning

The Victor Zoning Board of Appeals will hold a public hearing and decide on an interpretation request from Four Winds Chimney to determine if its business complies with Light Industrial Zoning District regulations. The board will also consider an area variance for a storage shed at Champion Reserve Townhomes. Minutes from the December 2, 2024 meeting will be approved.

zoningpublic-hearingvarianceindustrialbusiness-uselight-industrialinterpretation
✓ Decided: ZBA upholds zoning interpretation allowing Four Winds Chimney in light industrial district

The Zoning Board of Appeals upheld a zoning interpretation that allows Four Winds Chimney, a general contractor and service business, to operate in the Light Industrial Zoning District at 770 Canning Parkway. The board found the use fits the district's character and is not prohibited, clearing the way for a special use permit review by the Planning Board. The board also tabled a variance request for a storage shed at Champion Reserve Townhomes to allow code enforcement to explore alternative locations.

Wed Feb 26, 2025

Town Board Draft Resolution Packets

Town Board to vote on rezoning 14.2 acres for Lehigh Place Planned Development District

The Victor Town Board will hold a public hearing and consider adopting Local Law 3-2025 to rezone 14.2 acres from Light Industrial to a Planned Development District (Lehigh Place) on Victor Heights Parkway. Other decisions include authorizing purchase of two highway trucks totaling $275,329, amending snow/ice contracts with NYSDOT for additional $31,317, and approving park improvements such as trail safety beacons and restroom upgrades.

zoningplanned-development-districtpublic-hearinghighwaytruck-purchasessnow-and-iceparks-and-recreationtrail-safety
Wed Feb 26, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider new Lehigh Place Planned Development District

The Victor Town Board will hold a public hearing and vote on a local law to rezone land and create the Lehigh Place Planned Development District. The board will also approve several highway and parks purchases, including two new trucks and pedestrian safety equipment for the Auburn Trail.

zoningpublic-hearinghighwayparkspurchasestraffic-safety
✓ Decided: Town Board adopts solar code update and 156-unit apartment rezoning

The Victor Town Board adopted Local Law 2-2025, updating the solar code and ending the solar moratorium, and Local Law 3-2025, rezoning 14.2 acres at 200 Victor Heights Parkway to allow a 156-unit apartment complex (Lehigh Place PDD), with Councilmember Ogra voting against the rezoning. The board also approved several highway purchases and other administrative items.

Wed Feb 26, 2025

Town Board After Meeting Reports

Town Board adopts Local Law 3-2025 creating Lehigh Place Planned Development District

The Victor Town Board approved several resolutions including the adoption of Local Law 3-2025 to amend the official zoning map and establish the Lehigh Place Planned Development District. The board also authorized purchases of highway trucks, upgrades to park facilities, and pedestrian safety improvements. A proclamation for Maureen Bills was presented, and the Victor-Farmington Ambulance gave a presentation.

zoningplanned-development-districthighwaytruck-purchaseparkspedestrian-safetyaccessibilitylocal-law
Tue Feb 25, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning Board to consider 123-room Element by Westin hotel at Eastview Mall

The Planning Board will hold public hearings and consider several site plan and subdivision applications, including a 123-room hotel at Eastview Mall, a 59-unit townhome development on Rawson Road, and various modifications. One preliminary application (Nickoloff Subdivision) has been removed until the March 11 meeting. All items are subject to public comment.

planning-boardpublic-hearingsubdivisionhotelsite-plantownhomeszoningroads
✓ Decided: Planning Board approves 59-townhome Bluestone Trail subdivision

The board approved the preliminary subdivision for the 59-unit Bluestone Trail townhome project at 7200 Rawson Road, issuing a negative declaration under SEQRA. It also approved a minor subdivision at the same address, a site plan for a looped driveway at LSI Solutions, and tabled a pole barn application pending more drainage details. The hotel project at Eastview Mall was discussed but not voted on.

