The Boring PartsFederalLocal · USLocal · Canada
Athens, GA

Athens public meetings in 2025

308 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Wed Dec 17, 2025

Historic Preservation Commission

Public hearing to designate 293 Gran Ellen Drive as a historic landmark

The Historic Preservation Commission will adopt minutes from the November 19 meetings, review several renovation and demolition requests for properties in historic districts, and hold a public hearing to consider designating 293 Gran Ellen Drive as a local historic landmark and adopting design guidelines for it. The commission will also receive updates on its strategic plan and committee reports, and conduct conceptual design reviews for two other properties.

historic-preservationzoningdesignationhearingsplanningdesign-review
✓ Decided: HPC unanimously approved landmark designation for 293 Gran Ellen Dr

The Historic Preservation Commission approved four Certificate of Appropriateness applications—245 Buena Vista Ave, 850 Boulevard, 283 E. Clayton St, and 163 Mell St—each with staff‑recommended conditions, all by a 6‑0 vote. The commission also recommended the designation of 293 Gran Ellen Dr as a local historic landmark and the adoption of its design guidelines, also by a 6‑0 vote. No decisions were made on the conceptual design reviews for 279 Meigs St or 232 Satula Ave. The meeting was adjourned at 8:30 PM.

Wed Dec 17, 2025

Human Relations Commission

Human Relations Commission will review its bylaws for conflict‑of‑interest provisions

The commission will accept the October 22 2025 meeting minutes and hear updates from the Chair and People & Belonging Department. It will review a handout from previous business and discuss a proposed amendment to its bylaws concerning conflicts of interest. The body will also consider plans for a Unity in Community event, participation in MLK activities, and set the 2026 meeting schedule.

governancebylawscommunity-eventspublic-commentmeetings
✓ Decided: Committee approved moving forward with Menstrual project and set next meeting date

The Human Relations Commission accepted the prior minutes and voted to shift Chairperson updates later in the agenda. It approved the recommendation to proceed with the Menstrual project pilot and scheduled the next meeting for November 19, 2025. The commission also assigned Cory and Annesia to order holiday parade supplies on October 24, 2025 and will request the communications department’s help with marketing and social‑media updates.

Tue Dec 16, 2025

Mayor & Commission Meetings

Mayor and Commission to set 2026 election qualifying fees

The Unified Government of Athens-Clarke County will consider establishing qualifying fees for the May 19, 2026, General Assembly. The body will also discuss funding requests for two local service organizations.

electionsfood-securitysenior-servicesfunding
✓ Decided: Commission approves 2026 qualifying fees and $100K in shutdown aid

The Mayor and Commission held a special called session and unanimously approved three items: setting qualifying fees for the 2026 General Primary election, and awarding $50,000 each from contingency funds to the Food Bank of Northeast Georgia and the Athens Community Council on Aging for Meals on Wheels, both to address continued need from the federal government shutdown. All motions passed unanimously.

Tue Dec 16, 2025

TAD Advisory Committee - Mall Area

Committee will decide the 2026 meeting schedule

The Mall Area TAD Advisory Committee will consider setting the meeting dates for 2026. It will also discuss committee membership based on attendance records and future commitments. Additionally, the committee will review capital project partnership priorities for public infrastructure.

tadmeeting-schedulecommittee-membershipinfrastructurepublic-projects
Tue Dec 16, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Committee to set 2026 meeting schedule

The East Downtown Tax Allocation District Advisory Committee will meet to approve minutes, review staff reports on ACCGov projects, and discuss the 2026 meeting schedule and capital project partnerships.

tadsplanninginfrastructuremeetingsbudget
✓ Decided: East Downtown TAD committee sets 2026 monthly meeting schedule

The East Downtown TAD Advisory Committee approved its agenda and prior meeting minutes, and set its 2026 meeting schedule to continue monthly on the third Tuesday. Staff reported early discussions on using TAD funds for bus shelters at Gressom Street, the Chicopee complex, and North Peter Street, and the committee discussed a potential visioning session for the TAD area. No formal funding decisions were made.

Tue Dec 16, 2025

Mayor & Commission Meetings

Mayor and Commission to consider funding for food and senior services

The Mayor and Commission will discuss supplemental funding for the Food Bank of Northeast Georgia and the Athens Community Council on Aging's Meals on Wheels Program. The body will also consider establishing qualifying fees for the May 19, 2026, General Primary election.

budgetelectionsfood-securitysenior-servicesreal-estate
✓ Decided: Agenda setting session held; no votes taken

The Mayor and Commission held an agenda setting session on December 16, 2025, to discuss 13 items, including grants, rezoning requests, a sewer project, a development agreement, and a bridge naming. No votes were taken during the session; the meeting was adjourned at 8:46 p.m.

Tue Dec 16, 2025

Mayor & Commission Meetings

Mayor and Commission to discuss real estate in executive session

The Unified Government of Athens-Clarke County has called a special session for December 16, 2025. The purpose of the meeting is to enter an executive session to discuss the acquisition or disposal of real estate.

real-estategovernment-administration
Mon Dec 15, 2025

Vision Committee

Vision Committee reviews FY27 CDBG, housing counseling and CPP grant process

The Vision Committee will discuss and vote on revisions to its bylaws and elect both interim and regular officers. It will also review the next steps for the FY27 Community Development Block Grant, housing counseling, and CPP grants, including TakeAim training, conflict‑of‑interest considerations, and the opening of Zoom Grant applications with a review deadline of January 20, 2026. The meeting will conclude with scheduling the next session.

governancegrantshousingcdbgelections
Mon Dec 15, 2025

TAD Advisory Committee - Newton Bridge Area

Committee will set the 2026 meeting schedule, skipping Jan 19 holiday

The Newton Bridge Road TAD Advisory Committee will approve the 2026 meeting calendar, noting the January 19 holiday skip. Members will discuss attendance‑based committee composition and future commitments. The group will consider next steps for improvements at the Vincent Drive and Newton Bridge Road intersection. They will also review capital project partnership options and public infrastructure priorities.

meeting-schedulecommitteeinfrastructuretransportationplanning
✓ Decided: Newton Bridge TAD Committee unanimously approved agenda, minutes and staff request

The committee unanimously approved the meeting agenda and the prior meeting minutes. It also unanimously authorized ACCGov staff member Daniel Young to forward a request to the Mayor regarding replacement of non‑participating committee members. An agenda amendment to discuss creating an escrow account for the TAD area was also approved unanimously.

Mon Dec 15, 2025

Mayor & Commission Meetings

Committee to develop ordinance clarifying public right-of-way definition

The Right-of-Way Use Committee will approve its agenda and the November 17, 2025 minutes, hear brief public comments, and begin work on drafting ordinance language that clarifies the definition and allowable uses of the public right-of-way. The draft is to be presented to the full Mayor and Commission no later than the November voting meeting.

right-of-wayordinancepublic-inputcommissionmeeting
Mon Dec 15, 2025

Mayor & Commission Meetings

Government Operations Committee to discuss employee surveys and leasing policy

The Government Operations Committee is meeting to review the Community Benefits Agreement portion of the Leasing Policy and employee engagement opportunities. The committee will also consider future reviews of the Short Term Rental Ordinance and renter protections.

leasing-policyemployee-engagementshort-term-rentalsrenter-protectionsgovernment-operations
✓ Decided: Committee approved revised nonprofit leasing policy with tiered rates

The Government Operations Committee approved all changes to the nonprofit leasing framework, including tiered lease rates, reduced public‑access hour requirements, and removal of residency‑percentage tracking. A motion to keep Tax Allocation Districts separate was also passed unanimously. The meeting adjourned after unanimous approval of the October 20 minutes and the adjournment motion.

Thu Dec 11, 2025

Planning Commission

Rezone of 293 Hoyt Street from P to C‑D district

The Athens-Clarke County Planning Commission will consider a rezoning request for 293 Hoyt Street, changing its designation from P to C‑D. The commission will also hear public comments on a proposed amendment to Title IX of the Code of Ordinances to regulate data centers. In addition, the meeting includes routine items such as staff reports, approval of the November 6, 2025 meeting minutes, and reports from the chair and planning director.

zoningdata-centersplanningminutespublic-hearing
Wed Dec 10, 2025

Hearings Board

Board will consider two sign and building‑size variance requests

The Athens-Clarke County Hearings Board will hear two variance applications. One seeks to eliminate the five‑foot side setback for a ground sign at 1005 Hull Road (C‑G zoning). The other asks to raise the accessory‑building limit from 800 SF to 1,032 SF at 160 Gran Ellen Drive (RS‑15 zoning). A third variance for parking expansion at 345 W. Hancock Avenue was withdrawn before the meeting.

zoningvarianceplanningcommercialresidential
Tue Dec 9, 2025

Mayor & Commission Meetings

Discussion of TSPLOST 2026 renewal referendum and project funding

The Mayor & Commission work session will review the TSPLOST 2026 renewal referendum, including the intergovernmental agreement, minimum distribution formula, and a list of Winterville projects. The agenda notes that all reports are draft and no final action will be taken at this session. The body will consider a resolution deadline of Feb 3 and a May referendum for voter approval.

tsplostbudgetinfrastructuretransportationdevelopment
✓ Decided: No decisions were made at the Athens work session on Dec 9, 2025

The Mayor and Commission held a work session with the cities of Bogart and Winterville. The only item discussed was the TSPLOST 2026 presentation by Capital Projects Director Josh Hawkins. No votes, approvals, or other actions were recorded.