Tue Feb 25, 2025

Planning Board After Meeting Reports

Planning Board approves 59-townhome Bluestone Trail subdivision

The Victor Planning Board approved several applications at its February 25 meeting, including a preliminary subdivision for 59 townhomes on Rawson Road and a minor subdivision at 7200 Rawson Road. The board tabled three items, including a proposed 123-room hotel at Eastview Mall, until March 11. One preliminary application for a subdivision on Blazey Road was removed until the next meeting.

planning-boardsubdivisiontownhomeshotelcommercial-developmentpublic-hearingvictor-ny
Mon Feb 24, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Parks and Recreation Committee to discuss signage and pathway improvements

The Parks and Recreation Citizens’ Advisory Committee will meet to review the Director's report and the status of the Recreation Center. The body will also discuss VHT signage and pathway improvements and address committee membership vacancies.

parksrecreationinfrastructurecommittee-membership
✓ Decided: Village Board funds Harlan Fisher Park Phase II improvements in 2025-26 budget

The Parks and Recreation Citizens' Advisory Committee met on February 24, 2025, and tabled approval of January meeting minutes due to lack of quorum. The Director reported that the Village Board has agreed to fund Phase II improvements to Harlan Fisher Park, including a new entry drive, 22-vehicle parking area, and sidewalk connections, with construction planned to begin in June. The committee also discussed ongoing trail signage, a vacant co-chair position, and upcoming hiring and bidding processes.

Tue Feb 18, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board to review Elliot Pole Barn on Bortle Road

The Victor Conservation Board will review a proposal to construct a 60x40 foot pole barn at 6415 Bortle Road on a 4.27-acre parcel. The board will also consider approval of the January 7, 2025 meeting minutes.

conservation-boardpole-barnsite-plan-reviewbortle-road
✓ Decided: Conservation Board reviews Elliot Pole Barn proposal, no decision made

The Conservation Board reviewed the Elliot Pole Barn application (04-SP-2025) for a 60x40 pole barn on Bortle Road but took no action, as the applicant was absent. The board discussed concerns about the Conservation Easement, drainage, and septic proximity, suggesting the applicant review easement language. The board approved the January 7, 2025 meeting minutes.

Thu Feb 13, 2025

Boughton Park Commission Agendas & Minutes

Boughton Park Commission reviews tree removal estimates

The Boughton Park Commission is meeting to approve previous minutes and the treasurer's report. The body will discuss a scout project, park walk review, and tree removal estimates from Holtz Forest & Shade Tree, LLC.

parkstree-removalmaintenanceappointments
✓ Decided: Boughton Park Commission approves $8,100 tree removal

The commission approved $8,100 in forestry quotes for removing dead and hazardous trees, funded from the forestry budget and possibly capital reserves. They also moved $16,771.13 in unspent budget funds into the capital reserve. The treasurer will address unresolved QuickBooks accounting issues. A wetlands jurisdictional determination was submitted, and a new member will be appointed.

Tue Feb 11, 2025

Planning Board Agendas, Minutes & YouTube Videos

Public hearing for short-term rental renewal, plus subdivision and pole barn proposals

The Victor Planning Board will hold a public hearing on a three-year renewal of a short-term rental permit at 6562 Break of Day. They will also acknowledge a complete sketch application for a 3-lot subdivision on Aldridge Road and review a site plan for a personal-use pole barn at 250 Blazey Road. Two items—a hotel project at Eastview Mall and an 8-lot subdivision on Blazey Road—have been removed to the February 25 meeting.

planning-boardpublic-hearingshort-term-rentalsubdivisionsite-planzoningvictor-ny
✓ Decided: Planning Board approves three applications, advances Aldridge Road subdivision

The Victor Planning Board approved a three-year renewal for a short-term rental at 6562 Break of Day, approved a 2,200-square-foot pole barn at 250 Blazey Road, and acknowledged a complete sketch plan for a three-lot subdivision on Aldridge Road. All votes were unanimous (5-0). The board also scheduled public hearings for three other projects.