Tue Dec 9, 2025

TAD Advisory Committee - Lexington Road

Committee will discuss membership criteria and capital project priorities

The Lexington Road TAD Advisory Committee will review updates on ACCGov projects in the district. It will discuss committee membership based on attendance records and future commitments. The committee will also discuss capital project partnerships and prioritize public infrastructure goals.

tax-allocation-districtcommitteeinfrastructuremembershipcapital-projects
Tue Dec 9, 2025

Athens in Motion Commission

Athens in Motion Commission reviews transit and pedestrian safety updates

The commission is meeting to receive staff updates on transportation planning and safety initiatives. The body will discuss the CDO Plan Revision and the Safe Streets for All Plan. The meeting also includes a year-in-review and reports from corridor and organizational committees.

transportationpedestrian-safetybikingtransiturban-planning
✓ Decided: Commission unanimously approved agenda and minutes, then adjourned

The commission unanimously approved the meeting agenda. The October meeting minutes were also approved unanimously. A motion to adjourn the meeting was moved, seconded, and adopted. The meeting adjourned at 6:21 pm.

Thu Dec 4, 2025

Mayor & Commission Meetings

Review of noise ordinance updates for Agricultural Residential and Downtown areas

The Legislative Review Committee will approve the minutes from the October 2, 2025 meeting and allow public input from residents. The committee will review and discuss updates to the noise ordinance in the Agricultural Residential zone and the Commercial Downtown district, including possible objective volume measures. They will also confirm a quorum for the next meeting. The noise ordinance review was assigned to the committee by Mayor Girtz on September 3, 2024.

noise-ordinancepublic-inputminutes-approvalquorumzoning
✓ Decided: Legislative Review Committee approved minutes and adjourned meeting

The committee unanimously approved the October 2, 2025 meeting minutes. Members reviewed downtown noise‑complaint data and discussed possible updates to the noise ordinance. They requested the Attorney’s office to organize ordinance language and enforcement options for review at the next meeting. The meeting was adjourned unanimously at 2:16 p.m.

Thu Dec 4, 2025

Audit Committee

Audit Committee reviews FY26 status and prepares FY27 workplan

The Athens Audit Committee will review and approve the minutes from the October 2, 2025 meeting. It will discuss the status of the FY26 workplan, including audits and follow‑ups. The committee will begin preparation of the FY27 workplan and receive an update from the internal auditor. The next meeting is scheduled for January 1, 2026.

auditbudgetingplanninggovernance
✓ Decided: Audit Committee unanimously approved the FY26 Organizational Audit

The committee approved the FY26 Organizational Audit with a unanimous vote. It also approved the October 2, 2025 meeting minutes after correcting a scrivener’s error, again unanimously. The January meeting was cancelled by unanimous vote, and the meeting was adjourned.

Wed Dec 3, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Board will approve the Rushton Annual Audit and meeting minutes

The Joint Development Authority will consider approval of the meeting agenda. Directors will vote to approve the minutes from the November 5, 2025 regular meeting. The board will discuss the Rushton Annual Audit. The next regular meeting is set for February 4, 2026.

auditminutesagendagovernancemeeting-schedule
✓ Decided: JDA audit accepted unanimously by all directors

The board approved the draft agenda and the minutes from the November 5 meeting. The audit of the Joint Development Authority’s financial records was accepted without objection. All actions were approved unanimously by the directors present.

Tue Dec 2, 2025

Mayor & Commission Meetings

Commission to consider temporary moratorium on data centers

The Mayor and Commission will hold public hearings on several rezoning requests and special use permits. The body is also considering a temporary moratorium on data centers and the reallocation of ARPA funds for affordable housing.

zoningdata-centersaffordable-housingpoliceshort-term-rentalsinfrastructure
✓ Decided: Commission denied rezoning of 255 Smithonia Road for church use

The Athens‑Clarke County Commission approved a grant application and related budget amendment, adopted a tax foreclosure resolution, and designated Super Bowl Sunday for alcohol sales. It also approved a $1 million corridor planning contract, a sidewalk project, a sewer connection, and an ordinance allowing short‑term rentals. The rezoning request for 255 Smithonia Road was denied.

Wed Nov 19, 2025

Solid Waste Advisory Commission

Solid Waste Advisory Commission to discuss C&D Reuse Program

The Commission will review division reports from July and August and discuss the C&D Reuse Program with the Executive Director of Historic Athens. The body will also address by-law amendments and a grant update.

waste-managementrecyclinglandfillgrants
Wed Nov 19, 2025

Historic Preservation Commission

Historic Preservation Commission reviews six certificate of appropriateness requests

The commission will consider six Certificate of Appropriateness applications for properties in historic districts, including a retaining‑wall modification, a structure‑raising project, accessory‑building roofing, rear‑porch changes, and a conceptual addition and renovation. The meeting also includes adoption of minutes from October 15, 2025 and updates on the strategic plan and committee reports. Public comment is permitted for each agenda item.

historic-preservationzoningdesign-reviewcertificate-of-appropriatenessplanning
Wed Nov 19, 2025

Human Relations Commission

Commission votes on 2026 meeting schedule

The Human Relations Commission will accept the minutes from the October 22, 2025 meeting and review a handout. It will discuss updates from the chairperson and the People & Belonging department. New business includes a vote on the 2026 meeting schedule, a review of the commission bylaws, planning a Unity in the Community event, and a vote on participation in the MLK Parade. The meeting will also set the date for the December meeting.

meetingsschedulebylawscommunityparade
✓ Decided: Committee approved moving forward with the Menstrual Project pilot

The Human Relations Commission voted to move forward with the Menstrual Project recommendation. It also decided to shift the Housing Tour to Spring 2026 and to order supplies for the Holiday Parade on October 24, 2025. The commission will explore November community events such as turkey or jacket drives and will request assistance from the communications department for social‑media and marketing guidance. Previous meeting minutes were accepted and chairperson updates were moved later in the agenda.

Wed Nov 19, 2025

Arena District Steering Committee

Arena District Steering Committee to vote on Development Facilitator scope of work

The committee will review and vote on the scope of work for a Development Facilitator. Members will also review Q3 reports regarding EWBI and Classic Center Arena Bonds.

arena-districteconomic-developmentbondscontracts
✓ Decided: Committee unanimously approved Accenture's revised development facilitator scope

The steering committee approved the October 16 minutes unanimously. It also approved, without dissent, the amended scope of work for Accenture as the development facilitator. The agenda was not approved, the next meeting was set for Dec. 7, and the meeting was adjourned unanimously.

Tue Nov 18, 2025

Mayor & Commission Meetings

Commission to approve funding and agreements for College Square Pedestrian Plaza

The Athens‑Clarke County Mayor and Commission will consider a series of actions for the College Square Pedestrian Plaza project. Items include approving an intergovernmental agreement with the Athens Downtown Development Authority, amending the Parking Management Agreement for 20 more years, authorizing a construction easement, and allowing up to $1.5 million in supplemental TSPLOST funding. The commission will also confirm the selection of Sheridan Construction as the construction contractor for the plaza.

pedestrian-plazatsplostparking-managementconstruction-contractbudget
✓ Decided: Reallocation of ARPA funds for affordable housing approved

The Athens-Clarke County Commission adopted several grant acceptances and resolutions, including the Byrne Justice Assistance Grant and a resolution on judicial tax foreclosures. It approved multiple infrastructure projects such as the Vincent Drive sidewalk design, a private pump station at 1125 Prince Ave, and a raw water conveyance concept. The commission also approved the reallocation of recaptured ARPA funds for affordable housing projects. No vote tallies were recorded for these items.

Tue Nov 18, 2025

Mayor & Commission Meetings

Mayor and Commission to hold special session for executive session

The Unified Government of Athens-Clarke County is holding a special called session. The purpose of the meeting is to enter into an executive session to discuss pending or threatened litigation.

legal-affairsexecutive-sessiongovernment-administration
✓ Decided: Commission approved $1.5 M funding and agreements for College Square Pedestrian Plaza

The commission entered executive session to discuss pending litigation and then adjourned it. In a later session, commissioners suspended the rules to consider a single item and unanimously approved an intergovernmental agreement with the ADDA, an amendment to the Parking Management Agreement, a temporary construction easement, and up to $1,500,000 in TSPLOST funding for the College Square Pedestrian Plaza. The mayor and staff were authorized to execute all related documents.

Tue Nov 18, 2025

Mayor & Commission Meetings

Commission considers contractor and funding for College Square Pedestrian Plaza

The Mayor and Commission will consider the contractor selection and final IGA agreement for the College Square Pedestrian Plaza. This project aims to transform a section of College Avenue into a public pedestrian space using local and TSPLOST funds.

tsplostpedestrian-plazainfrastructurecollege-avenuetransportation
Tue Nov 18, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Committee to hold visioning session and discuss mayoral resolution

The East Downtown Tax Allocation District (TAD) Advisory Committee will meet to discuss the area's vision. The committee will also consider a resolution for the Mayor & Commission.

tax-allocation-districturban-planningeast-downtowneconomic-development
✓ Decided: Committee unanimously approved request for a joint TAD committees meeting before December

The East Downtown TAD Advisory Committee approved a motion to request a meeting with all TAD committees and leadership prior to the December Mayor and Commission meeting. The amended agenda and the September 16 minutes were also approved, each with three votes in favor and one abstention. No other new business was acted on, and the open discussion item was postponed due to time constraints.

Mon Nov 17, 2025

SPLOST Oversight Committee

Committee to decide on $300,000 solar installation at Fire Station #9

The SPLOST Oversight Committee will consider confirming the project concept for SPLOST 2020 Project 11 Sub‑Project #15, a solar photovoltaic system at Fire Station #9 with an estimated contract of $300,000. The committee will also review and approve the September 15, 2025 meeting minutes and examine monthly and expenditure reports for the SPLOST program. Additional items include discussion of Project 27 Facilities Equipment Systems Replacement (Sub‑project #5) and scheduling the next meeting.

spostrenewable-energysolarcapital-projectsbudgetpublic-safetyoversight
Mon Nov 17, 2025

Mayor & Commission Meetings

Committee reviews updates to Public Right-of-Way ordinance language

The Right-of-Way Use Committee is meeting to discuss ordinance language updates regarding the definition and allowable uses of the public right-of-way. The goal is to provide a common understanding for staff and the public to improve safety and reduce debris storage.

public-right-of-wayordinancepublic-safetyzoning
✓ Decided: Ad Hoc Committee moves ordinance updates to December agenda, approves agenda

The committee unanimously approved its agenda and the October 28, 2025 meeting minutes. A motion was passed to forward the revised ordinance language for inclusion in the December agenda‑setting meeting. The next meeting was scheduled for December 15, 2025 at 2:00 p.m. to review a homeless‑focused storage solution proposal. The meeting was then adjourned unanimously.