Tue Feb 11, 2025

Planning Board After Meeting Reports

Planning Board considers subdivision and rental permits

The Planning Board is reviewing a request to acknowledge a complete application for a new subdivision on Aldridge Road. The board is also considering a short-term rental renewal and a pole barn construction project.

zoningsubdivisionsshort-term-rentalsconstruction
Mon Feb 10, 2025

Town Board Draft Resolution Packets

Town board to vote on updated solar code, ending moratorium on large-scale solar projects

The Victor Town Board will hold a public hearing on extending the Stone Brook Subdivision drainage improvement area and consider a local law to adopt large-scale solar code updates, repeal Chapter 103 Energy Systems, and end the temporary land use moratorium. Other resolutions include amending the 2024 budget for ARPA expenditures, authorizing bids for phase one of the Cobblestone Creek road rehabilitation, purchasing a backhoe and a tractor, and adjusting the fee schedule for solar and sewer fees.

solar-energyzoningpublic-hearingbudgetroadsequipment-purchasedrainage
Mon Feb 10, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board to consider solar code updates and drainage improvements

The Town Board will hold a public hearing regarding the Stone Brook Drainage Improvement Area Extension. Members will consider updates to the large-scale solar code and the purchase of new highway equipment.

zoningsolardrainagehighwaysbudget
✓ Decided: Town Board adopts Local Law 2-2025 updating solar code, ending moratorium

The Victor Town Board adopted Local Law 2-2025, which repeals Chapter 103 (Energy Systems) and amends Chapter 211 (Zoning) to regulate large-scale solar photovoltaic systems, and terminated the temporary moratorium on such systems. The board also approved a $7.32 million bill manifest, authorized bids for road rehabilitation, approved equipment purchases, and extended the Stone Brook Drainage Improvement Area. All resolutions passed 4-0.

Mon Feb 10, 2025

Town Board After Meeting Reports

Victor Town Board adopts solar code updates, ends energy moratorium

At its February 10, 2025 regular meeting, the Victor Town Board approved several resolutions including adoption of Local Law 2-2025 updating large-scale solar regulations and ending the temporary moratorium on such systems. The board also authorized a road rehabilitation project in Cobblestone Creek, approved equipment purchases, and extended a drainage improvement area.

zoningsolarenergyroadsequipmentfeeswater-authoritydrainage
Tue Feb 4, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board February 4 meeting cancelled

The Conservation Board meeting scheduled for February 4, 2025 has been cancelled. No projects are to be reviewed.

cancelledconservation-boardtown-of-victor
Mon Feb 3, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board of Appeals meeting on Feb 3 cancelled

The February 3, 2025 meeting of the Victor Zoning Board of Appeals has been cancelled. The sole agenda item, a public hearing for Champion Reserve Townhomes seeking an area variance for an existing shed, has been tabled to a future date.

zoning-board-of-appealsmeeting-cancelledarea-variancechampion-reserve-townhomes
Tue Jan 28, 2025

Planning Board Agendas, Minutes & YouTube Videos

Stover subdivision review and public hearings for Crown Castle and PMD site plan

The Victor Planning Board will hold public hearings on Crown Castle's antenna replacement at 914 Brownsville Road and a PMD site plan modification at 727 Rowley Road for unauthorized changes including a driveway, roof drains, and guard rail. They will also consider acknowledging a complete application for the Stover subdivision, which would split an 11.6-acre parcel on Benson Road into three residential lots. The Element by Westin hotel (123 rooms) and the Nickoloff subdivision (8 lots on Blazey Road) are tabled until February 11.

planning-boardpublic-hearingsubdivisionwireless-communicationsite-plan-modificationhoteltabled
✓ Decided: Planning Board approves Crown Castle antenna swap, PMD site changes, Stover subdivision

The Town of Victor Planning Board approved three applications: Crown Castle/T-Mobile antenna replacement at 914 Brownsville Road, a site plan modification for Progressive Machine & Design at 727 Rowley Road, and the Stover Subdivision on Benson Road. The board also tabled the Element by Westin hotel application and removed the Nickoloff Subdivision from the agenda until the next meeting.

Tue Jan 28, 2025

Planning Board After Meeting Reports

Planning Board tables 123-room hotel proposal at Eastview Mall

The Victor Planning Board approved a cell tower antenna replacement on Brownsville Road, a site plan modification on Rowley Road, and a three-lot subdivision on Benson Road. It tabled a 123-room hotel at Eastview Mall and an eight-lot subdivision on Blazey Road until February 11. The meeting also included approvals of minutes and correspondence.

planning-boardpublic-hearingsubdivisionhotelcell-towersite-planvictor-ny
Mon Jan 27, 2025