Mon Nov 17, 2025

TAD Advisory Committee - Newton Bridge Area

Committee to discuss Vincent Drive and Newton Bridge Road intersection improvements

The Newton Bridge Road TAD Advisory Committee will meet to review staff reports and project updates. The body will discuss next steps for intersection improvements at Vincent Drive and Newton Bridge Road.

roadsinfrastructuretransportationplanning
Mon Nov 17, 2025

TSPLOST Oversight Committee

Committee to confirm CY26 Pavement Maintenance Program road list

The TSPLOST 2023 Oversight Committee will review and approve the May 19, 2025 meeting minutes, examine monthly project and financial reports for 2018 and 2023, and consider action on Project 21 – the Calendar Year 2026 Pavement Management Program road list. The committee will decide whether the listed roadways and maintenance activities are consistent with the Initial Project Statement for Project 21. The meeting also includes other business and sets the next meeting for December 15, 2025.

pavementmaintenancetransportationbudgetgrantsoversight
Wed Nov 12, 2025

Deferred Compensation Board

Board reviews investment consultant report and deferred compensation plan updates

The Deferred Compensation Board will approve the minutes from the August 13, 2025 meeting and hear the Investment Consultant’s Report covering fund performance, plan charges, and potential fund changes. The board will discuss its own roles, term lengths for board representatives, and updates to the deferred compensation plan design. An annual performance review of the investment consultant and actuarial services will also be considered. Announcements include the GAPPT Annual Conference in March 2026 and a joint meeting with the Pension Board in January 2026.

deferred-compensationinvestmentboard-governanceannouncementsplan-design
✓ Decided: Board extended term limits for employee and resident participants to three years

The Deferred Compensation Board voted unanimously to adopt Option #2, extending term limits for both employee participants and the resident participant from two to three years. It also approved moving participants under age 39 into target‑date funds, changed the automatic enrollment period from 30 to 45 days, and authorized the chair to sign paperwork for a fund change. All motions were passed unanimously.

Wed Nov 12, 2025

Mayor & Commission Meetings

Fire department pay study and budget impact presented for discussion

The commission will review a draft classification and compensation study for the Athens‑Clarke County Fire Department, including projected salary and pension costs for the next five years and a proposed 20‑step pay plan. The meeting also includes an update on the Capital Projects Service Delivery Plan. No formal actions will be taken; the session is for information only.

fire-paycollective-bargainingbudgetcapital-projectsclassification-study
✓ Decided: Commission discussed fire pay plan and capital projects; no decisions taken

The meeting consisted of a work session where the commission reviewed the fire pay plan/collective bargaining and the capital projects service delivery plan. No votes, approvals, denials, or other formal actions were recorded. The session ended without any substantive decisions.

Wed Nov 12, 2025

Hearings Board

Hearings Board to consider yard setback variances for 150 Cloverhurst Terrace

The Athens-Clarke County Hearings Board will review a request from Jeremy Field for two variances at 150 Cloverhurst Terrace. The petitioner is seeking to reduce the required side and rear yard setbacks for a single-family residential property.

zoningvarianceresidential
Mon Nov 10, 2025

Athens Cultural Affairs Commission

ACAC discusses public art calls and upcoming gallery events

The Athens Cultural Affairs Commission will review minutes from the previous month and receive updates on completed training and upcoming art calls. The group will also discuss an exhibit at the Lyndon House and the Lantern Parade for 2026.

artspublic-artcouncilgallerypoet-laureateeducationoutreach
✓ Decided: Commission unanimously approved motion to adjourn the meeting

The Athens Cultural Affairs Commission held its regular monthly meeting and discussed upcoming events, staff updates, and community announcements. The only formal action taken was a unanimous vote to adjourn the meeting. The next regular meeting is scheduled for 1/12/2026.

Thu Nov 6, 2025

Planning Commission

Planning Commission will consider a text amendment to short‑term rental ordinance

The commission will introduce staff reports, approve the October 2, 2025 meeting minutes, and review MACORTS. It will consider two old‑business items: a master planned development petition for 2415 Jefferson Road and a rezoning and special‑use permit request for 115 McClung Road. New business includes three special‑use permit requests for 250 Little Street, rezoning requests for 1065‑1085 Hull Road and 255 Smithonia Road, and a text amendment to Title IX of the Code of Ordinances concerning short‑term rentals. The meeting will conclude with reports from the chair and planning director and miscellaneous announcements.

zoningdevelopmentshort-term-rentalsplanningland-use
✓ Decided: Commission approves rezoning of 115 McClung Road and related special‑use permit

The Planning Commission recommended approval of the rezoning of 115 McClung Road from Commercial‑General to Employment‑Office and also approved a special‑use permit for the same site, with votes of 6‑1 and 5‑2 respectively. It approved the 2415 Jefferson Road master‑planned development with three conditions, passing 4‑3. The commission also approved special‑use permits for two units (A208 and A303) at 250 Little Street, each by a 6‑1 vote. Routine items to place staff reports and prior minutes into the record were adopted unanimously.

Wed Nov 5, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Joint Development Authority to review routine agenda items and reports

The Joint Development Authority will consider routine agenda approvals, a treasurer's financial report, an update on the ARPA Small Business Grant, and a staff audit report. No substantive policy changes or new contracts are on the agenda.

governmentbudgetgrantsauditmeeting
✓ Decided: Directors unanimously approved the agenda and minutes, and tabled the Treasurer’s Report

The board approved the draft agenda and the minutes from the September 17 special meeting by unanimous vote of all four directors present. The Treasurer’s Report was postponed to the next meeting, also by unanimous consent. The meeting was then adjourned.

Wed Nov 5, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA will discuss an update on the ARPA Small Business Grant

The Joint Development Authority will hold a special called meeting to approve its agenda and the minutes from the September 17, 2025 meeting. The treasurer will present a report, and the board will receive an update on the ARPA Small Business Grant and a staff report on the Rushton audit. The meeting will also set the date for the next regular session.

grantsfinanceauditmeetingdevelopment
Wed Nov 5, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB board approves funding and minutes for November meeting

The Keep Athens-Clarke County Beautiful board convened at Synovus Bank to approve meeting minutes, a treasurer's report, and an executive director's report. The board unanimously approved funding up to $150 for Bring Back the Chipper donuts.

kaccbboard-meetingbudgetdonationscommittee-updates
✓ Decided: Board approved $150 funding for Christmas Tree Chipper

The board unanimously approved the October meeting minutes and the treasurer’s financial report. It also approved a $150 allocation for a Christmas tree chipper. The board set the retreat date for December 3 at Trappeze Pub. All motions were passed with no opposition.

Wed Nov 5, 2025

Pension Board

Board reviews 2025 valuation results and discusses plan design

The Athens-Clarke County Pension Board will approve the minutes from its August 6, 2025 meeting and receive updates on board membership and the retiree representative election. It will review pension investment activity through September 30, 2025, examine the July 1, 2025 valuation results and discuss plan design, and conduct an annual performance review of its investment manager and actuarial services. The agenda also includes an announcement of the GAPPT Annual Conference for March 2026 and a period for employee comments.

pensioninvestmentsvaluationboardperformance-review
✓ Decided: Board approves August minutes, postpones performance review to Feb 2026

The board unanimously approved the regular meeting minutes from August 6, 2025. The board agreed to postpone the Annual Performance Review of the Investment Manager and Actuarial Services until the February 4, 2026 meeting. The meeting was adjourned unanimously at 11:27 a.m.

Tue Nov 4, 2025

Mayor & Commission Meetings

Athens-Clarke County to consider $28.7 million pavement maintenance program

The Mayor and Commission will vote on the Calendar Year 2026 Pavement Maintenance Program and various zoning amendments. The body is also discussing infrastructure projects and a funding request for the Food Bank of Northeast Georgia.

roadszoningbudgethousinginfrastructure
✓ Decided: Commission approves $1.76 M road grant and adopts multiple ordinances

The commission approved the minutes from October meetings and accepted two street right‑of‑way notices. It unanimously consented to the CY2026 Pavement Maintenance Program, including a $1,756,898.36 grant application and related ordinance. Additional ordinances created yellow curbing on Herring and Reese Streets, amended the FY2026 budget for solid‑waste CHaRM processing, and elected not to require mobile‑home decals. Finally, a $1,853,086.77 contract was awarded for culvert replacement on Lavender and Roberts Roads.

Tue Oct 28, 2025

Mayor & Commission Meetings

Committee reviews updates to Public Right-of-Way ordinance definitions

The Right-of-Way Use Committee is discussing updates to ordinance language regarding the definition and allowable uses of public rights-of-way. The goal is to create a common understanding for staff and the public to be presented to the full Mayor and Commission by the November Voting Meeting.

ordinancepublic-safetyright-of-wayinfrastructure
✓ Decided: Committee approved agenda, minutes and adjourned unanimously

The Ad Hoc Committee on Public Right of Way approved the meeting agenda and the October 10, 2025 minutes, each with a unanimous vote. No substantive policy changes or ordinances were adopted. The committee set a next meeting for November 17 and will research a locker pilot for unhoused individuals.