Town Board Agendas, Minutes & YouTube Videos

Public hearing on overriding 2026 tax levy limit for Victor

The Town Board will hold a public hearing to consider overriding the 2026 tax levy limit, followed by a resolution to adopt a local law authorizing the override. The board will also vote on resolutions including budget transfers, purchase of two freightliner trucks, agreements for recreation instructors, and environmental reviews for a solar law and a planned development district. Additionally, there is an executive session to discuss potential real property acquisition, sale, or lease.

budgettax-levypublic-hearinghighwayparks-and-recreationzoningsolarenvironmental-review
✓ Decided: Victor adopts local law to override 2026 state tax levy cap

The Victor Town Board adopted Local Law No. 1-2025 to override the NYS tax levy limit for 2026, a safeguard that allows the town to exceed the 2% tax cap if needed. The board also approved funding for Boughton Park, two new highway trucks, and several recreation instructor agreements. A negative declaration was issued for a proposed solar law and the Lehigh Place Planned Development District.

Mon Jan 27, 2025

Town Board After Meeting Reports

Town of Victor approves 2026 tax levy override and new truck purchases

The Victor Town Board adopted a local law to override the 2026 tax levy limit following a public hearing. The board also approved the purchase of two 2025 Freightliner trucks, piggybacking on Onondaga County contracts, and declared older 2015 trucks surplus. Additionally, the board approved several instructor agreements for Parks & Recreation programs and set a public hearing for a drainage improvement area.

taxesbudgethighwayparks-recreationzoningenvironment
Mon Jan 27, 2025

Parks & Rec Citizens' Advisory Committee Agendas & Minutes

Committee addresses leadership gap for February meeting and confirms 2025 schedule

The Parks and Recreation Citizen’s Advisory Committee met to review December minutes and receive reports on recreation center updates. The agenda noted that the VHT signage and pathway improvements item was removed due to a lack of updates. The committee discussed the need for a co-chair to lead the February meeting or move the date, and confirmed that 2025 meetings will be held on the fourth Monday of each month at 5pm.

parksrecreationmeetingsgovernance
✓ Decided: Parks committee approves December minutes, reviews 2024 revenue over $625K

The Parks and Recreation Citizens' Advisory Committee approved the December meeting minutes with no changes and reviewed the Director's report. No formal votes were taken on new business; the meeting focused on updates, including 2024 revenues exceeding $625,000, new memorial benches, and upcoming events. The committee also discussed scheduling for 2025 meetings and noted no volunteers for the co-chair position.

Tue Jan 21, 2025

Zoning Board of Appeals Agendas, Minutes & YouTube Videos

Zoning Board of Appeals meeting cancelled

The January 21, 2025 Zoning Board of Appeals meeting was cancelled. No items were discussed or decided. One public hearing (Champion Reserve Townhomes area variance) was tabled to February 3, 2025.

zoningmeeting-cancelledarea-variancechampion-reserve
Tue Jan 14, 2025

Planning Board Agendas, Minutes & YouTube Videos

Planning board to hold public hearing on new 123-room hotel at Eastview Mall

The board will hold a public hearing on a proposal to build a 4-story, 23,580 sq ft hotel with 123 rooms on the west side of Eastview Mall. It will also consider a field change for mechanical equipment at 7321 State Route 251 and a site plan modification for outdoor seating at Aladdin's Natural Eatery. Two items (Crown Castle/T-Mobile antenna replacement and Nickoloff Subdivision) have been removed until the January 28 meeting.

planning-boardpublic-hearinghotelcommercialsite-planresidentialwireless
✓ Decided: Planning Board approves Lite Coms field change, Verizon antenna upgrade, Aladdin's patio

The Town of Victor Planning Board approved three applications at its January 14, 2025 meeting. It approved a field change for Lite Coms to relocate exterior mechanical equipment at 7321 State Route 251 (4-0, 1 absent), approved Verizon Wireless's antenna upgrade at 200 Cobblestone Court (5-0), and approved Aladdin's Natural Eatery's site plan modification for 12 outdoor seats at 8053 State Route 96 (5-0). The board also approved the October 8, 2024 meeting minutes (4-0, 1 absent). A public hearing for the proposed 123-room Element by Westin hotel at Eastview Mall was held but not closed, pending additional information.