Tue Oct 28, 2025

Athens in Motion Commission

Commission will consider approvals for Barber Street bike and pedestrian improvements

The Athens in Motion Commission will discuss the proposed CY26 Pavement Management Program and seek feedback. It will vote on several actions for the Barber Street bike and pedestrian improvements, including plan approvals and a design services supplement. The meeting will also provide updates on capital projects, staff reports, and committee activities.

bike-pedestrianpavement-managementcapital-projectsplanningtransportation
✓ Decided: Barber Street bike/ped improvements for segments 1‑2 approved, design supplement for segment 3

The commission unanimously approved the meeting agenda and the September meeting minutes. It approved the proposed preliminary and right‑of‑way plans for Barber Street Segments 1 and 2 and authorized staff to move those plans to final design, ROW acquisition, and bid phases. The commission also approved a professional services supplement for on‑call designer Alfred Benesch and Company to address sidewalk gaps in Segment 3. The meeting was adjourned at 6:03 pm.

Wed Oct 22, 2025

Human Relations Commission

Human Relations Commission to discuss Menstrual Project and housing tour

The Human Relations Commission will meet to review updates on the Menstrual Project and a housing tour. The body will also discuss holiday parade planning and November events.

human-relationshousingcommunity-eventspublic-health
✓ Decided: Committee approved moving forward with Menstrual project recommendation

The Human Relations Commission accepted the prior meeting minutes and voted to postpone Chairperson updates. It approved the Vice Chair's recommendation to advance the Menstrual project pilot. Cory and Annesia were tasked with ordering holiday parade supplies on October 24, 2025, and the commission agreed to hold its next meeting on November 19, 2025.

Tue Oct 21, 2025

Mayor & Commission Meetings

Mayor and Commission consider $15 million development agreement for 295 E. Dougherty St.

The commission will vote on a consent agenda that includes adopting the 2026 pavement maintenance program, adding two free holiday parking days, approving a solar panel contract for Fire Station #9, waiving $37,549 in water and wastewater fees for the 195 Bray St affordable housing project, and authorizing several parking prohibitions and a culvert replacement contract. They will also discuss new business items such as CHARM contingency funding, a revised MOU with the Board of Regents, the $15 million development agreement for 295 E. Dougherty St., and a work order for Phase II of the North Oconee River sanitary sewer interceptor project.

pavementparkingsolarhousinginfrastructuredevelopmentsewertaxes
✓ Decided: Mayor and Commission approved a solar panel project for Fire Station #9

The commission approved the 2026 Pavement Maintenance Program roadway list and added Indigenous Peoples’ Day and Juneteenth as free parking holidays. It also approved a solar panel installation at Fire Station #9, waived $37,549 in water and wastewater fees for the 195 Bray St affordable‑housing project, and adopted parking prohibitions on Herring and Reese Streets. Additionally, the body authorized a culvert‑replacement contract, and adopted a resolution to stop issuing mobile‑home decals.

Tue Oct 21, 2025

Mayor & Commission Meetings

Commission to approve holiday lighting MOU with downtown development authority

The Athens-Clarke County Mayor and Commission will consider a Memorandum of Understanding with the Athens Downtown Development Authority to install and maintain a holiday lighting display on College Avenue and Clayton Street. The meeting also includes an executive session to discuss a real estate acquisition or disposal, as authorized by state law. Members of the public may address the commission on agenda items for up to three minutes each.

holiday-lightingdowntown-developmentreal-estateexecutive-sessionpublic-input
✓ Decided: Commission approves holiday lighting MOU, suspends rules, and enters executive session

The commission voted 9‑yes to suspend its rules for a single new business item. It then approved the Memorandum of Understanding with the Athens Downtown Development Authority for a holiday lighting display along College Avenue and Clayton Street. A third 9‑yes vote placed the commission into executive session to discuss real‑estate acquisition or disposal. The meeting was adjourned unanimously.

Tue Oct 21, 2025

TAD Advisory Committee - East Downtown Area

Open discussion and visioning session for the East Downtown TAD area

The East Downtown TAD Advisory Committee will hold an open discussion and visioning session for the district. The meeting includes routine approvals of the agenda and minutes from September 16, 2025. Staff will provide updates on ACCGov projects in the TAD and report that there are no funded TAD requests at this time.

tax-allocation-districteconomic-developmentplanningcommunity-engagement
Mon Oct 20, 2025

SPLOST Oversight Committee

Committee to review Fire Station #9 solar project concept

The SPLOST Oversight Committee will review a proposed solar photovoltaic system for Fire Station #9, which would cost approximately $300,000. The committee is asked to confirm if the project concept aligns with the initial project statement.

splostsolarfire-stationoversightbudgetrenewable-energy
Mon Oct 20, 2025

Athens Cultural Affairs Commission

Commission will vote on Memorial Park and Animal Services proposals

The Athens Cultural Affairs Commission will discuss and vote on two recommendations: a presentation on Memorial Park and a presentation on Animal Services. The meeting also includes updates on a canceled poetry event, the start of a public art training course, and details about upcoming art exhibits and calls for submissions.

cultural-affairsartpublic-artparksanimal-services
Mon Oct 20, 2025

Mayor & Commission Meetings

Commission to consider updates to BAC procedures and Community Benefits Agreement

The Government Operations Committee will approve the September 15, 2025 meeting minutes and discuss several policy updates. Items include recommended changes to the Board of Adjustments and Appeals (BAC) procedures and revisions to the Community Benefits Agreement portion of the Leasing Policy. The committee will also review the recently approved Short Term Rental Ordinance and consider future actions on renter protections and employee engagement.

governancepolicyhousingshort-term-rentalsemployee-engagement
✓ Decided: Commission approved minutes and referred historic property issues to Property Committee

The committee unanimously approved the minutes from the September 15, 2025 meeting. Members agreed to refer the discussion of county‑owned historic properties to the Property Committee for further study. The meeting was adjourned by unanimous vote.

Mon Oct 20, 2025

TAD Advisory Committee - Newton Bridge Area

Committee will discuss membership and vision for Newton Bridge TAD

The Newton Bridge Road TAD Advisory Committee will meet to discuss its membership and hold an open visioning session for the TAD area. No funded projects or rezoning actions are on the agenda. The meeting includes a staff report updating on ACCGov projects and TAD requests, which currently have none.

tadplanningcommunity-engagementmembershipathens-ga
✓ Decided: Committee unanimously approved agenda and prior meeting minutes

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the September 15, 2025 meeting. No funding requests, project updates, or new actions were approved. Discussion of committee membership and a visioning session were postponed pending potential TAD committee consolidation.

Mon Oct 20, 2025

TSPLOST Oversight Committee

Committee to review 2026 Pavement Maintenance Program roadway list

The TSPLOST Oversight Committee will discuss whether the proposed roadway list for the Calendar Year 2026 Pavement Maintenance Program aligns with the project's initial statement. The committee will also review monthly project and revenue reports for the 2018 and 2023 TSPLOST programs.

roadsinfrastructurebudgettsplost
Thu Oct 16, 2025

Arena District Steering Committee

Arena District Steering Committee to interview development facilitator candidates

The committee will hold oral presentations and interviews with short-listed submitters for the Arena District Development Facilitator RFQ. Members will then discuss these presentations to move forward with the selection process.

arena-districtdevelopmentprocurementplanning
✓ Decided: Committee unanimously approved agenda, minutes and adjourned

The steering committee approved the meeting agenda with a unanimous vote. The draft minutes from the previous meeting were also approved unanimously. The meeting was then adjourned by unanimous consent. No substantive development decisions were made.

Wed Oct 15, 2025

Mayor & Commission Meetings

Commission reviews Affordable Housing Trust Fund and market findings

The commission will hear an overview of the Affordable Housing Trust Fund and a market overview with key findings from HTF research and interviews. Q&A sessions will follow each presentation. No formal actions or votes are scheduled for this meeting.

affordable-housinghousing-trust-fundresearchcommunity-development
Wed Oct 15, 2025

Historic Preservation Commission

Commission reviews structure raising at 127 Nantahala Ave.

The Historic Preservation Commission will review requests for structural changes and security installations in the Boulevard and Downtown Historic Districts. The body will also consider a conceptual design for a facade modification and rooftop addition.

historic-preservationzoningdowntownboulevard-district
✓ Decided: Historic Preservation Commission approved a gated entry with dark coating condition

The commission approved Russell Edwards’ request for a retractable gate at 121 E. Clayton St, requiring a dark coating on the gate (vote 3‑1). It also accepted additional images for the gate as Exhibit A (unanimous) and recused member Chris Jackson from the vote. Officers were elected, naming Ted Rossier as chair and Bobbie Epting as vice‑chair (5‑0). Several routine items, including staff report introductions and minute adoptions, were passed unanimously.

Wed Oct 15, 2025

Arena District Steering Committee

Committee to interview candidates for Arena District Development Facilitator

The Arena District Steering Committee is meeting to conduct oral presentations and interviews. The committee will evaluate short-listed submitters for the Arena District Development Facilitator RFQ.

arena-districtdevelopmentrfqinterviews
✓ Decided: Committee unanimously approved agenda, minutes and adjourned the meeting

The Arena District Steering Committee approved its October 15 agenda and the August 20 draft minutes by unanimous vote. The committee also voted unanimously to adjourn the meeting. No other actions were taken.

Tue Oct 14, 2025

Mayor & Commission Meetings

Mayor and Commission hold work session on land use and short-term rentals

The Mayor, Commission, and Planning Commission are holding a joint work session to discuss future updates. No final actions will be taken during this meeting.

planningzoningshort-term-rentalsland-use
✓ Decided: No decisions made; commission discussed land use and short‑term rentals

The joint Mayor & Commission and Planning Commission work session met on October 14, 2025 at the Dougherty Street Auditorium. Commissioners and planning members discussed updates to the Future Land Use Plan and the Short‑Term Rental Ordinance. No formal actions, approvals, or votes were recorded on these items.

Fri Oct 10, 2025

Mayor & Commission Meetings

Draft ordinance to clarify definition and uses of public right-of-way

The Right-of-Way Use Committee will approve its agenda and the minutes from the October 3, 2025 meeting. It will allow public comments on items listed in the agenda, limited to three minutes per speaker. The committee is tasked with developing ordinance language that clarifies the definition of “Public Right-of-Way” and its allowable uses, to be presented to the full Mayor and Commission by the November voting meeting. The meeting will also set the date for the next committee session and confirm a quorum.

right-of-wayordinancepublic-safetycommitteemeeting
✓ Decided: Committee agreed to refine sidewalk obstruction ordinance language

The committee unanimously approved the agenda and the minutes from the October 3 meeting. Members discussed sidewalk obstruction data and agreed that citations and warnings, not arrests, are appropriate for first offenses. They decided to refine the draft ordinance language on storage limits, bike‑parking exceptions, peaceful gatherings, and bus‑stop areas, and to gather more examples from other cities before final recommendations. The next meeting was set for October 24, 2025.

Wed Oct 8, 2025

Hearings Board

Hearings Board to hear two residential variance requests

The Athens-Clarke County Hearings Board will consider two variance requests for single-family residential properties. One request seeks to increase the front yard parking allotment above 25%, and the other seeks to reduce the rear yard setback from 20 feet to 10 feet.

zoningvarianceresidentialplanninghearings-board
Tue Oct 7, 2025

Mayor & Commission Meetings

Commission adopts $200,000 Recreational Trails Grant for Southeast Clarke Park

The Athens-Clarke County Mayor and Commission will adopt several ordinances, including a grant for a recreational trail project at Southeast Clarke Park. They will also approve multiple service and supplier contracts and consider rezoning applications for industrial and commercial uses. A public hearing will be held on the planning commission's recommendations for those rezoning requests.

zoningcontractsbudgettransportationparkspublic-works
✓ Decided: Commission approved $3 M grant application for Memorial Park master plan

The Athens‑Clarke County Commission approved several grant applications and funding measures, including a $3 million Georgia Outdoor Stewardship Program grant for the Memorial Park Master Plan and a $200,000 Recreational Trails Program grant for Southeast Clarke Park trail improvements. It also authorized new Leaf & Limb staffing, a $1.65 million federal transit grant application, and awarded contracts for transit surveillance and airport fuel services. The minutes of prior meetings were approved and the Local Emergency Operations Plan was adopted.

Fri Oct 3, 2025

Mayor & Commission Meetings

Ad Hoc Committee to update Public Right-of-Way ordinance language

The Right-of-Way Ad Hoc Committee is meeting to develop ordinance updates regarding the definition and allowable uses of public rights-of-way. The committee aims to present these updates to the full Mayor and Commission by the November Voting Meeting.

right-of-wayordinancepublic-safetyzoning
✓ Decided: Committee agreed to rewrite obstruction ordinance to cover all public areas

The commission unanimously approved the meeting agenda (including September 23 minutes) and the September 23 minutes themselves. The committee agreed to replace fixed timeframes with flexible language and to use the term “public area” in a revised obstruction ordinance. Attorney Courtney Davis will draft the revised ordinance and staff will verify enforcement data before the next meeting on October 10.

Thu Oct 2, 2025

Mayor & Commission Meetings

Legislative Review Committee to discuss updates to the city noise ordinance

The Legislative Review Committee will approve the minutes from the September 4, 2025 meeting, allow brief public comments, and review the existing noise ordinance. Members will discuss possible updates for non‑agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district, including the use of objective volume measurements. The committee will also confirm a quorum for the next meeting on November 6, 2025.

noise-ordinancezoningpublic-hearingcommissionagenda
✓ Decided: Committee approved September 4, 2025 minutes

The Legislative Review Committee unanimously approved the September 4, 2025 meeting minutes. Members discussed possible updates to the city noise ordinance but did not adopt any changes, instead directing staff to keep evaluating models from other jurisdictions and related enforcement options. The meeting was adjourned unanimously.

Thu Oct 2, 2025

Audit Committee

Audit Committee will review FY26 audit workplan and approve prior meeting minutes

The Audit Committee will consider and approve the minutes from its August 7, 2025 meeting. It will receive a status report on the FY26 audit workplan, covering current audits and follow‑up items. The committee will also hear an update from the internal auditor. The next meeting is scheduled for November 6, 2025.

auditfinanceoversightgovernance
✓ Decided: Audit Committee unanimously approves August 7 meeting minutes

The committee approved the minutes from the August 7, 2025 meeting by unanimous consent. Members then reviewed the FY26 Organizational Structure Audit, noting its informational nature and discussing its language and clarity. Commissioners agreed to postpone any formal vote on the audit report until questions are answered, likely in December. No other substantive actions were voted on.

Thu Oct 2, 2025

Planning Commission

Rezoning and special‑use permit request for 115 & 125 McClung Road considered

The Athens‑Clarke County Planning Commission will adopt staff reports, approve the September 4, 2025 meeting minutes, and review MACORTS. It will consider an old‑business Special Use Permit for 480 S. Milledge Avenue and three new‑business items: a rezoning and Special Use Permit for 115 & 125 McClung Road, a text amendment to the code on home occupations, and a text amendment on veterinary clinics and kennels. The public may address the commission for up to three minutes on each agenda item.

zoningspecial-use-permitcode-amendmentplanning-commissionpublic-hearing
✓ Decided: Planning Commission approved prior minutes and tabled rezoning request

The commission approved the September 4, 2025 Planning Commission meeting minutes. The rezoning and special‑use permit request for 115 & 125 McClung Road was tabled after the applicant withdrew it prior to the meeting. No other items were decided.

Wed Oct 1, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

Board unanimously approves meeting minutes and financial and director reports

The Keep Athens-Clarke County Beautiful Board met on October 1, 2025 at Synovus Bank – Downtown. The board approved the prior meeting minutes, the Treasurer’s Report, and the Executive Director’s Report, each by unanimous motion. Committee updates were given for Business and Industry, Events, and Outreach/PR. Old and new business items were discussed but no decisions were recorded.

governancefinancereportscommittees
✓ Decided: Board unanimously approved September minutes and financial reports

The board voted to approve the September meeting minutes. The Treasurer’s Report showing a net operating loss of $932.53 was approved. The Executive Director’s Report, including revenue and expense details, was also approved. The meeting was then adjourned.

Tue Sep 30, 2025

Mayor & Commission Meetings

Mayor and Commission will hold an executive session on personnel matters

The Athens Mayor and Commission met in a special called session on September 30, 2025. The meeting was called to enter an executive session to discuss personnel matters under O.C.G.A. § 50-14-3(b)(2). No other agenda items were scheduled beyond roll call and adjournment.

executive-sessionpersonnelgovernmentathens
✓ Decided: Commission entered executive session and adjourned unanimously

The special session was called to discuss confidential personnel matters. Commissioners voted unanimously to enter executive session, then unanimously voted to adjourn the meeting.

Wed Sep 24, 2025

Human Relations Commission

Human Relations Commission discusses community projects and upcoming events

The commission will review updates from the Chairperson, Inclusion Office, and subcommittees, and hear public comments on old and new business. Topics include the Menstruation Project, subcommittee groups, a housing tour update, and planning for October events and the Christmas Parade. No formal decisions or contracts are listed on the agenda.

human-relationscommunity-projectseventspublic-commenthousinginclusion
✓ Decided: William Redding appointed as Human Relations Commission secretary

The commission voted to appoint William Redding as secretary, replacing Mary Frances O’Neil. The committee also decided to form subcommittees to develop a float for the December 4th ACCGov Parade of Lights. Other topics such as the Faith and Blue Festival and the Housing Tour were discussed but no formal actions were taken.

Tue Sep 23, 2025

Mayor & Commission Meetings

Committee will draft ordinance updates defining public right-of-way uses

The Ad Hoc Right-of-Way Use Committee will consider updates to the city ordinance that clarify the definition and allowable uses of public right-of-way, including sidewalks, bike lanes and vehicle lanes. The committee will also confirm a quorum for its next meeting on September 30, 2025. Public comments are invited on agenda items.

right-of-wayordinancepublic-safetycity-governmentmeeting
✓ Decided: Committee tasked staff to research public right‑of‑way ordinance updates

The committee unanimously approved the meeting agenda. It directed staff to work with the County Attorney’s Office and ACCPD to research and propose updates to the public right‑of‑way ordinance. The next meeting was scheduled for Friday, October 3, 2025. The meeting was adjourned by unanimous vote.

Tue Sep 23, 2025

Athens in Motion Commission

Commission will discuss the Barber Street bike and pedestrian project.

The Athens in Motion Commission will hold its monthly meeting on September 23, 2025 to review agenda items and take public comment. Commissioners will receive updates on TSPLOST 2026, a plan revision, and staff reports, and will consider several capital projects including the Barber Street bike and pedestrian project and concept approvals for sidewalk improvements on W. Broad & Hancock, Stonehenge, and Sycamore Drive. Additional items include a notice of award for an RCP planning grant and updates on bike rack installations, transit, and regional planning.

transportationbike-pedestriancapital-projectstsplostsidewalksplanning
✓ Decided: AiMC will accept sharrows for Barber Street segment 4 to speed project

The commission approved the meeting agenda and the August meeting minutes unanimously. The commission decided to accept, rather than recommend, sharrows for segment 4 of the Barber Street Bicycle & Pedestrian Improvements Project to accelerate completion of the remaining segments. The meeting was adjourned after a motion to adjourn was moved and seconded.

Tue Sep 23, 2025

Airport Authority

Airport Authority will review minutes and hear manager reports on finances and projects

The Athens Ben Epps Airport Authority will review and approve the August meeting minutes. The Airport Manager will present reports on finances, operations, capital improvement projects, and marketing and outreach activities. Old business includes a Lexington Corridor update, for which no report is available. No new business is scheduled, and committee updates will be provided before adjourning.

financeoperationscapital-projectsmarketingmeetings
✓ Decided: August meeting minutes approved unanimously

The Authority approved the August meeting minutes with a unanimous vote. The meeting was then adjourned unanimously. No other substantive actions were decided at this session.