Tue Jan 14, 2025

Planning Board After Meeting Reports

Planning Board tables 123-room hotel at Eastview Mall; approves several site plans

The Victor Planning Board approved a field change for a light industrial building, a wireless antenna upgrade, and a site plan modification for outdoor seating at Aladdin's Natural Eatery. A 4-story, 123-room Element by Westin hotel at Eastview Mall was tabled to a future meeting. A proposed 8-lot subdivision on Blazey Road and a wireless facility antenna replacement were removed to the January 28 meeting.

planning-boardcommercial-developmenthotelwireless-facilitysubdivisionsite-plan-modificationpublic-hearingvictor-ny
Thu Jan 9, 2025

Boughton Park Commission Agendas & Minutes

Boughton Park Commission to review payroll estimates and officer nominations

The Boughton Park Commission will approve December 2024 minutes, review the treasurer's report and pay bills, and discuss several operational items including officer nominations, payroll estimates, a bathroom maintenance pumping estimate, and a subscription for meeting notes.

parkscommissionbudgetmaintenancepayrollappointments
✓ Decided: Boughton Park Commission approves 2025 officer nominations and budgets

The Boughton Park Commission approved the December minutes and treasurer's report, including a $203 payment to Mobile Graphics for signs. They nominated Claudia Walsh, Christian Culbertson, and Joe Andrijenko for officer positions. The board approved up to $200 for a note-taking app and up to $425 for a hydraulic cylinder for the wagon. No changes were made to the payroll company.

Tue Jan 7, 2025

Conservation Board Agendas, Minutes & YouTube Videos

Conservation Board reviews proposal for 123-room hotel at Eastview Mall

The Conservation Board will review two projects: a new 4-story, 123-room Element by Westin hotel on the west side of Eastview Mall, and a subdivision of an 11.6-acre parcel on Benson Road into three residential lots. The board will also approve minutes from the previous meeting.

zoningdevelopmenthotelsubdivisionconservation-board
✓ Decided: Conservation Board supports Eastview Mall hotel, schedules site walk for subdivision

The board reviewed two projects: the proposed 123-room Element by Westin hotel at Eastview Mall and a three-lot subdivision on Benson Road. It acknowledged the hotel application as complete and supported it with no further comments. For the subdivision, the board suggested straightening conservation easement lines and scheduling a site walk. No formal votes were taken on either project.

Mon Jan 6, 2025

Town Board Draft Resolution Packets

Victor Town Board sets 2025 meeting schedule, appoints constable, approves investment limits

This is the annual organizational meeting where the Town Board adopts routine resolutions to govern the coming year, including setting meeting nights, designating official newspaper and depositories, appointing a town constable at $30.89/hour, and approving investment limits up to $20 million with local banks.

organizational-meetingappointmentsfinancepersonneladministrationholidaysinsurance
Mon Jan 6, 2025

Town Board Agendas, Minutes & YouTube Videos

Town Board holds public hearing on Lehigh Place PDD and considers tax cap override

The Victor Town Board meets for its organizational meeting to set annual procedures and appointments, followed immediately by a regular meeting. The regular meeting includes a public hearing on the Lehigh Place Planned Development District, consideration of a local law to override the state tax levy limit for 2025, and adoption of the 2025 fee schedule. Several equipment purchases for the Highway and Parks departments are also on the agenda, along with routine approvals and appointments.

organizational-meetingzoningpublic-hearingbudgettax-levyhighwayequipment-purchasesparks
✓ Decided: Victor Town Board sets 2025 meeting schedule, adopts annual resolutions

The Victor Town Board held its organizational meeting, adopting routine annual resolutions including meeting nights, rules of order, official newspaper, petty cash accounts, and liaison assignments. The board also set a public hearing for a proposed local law to override the state tax levy limit for 2026. No substantive project approvals or denials occurred; the Lehigh Place PDD rezoning was discussed but only the public hearing was closed.

Mon Jan 6, 2025

Town Board After Meeting Reports

Victor Town Board approves 2025 fee schedule and sets tax levy limit hearing

The Town Board held an organizational meeting to approve administrative appointments, financial limits, and the 2025 fee schedule. The board also scheduled a public hearing for January 27, 2025, regarding Local Law No. 1 - 2025 to override the NY Tax Levy Limit.

budgettaxesfeeshighwayparks-and-recreationadministration