Sat Sep 20, 2025

Mayor & Commission Meetings

Commission will discuss FY27 budget and upcoming TSPLOST 2026 funding

The Athens-Clarke County Mayor & Commission will review the FY27 budget and longer‑term financial plans. They will also consider the TSPLOST 2026 proposal, a capital‑projects delivery framework, and a response to zoning questions. The meeting includes a mid‑point review of the manager’s 90‑day observations and a discussion of top priority areas for the next year.

budgetzoningcapital-projectstransportationstrategic-planning
✓ Decided: Retreat meeting discussed projects and budget but made no decisions

Commission members met at a retreat to discuss the Capital Project Delivery Framework, the TSPLOST 2026 initiative, and the FY27 budget and beyond. No votes were taken, and no actions were approved, denied, or tabled. The meeting adjourned at 1:24 PM.

Fri Sep 19, 2025

Mayor & Commission Meetings

Mayor & Commission retreat will discuss FY27 budget and upcoming projects

The Athens-Clarke County Mayor and Commission will hold a two‑day retreat to review priority areas for the next year, respond to zoning questions, and assess the manager's 90‑day observations. Sessions will cover the Capital Projects Delivery Framework, the TSPLOST 2026 initiative, and the budget for fiscal year 2027 and beyond. The agenda includes breaks, a tour of Gainesville, and a group dinner.

budgetzoningcapital-projectsstrategic-planningretreat
✓ Decided: No formal decisions were made at the September 19 retreat

The Athens-Clarke County Mayor and Commission held a retreat on September 19, 2025 at The Vault in Gainesville. Commissioners discussed the top three priority areas for the next year, responded to zoning questions, reviewed the manager's 90‑day observations, and toured Gainesville. No votes, approvals, or other formal actions were recorded.

Fri Sep 19, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA will vote to prequalify a new loan applicant and finalize the grant slate

The Joint Development Authority will consider three main actions: approving the meeting agenda, approving the minutes from the August 6, 2025 regular meeting, and voting to prequalify a new loan applicant. In old business, the board will finalize the JDA grant slate. The next regular meeting is scheduled for November 5, 2025.

developmentfinancegrantmeetingplanning
✓ Decided: JDA advances revolving loan fund request to underwriting phase

The Joint Development Authority unanimously approved the meeting agenda, moved a new revolving loan fund request to the underwriting phase, and approved revised allocations for the ARPA Workforce Development Small Business Grant program. All motions were passed unanimously by the four directors present.

Wed Sep 17, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Board will vote to prequalify a new loan applicant for the JDA

The Joint Development Authority will consider approving the prequalification of a new loan applicant. Directors will also finalize the JDA grant slate under old business. Routine items include approving the agenda, approving minutes from the August 6, 2025 meeting, and setting the next regular meeting date.

joint-developmentfinanceloansgrantsgovernment
Wed Sep 17, 2025

Solid Waste Advisory Commission

SWAC to consider draft ordinance banning plastic bags and Styrofoam

The Athens-Clarke County Solid Waste Advisory Commission will approve the August 2025 meeting minutes, review July and August division reports, and discuss old business items such as the AAH cleanup and the Made to be Remade grant update. In new business, the commission will consider a draft ordinance that would eliminate plastic bags and Styrofoam containers at points‑of‑purchase, with a 12‑month phase‑in and data collection on impacts. The meeting will be streamed live and public comments can be emailed to the SWAC secretary.

waste-managementordinanceplastics-banlandfillcompostingenvironmental-justice
Wed Sep 17, 2025

Historic Preservation Commission

Historic Preservation Commission reviews permits for windows, demolition, and design changes

The Athens-Clarke County Historic Preservation Commission will meet to review requests for Certificates of Appropriateness regarding window replacements, chimney removal, and a full demolition. The body will also discuss conceptual designs for new additions and exterior modifications in various historic districts.

historic-preservationzoningdemolitionarchitecturebuilding-permitsathens-clarke-county
Tue Sep 16, 2025

TAD Advisory Committee - Mall Area

Mall Area TAD Advisory Committee to review project updates and 2026 schedule

The committee will receive staff reports on ACCGov projects and funded requests within the Mall Area Tax Allocation District. Members will also discuss the 2026 meeting schedule and a resource called Take Aim.

tax-allocation-districtinfrastructureplanningathens-clarke-county
✓ Decided: Committee approved agenda, minutes and set 2026 meeting schedule

The Mall Area TAD Advisory Committee unanimously approved the meeting agenda and the prior meeting minutes. The committee accepted a proposed schedule for its 2026 meetings. Members were informed about the Take Aim resource via email, and the meeting was adjourned unanimously.

Tue Sep 16, 2025

Mayor & Commission Meetings

Mayor & Commission to approve $3.5M loan for North Downtown Athens Phase 2

The Athens‑Clarke County Mayor and Commission will consider a range of contracts, grant applications, and infrastructure projects. Items include a five‑year aviation fuel supply contract with Titan Aviation Fuels, a $701,963 SPLOST facilities equipment replacement, and a $3.5 million soft‑pay loan to support the $64.5 million North Downtown Athens Phase 2 redevelopment. The board will also review a water‑and‑wastewater connection fee exemption for Meissner’s $250 million campus investment and approve pedestrian improvement designs for Sycamore Drive. Additional agenda items cover transit fleet surveillance, airport fuel services, and adoption of the Local Emergency Operations Plan.

transportationfinanceinfrastructurehousingwaterparks
✓ Decided: Mayor and Commission agenda-setting session held, no decisions made

The September 16, 2025 meeting was an agenda‑setting session. No votes were taken on any items, and the commission did not approve, deny, or table any proposals. The meeting was adjourned at 8:02 p.m. after a motion to approve the session.

Tue Sep 16, 2025

Mayor & Commission Meetings

Commission to approve MOU for Sanford Stadium Phase II sewer project

The Mayor and Commission will consider approval of a Memorandum of Understanding with the University of Georgia Athletic Association for construction of the Phase II sanitary sewer interceptor at Sanford Stadium. They will also discuss any other old business items and may enter executive session after adjournment to discuss a real‑estate acquisition or disposal under §50‑14‑3(b)(1)(B). Public input is allowed on agenda items for up to three minutes per speaker.

sewerinfrastructureuniversityreal-estatepublic-inputcommission
✓ Decided: Commission unanimously approved MOU for Phase II Sanford Stadium sewer project

The commission approved a Memorandum of Understanding between ACCGov and the University of Georgia Athletics Association to design and construct Phase II of the Sanford Stadium sanitary sewer interceptor improvement project. They also authorized the mayor and staff to execute all related documents. A motion to enter executive session for discussion of real‑estate acquisition or disposal was also approved, all by unanimous vote.

Tue Sep 16, 2025

TAD Advisory Committee - Lexington Road

Committee will review capital projects funded by SPLOST and TSPLOST in the TAD

The Lexington Road TAD Advisory Committee met on September 16, 2025 to discuss ongoing and upcoming matters for the tax allocation district. The agenda included routine items such as approval of the agenda and minutes, a staff report on ACCGov projects, and updates on the community‑identified priority list and bylaws. New business focused on reviewing capital projects funded by SPLOST and TSPLOST, confirming that there are currently no public utilities projects, and setting the 2026 meeting schedule. The committee also introduced the Take Aim resource and scheduled the next meeting for December 9, 2025.

tax-allocation-districtcapital-projectssplosttsplostmeeting-schedulecommunity-priorities
✓ Decided: Committee unanimously approved the 2026 meeting schedule

The Lexington Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the May 6, 2025 meeting. The committee also unanimously approved the schedule for its 2026 meetings (March 17, June 16, September 15, and December 15). No new public‑utilities projects were identified, and no funding decisions were made.

Tue Sep 16, 2025

TAD Advisory Committee - East Downtown Area

Advisory committee to approve agenda, minutes and hear staff updates

The East Downtown TAD Advisory Committee will approve the agenda and the August 21, 2025 minutes, receive staff updates, and set the date for the next meeting. No new or unfinished business items are listed.

tax-allocation-districtmeetingagendaminutesstaff-reports
✓ Decided: Committee unanimously approved agenda and prior meeting minutes

The East Downtown TAD Advisory Committee approved its agenda and the minutes from the August 21, 2025 meeting both by unanimous vote. The meeting was then adjourned by unanimous consent. No substantive project decisions were made.

Mon Sep 15, 2025

SPLOST Oversight Committee

Committee to vote on SPLOST Project 27 Sub‑Project #5 funding request

The SPLOST 2020 Oversight Committee will review and approve the minutes from the April 21, 2025 meeting, examine several SPLOST monthly and financial reports, and decide whether to confirm that the proposed concept for SPLOST 2020 Project 27, Facilities Equipment Systems Replacement, Sub‑Project #5 is consistent with its initial project statement. The decision involves $701,693 of available funding out of a total $3,879,690 allocated to Project 27. The agenda also includes scheduling items for future meetings.

spostfinancefacilitiescapital-projectsoversightbudget
Mon Sep 15, 2025

Mayor & Commission Meetings

Government Operations Committee to review renter protections and employee engagement

The Government Operations Committee will discuss updates to renter protections and resources, including potential changes to comply with state code and case law. The committee will also review employee engagement and recognition initiatives for ACC government employees. No decisions are scheduled for this meeting.

zoninghousingemployee-engagementrental-policygovernment-operations
Mon Sep 15, 2025

TAD Advisory Committee - Newton Bridge Area

Committee will discuss future land use and visioning for Newton Bridge Road TAD

The Newton Bridge Road TAD Advisory Committee will approve the agenda and minutes, receive a staff report on ACCGov projects and note that no TAD requests have been funded, and hold a new business discussion with ACCGov Planning and Zoning staff about future land use and visioning. The meeting will also address the status of ACCGov-issued email addresses.

land-useplanningzoningeconomic-developmenttax-allocation-district
✓ Decided: Committee approved agenda and minutes, then adjourned

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the August 18, 2025 meeting. No new funding requests or project approvals were made. The committee discussed the future land‑use map, traffic study schedule, and sewer capacity, then adjourned.

Mon Sep 15, 2025

TSPLOST Oversight Committee

Committee reviews pedestrian improvement concepts for Stonehenge neighborhood

The TSPLOST 2023 Oversight Committee is meeting to determine if the proposed project concepts for the Stonehenge Neighborhood Area Pedestrian Improvements Project are consistent with the initial project statement. The body will also review monthly project, revenue, and expenditure reports for the 2018 and 2023 TSPLOST programs.

tsplostpedestrian-safetysidewalksstonehenge-neighborhoodinfrastructurebudget
Thu Sep 11, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA reviews applications for ARPA Small Business Grant program

The Joint Development Authority will consider applications for its ARPA Workforce Development Small Business Grant program. No other substantive items appear on the agenda besides routine approvals. The meeting is a special called meeting on September 11, 2025.

workforce-developmentsmall-businessgrantseconomic-development
Wed Sep 10, 2025

Hearings Board

Variance to reduce side setback for ground sign at 1005 Hull Road

The Athens-Clarke County Hearings Board will consider two variance requests. One request seeks to reduce the side setback allowance for a ground sign at 1005 Hull Road (VAR-2025-08-1572). The other request seeks to increase the maximum square footage allowed for an accessory building at 160 Greenwood Drive (VAR-2025-08-1573). Both items are scheduled for discussion and decision at the September 10, 2025 meeting.

zoningvariancesplanningdevelopment
Wed Sep 10, 2025

TAD Advisory Committee - North Avenue

Committee will decide on public input sessions for infrastructure, housing, and development

The North Avenue TAD Advisory Committee will discuss how to gather public input on community‑identified priorities, including infrastructure improvements, affordable housing, economic development partnerships, and youth development. It will also set the 2026 meeting schedule and introduce the Take Aim resource. The meeting includes routine approvals of the agenda and prior minutes.

public-inputhousinginfrastructureeconomic-developmentyouth-developmentschedule
Tue Sep 9, 2025

Mayor & Commission Meetings

Vision Zero Safety Action Plan status update presented at work session

The Athens Mayor and Commission held a work session with draft reports only. No final actions were taken. Officials provided updates on several future‑consideration projects, including pedestrian improvements and emergency planning. The session was open to the public but did not accept public comments.

transportationpublic-workssafetyplanningemergency
✓ Decided: No actions taken; commission held work session to discuss five items

The Athens-Clarke County Mayor and Commission met for a work session on September 9, 2025. Commissioners discussed five agenda items, each noted as "questions only" or a status update. No motions were made, and no approvals, denials, or tablings were recorded.

Mon Sep 8, 2025

Athens Cultural Affairs Commission

Athens Cultural Affairs Commission approves October events and public art deadlines

The Athens Cultural Affairs Commission will meet to review staff reports on public art projects, upcoming events, and application deadlines. The meeting includes updates on a mural call, artist talks, and a sculpture installation planned for mid-October.

artspublic-arteventscultural-commissionlyndon-house
✓ Decided: Commission approved August minutes and set October meeting for Oct 20

The Cultural Affairs Commission unanimously approved the August meeting minutes. The October commission meeting was moved to October 20. The Costa Building public art selection was approved by the mayor and the commission. The Poetry for the People event was rescheduled to October 5, 3‑5 pm at Dudley Park.

Thu Sep 4, 2025

Mayor & Commission Meetings

Legislative Review Committee to discuss noise ordinance updates

The Legislative Review Committee is meeting to review the existing noise ordinance. The body will discuss prospective updates regarding non-agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district.

noise-ordinancezoningpublic-safetylegislative-review
✓ Decided: LRC voted to adopt 1‑mile and 0.5‑mile noise limits for the Fairgrounds

The Legislative Review Committee approved the August 7, 2025 minutes unanimously. The committee unanimously adopted a draft amendment setting a 1‑mile distance for item a and a 0.5‑mile distance for item b in the noise ordinance and will forward the recommendation to the full Mayor and Commission. The meeting was adjourned by unanimous vote.

Thu Sep 4, 2025

Planning Commission

Planning Commission to review rezoning and development requests

The Planning Commission is meeting to discuss several rezoning requests and special use permits. The body will review proposals for residential, business, and employment center land use changes.

zoningland-userezoningdevelopment
✓ Decided: Commission approved rezoning of 780 Macon Highway to RM-1

The Planning Commission approved a rezoning request for 780 Macon Highway from RS-5 to RM-1 with a unanimous 6‑0 vote. It also approved a special‑use permit for 600 Oglethorpe Avenue with conditions (5‑0) and approved both future land‑use and zoning changes for 135 & 150 McClung Road (6‑0 each). The commission denied the future land‑use and zoning requests for Old Elberton Road (6‑0 each) and tabled the 2415 Jefferson Road application for up to three months (6‑0).

🏢 Building at this address: 4 m tall
Wed Sep 3, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB Board approves $500 for DDP event supplies and marketing

The Keep Athens-Clarke County Beautiful Board met to review financial reports and director updates. The board unanimously approved the treasurer's report and a specific funding allocation for event materials.

beautificationbudgetcommunity-events
✓ Decided: Board approved $500 for Dirty Dance fundraiser expenses

The board unanimously approved the August meeting minutes and the Treasurer’s Report, which showed a net loss of $1,084.64. It also approved a $500 expenditure for the upcoming Dirty Dance event, covering Facebook ads and face‑painting supplies. No other substantive actions were taken; upcoming events were announced.

Tue Sep 2, 2025

TAD Advisory Committee- West Broad/Hawthorne Area

West Broad/Hawthorne TAD committee meets to review projects and set 2026 schedule

The West Broad/Hawthorne Area Tax Allocation District (TAD) Advisory Committee will hold a regular meeting to receive a staff report on ACCGov projects, review TAD requests, and discuss upcoming meeting topics. The committee will also set its 2026 meeting schedule and introduce a new resource called Take Aim.

tax-allocation-districteconomic-developmentwest-broadhousinglocal-government
Tue Sep 2, 2025

Mayor & Commission Meetings

Athens-Clarke County Commission to vote on $100,000 grant for Morton Theatre redesign

The Athens-Clarke County Mayor and Commission will meet to decide on funding for the Morton Theatre Proscenium Redesign, a $200,000 project including a $100,000 grant from the Fox Theatre Grant Program. The meeting will also include votes on multiple SPLOST and TSPLOST projects, zoning requests, and public hearings on developments like Macon Highway Village and 585 Vine Street.

zoningbudgethousingroadsartsgrantspublic-hearings
✓ Decided: Commission approved $2.1M grant for W. Broad pedestrian improvements

The commission voted unanimously to approve twelve consent items covering grant funding, ordinance amendments, and project authorizations. Notably, it adopted a $2,115,237 amendment to the TSPLOST 2018 Capital Projects Fund for the W. Broad Area Pedestrian Improvements and a $100,000 amendment for the Morton Theatre proscenium redesign. It also raised the residential trash service fee from $10 to $25 and approved several infrastructure, park, and renewable‑energy projects. All motions passed with unanimous or recorded 9‑yes votes.

Wed Aug 27, 2025

Human Relations Commission

Athens Human Relations Commission meets to review work plan and events

The Athens Human Relations Commission will hold a routine meeting to accept past minutes, hear a chairperson’s update, and review ongoing work including a work plan, healthcare education session, and housing tour. Residents may speak for up to three minutes during public comment periods.

human-relationspublic-commentwork-planhealthcarehousing
✓ Decided: Human Relations Commission moves housing tour to Jan 2025 and tables menstrual project

The commission accepted the minutes from the prior meeting. A motion to shift the housing tour to January 2025 was carried. The committee also voted to table the menstrual project pilot until January 2025. No other substantive actions were taken.

Tue Aug 26, 2025

Airport Authority

Athens Airport Authority meets Aug 26 to review finances and Lexington Corridor progress

The Athens Ben Epps Airport Authority will hold its August 26 meeting to receive manager reports on finances, operations, capital projects, and marketing, review July minutes, and hear updates on the Lexington Corridor project. No specific decisions are listed on the agenda; the meeting is primarily informational and procedural.

airportfinanceoperationslexington-corridorprocedural
✓ Decided: July meeting minutes approved unanimously

The board approved the corrected July meeting minutes with a unanimous vote. Mr. Sanders was designated to lead the September meeting, with Mr. Alexander as backup. The meeting was adjourned at 3:30 pm by unanimous consent. The next meeting was scheduled for Tuesday, September 23, 2025.

Tue Aug 26, 2025

Athens in Motion Commission

Athens in Motion Commission to review capital projects and safety updates

The commission will discuss updates on the Safe Streets for All plan and Vision Zero dashboard. Members will review several capital projects and a July crash report detailing 306 total crashes.

transportationpublic-safetyinfrastructurezoningpedestrian-safety
✓ Decided: Athens in Motion Commission approved agenda unanimously

The commission unanimously approved the meeting agenda and the July meeting minutes. The Education and Communication committee tabled the UGA Watch for Dawgs event. The meeting was then adjourned.

Thu Aug 21, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Advisory Committee to review project updates

The East Downtown Tax Allocation District (TAD) Advisory Committee will meet to receive staff reports on ACCGov projects. The committee will also discuss upcoming meeting topics and review responses from the previous meeting.

tax-allocation-districteconomic-developmentathens-gainfrastructure
✓ Decided: Committee unanimously approved agenda and minutes, then adjourned

The East Downtown TAD Advisory Committee unanimously approved the meeting agenda and the prior meeting minutes. No funding requests or project updates were reported. The committee discussed potential consolidation of TAD advisory committees but took no formal action. The meeting was then adjourned.

Thu Aug 21, 2025

Athens Justice and Memory Project

Athens Justice & Memory Project to review public art and Linnentown signage

The Athens Justice & Memory Project will meet to discuss the status of public art and Linnentown signage. The committee will also vote to approve previous meeting minutes.

public-artlinnentownmemorialscommunity-belonging
Wed Aug 20, 2025

Solid Waste Advisory Commission

Solid Waste Advisory Commission reviews draft hazardous waste policy and future meeting dates

The Athens-Clarke County Solid Waste Advisory Commission will hold its August 20, 2025 meeting to approve minutes, receive reports on beautification, recycling, collections, and landfill status, and discuss new business including a draft household hazardous waste policy and 2025 litter index results. The meeting is open to the public and will be streamed live.

solid-wastehazardous-wastelitterrecyclingpublic-meeting
Wed Aug 20, 2025

Historic Preservation Commission

Commission reviews demolition and new construction at 480 S. Milledge Avenue

The Historic Preservation Commission will review several requests for Certificates of Appropriateness for properties in the Downtown, Milledge Ave., and Boulevard historic districts. The body is deciding on demolition, signage, and storefront modifications, and reviewing a conceptual design for a residential structure.

historic-preservationdemolitionzoningdowntownsignage
Wed Aug 20, 2025

Arena District Steering Committee

Committee reviews submittals for Arena District Development Facilitator

The Arena District Steering Committee will meet to review and discuss submittals for a Request for Qualifications (RFQ) for a Development Facilitator. The committee will also approve the agenda and previous meeting minutes.

arena-districtdevelopmentrfq
✓ Decided: Committee selected four firms for Arena District interviews and set dates

The committee unanimously approved the meeting agenda and the June 10 minutes. It narrowed the RFQ submissions to four firms—CBRE, Seven Oaks, Accenture, and Brailsford & Dunlavey—and decided to invite them for presentations. Interview sessions were scheduled for October 15 (morning) and October 16 (afternoon). Members will email their interview questions by Friday and staff will compile the final list and confirm firm availability.

Tue Aug 19, 2025

Mayor & Commission Meetings

Commission to vote on selling NEGRC property for $10 and elect new officers

The Athens-Clarke County Public Facilities Authority will consider a request from the Northeast Georgia Regional Commission to repurchase its property for $10.00. The meeting will also swear in newly appointed members, elect a chairperson and secretary for 2025, and approve minutes from a July 2010 meeting.

authorityproperty-salenortheast-georgia-regional-commissionoath-of-officeminutes-approval
Tue Aug 19, 2025

Mayor & Commission Meetings

Mayor and Commission to consider $2.75M roundabout funding and ARPA fund recapture

The Unified Government is setting its September 2 agenda, including transit grants and infrastructure projects. The body will also discuss recapturing unspent ARPA funds from eight local agency partners and the sale of property to the Northeast Georgia Regional Commission for $10.00.

transitzoninginfrastructurebudgetarpapublic-safety
✓ Decided: Commission approves multiple development, infrastructure and grant projects

The Athens‑Clarke County Mayor and Commission approved a series of funding applications, intergovernmental agreements, and project concepts. They denied a master‑planned multi‑family development on Macon Highway and approved a commercial planned‑development amendment on Vine Street. An intersection safety improvement at Thomas and Washington Streets was also approved.

Mon Aug 18, 2025

Mayor & Commission Meetings

Government Operations Committee to review renter protections and ACC employee engagement

The Government Operations Committee will meet to approve past meeting minutes and discuss future items assigned by Mayor Girtz, including updates to renter protections, a review of the Short Term Rental Ordinance, and enhancements to ACC employee engagement and recognition initiatives. No public comments will be taken unless requested by the Chair.

zoninghousingemployee-engagementshort-term-rentalsgovernment-operations
Mon Aug 18, 2025

TAD Advisory Committee - Newton Bridge Area

Newton Bridge Road TAD Committee to review traffic study

The Newton Bridge Road Tax Allocation District (TAD) Advisory Committee will meet to receive a staff report on local projects. The meeting includes a session with guests from Atlas to answer questions regarding a traffic study.

tax-allocation-districttraffic-studyinfrastructureathens-ga
✓ Decided: Committee approved agenda, minutes and scheduled next meeting

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the prior meeting minutes. The committee assigned Daniel Young to resend ACCGov email instructions and Take Aim information. The next meeting was set for September 15, 2025, and the meeting was adjourned.

Mon Aug 18, 2025

TSPLOST Oversight Committee

Committee reviews pedestrian improvements for W. Broad and Hancock

The TSPLOST Oversight Committee will review project concepts for pedestrian improvements at W. Broad and Hancock. The body will also consider a memorandum of agreement with GDOT for funds transfer regarding the W. Broad Street and W. Hancock Avenue Roundabout. Monthly revenue and expenditure reports for the 2018 and 2023 programs will be reviewed.

tsplostpedestrian-improvementstransportationinfrastructurebudget
Mon Aug 18, 2025

SPLOST Oversight Committee

SPLOST Oversight Committee to review Fire Station #8 and Dudley Park projects

The committee will take action on two SPLOST 2020 projects and review monthly project and expenditure reports. The meeting includes updates on the 2005, 2011, and 2020 SPLOST programs.

splostinfrastructurefire-stationparksbudget-oversight
Wed Aug 13, 2025

Deferred Compensation Board

Deferred Compensation Board to elect employee rep and review plan changes

The Athens-Clarke County Deferred Compensation Board will meet to approve prior minutes, elect a new employee representative, review quarterly investment performance with Corebridge Financial, and discuss updates to board roles, term lengths, and plan documents. The board will also hear updates on budget proposals and a resolution authorization.

deferred-compensationemployee-representativeinvestment-reportbudgetplan-update
✓ Decided: Board extended elected member terms to three years with a two-term limit

The Deferred Compensation Board approved the minutes from the May 28, 2025 meeting. It modified the 457(b) plan to allow cash‑outs for terminated participants with balances of $7,000 or less and later expanded that rule to apply to the aggregate value of all employee plans. The board also amended the ordinance to extend elected member terms from two to three years with a two‑term limit, and approved a $15,000 FY27 budget for fiduciary training and travel.

Wed Aug 13, 2025

Hearings Board

Hearings Board to consider variance for Freeman Drive property

The Athens-Clarke County Hearings Board will review a request for a variance to waive a development limitation for a property at 150 Freeman Drive. The petitioner, Angela E. Pope, seeks to proceed without adhering to a specific development activity restriction under section 8-7-18(i).

zoningvariancefreeman-driveundeveloped-land
Tue Aug 12, 2025

Mayor & Commission Meetings

Commission reviews pedestrian safety concepts for West Broad & Hancock neighborhoods

The Mayor and Commission will discuss draft pedestrian safety improvements for the West Broad & Hancock neighborhoods at a work session. No final decisions will be made; the meeting is informational only. Staff will present project concepts, historical studies, and crash data to guide future planning.

pedestrian-safetyzoninghousingtransportationbudgetpublic-art
✓ Decided: Commission approved motion to adjourn the meeting

The commission approved the motion to adjourn the meeting. No substantive decisions or votes on agenda items were taken.

Mon Aug 11, 2025

Athens Cultural Affairs Commission

Athens Cultural Affairs Commission approves new members and reviews mural projects

The Athens Cultural Affairs Commission will meet to approve new members and review updates on public art projects, including mural selections and community events. The commission will also discuss recommendations for the West Broad Roundabout and receive a master plan update.

artsmuralpublic-artcommunity-eventscommission
Thu Aug 7, 2025

Audit Committee

Audit Committee to review FY25 and FY26 audit workplans

The Audit Committee will discuss the status and activity of audit workplans and follow-ups for fiscal years 2025 and 2026. The meeting includes an update from the Internal Auditor.

auditgovernment-oversightfinance
✓ Decided: Audit Committee unanimously cancels September meeting

The committee unanimously approved the minutes from the June 5, 2025 meeting. It also voted unanimously to cancel the scheduled September meeting. The meeting was adjourned by unanimous motion. The next audit committee meeting is set for October 2, 2025.

Thu Aug 7, 2025

Mayor & Commission Meetings

Committee to review noise ordinance updates

The Legislative Review Committee is meeting to discuss potential updates to the existing noise ordinance. The discussion focuses on non-agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district.

noise-ordinancezoningpublic-safetylegislative-review
✓ Decided: Committee directs staff to draft noise ordinance amendment and related studies

The Legislative Review Committee approved the May 1, 2025 minutes and unanimously voted to adjourn the meeting. It then asked staff to develop a draft text amendment to the noise ordinance and to provide several reports, including penalty overviews, citation guidance, top complaint locations, and single‑family noise complaint data. The committee also noted that public comment on the amendment will be required at future agenda‑setting and voting sessions.

Thu Aug 7, 2025

Planning Commission

Planning Commission to review Future Land Use Map and short-term rental rules

The Planning Commission will consider updates to the Future Land Use Map and discuss potential amendments to the Code of Ordinances regarding short-term rentals. The body will also review several zoning requests and special use permits.

zoningland-useshort-term-rentalsplanning
✓ Decided: Planning Commission approved Future Land Use Map update and several project requests

The commission denied the Macon Highway Village master‑planned development (7‑0). It approved the 585 Vine Street planned‑development amendment (7‑0) and the alternative‑compliance request for 530 N. Hull Street with conditions (7‑0). It also tabled the 480 S. Milledge Avenue special‑use permit for up to three months (7‑0) and approved the Future Land Use Map update and related documents (7‑0). All votes were unanimous.

Wed Aug 6, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA to discuss workforce development and small business grant program

The Joint Development Authority will meet to discuss the ARPA Workforce Development and Small Business Grant Program. The body will also receive updates on the Turntable Revolving Loan Fund and a treasurer's report.

grantseconomic-developmentsmall-businessloansfinance
✓ Decided: JDA authorized opening of ARPA Workforce Development grant applications

The board unanimously approved the meeting agenda and the minutes from the May 28 special meeting. Directors voted to authorize Myung Cogan to open and advertise the ARPA Workforce Development Small Business Grant program. Chairman Cascio signed the agreement for the required annual audit of JDA records. The meeting was adjourned unanimously.

Wed Aug 6, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB Board approves treasurer's report and Flagpole advertisement

The Keep Athens-Clarke County Beautiful Board reviewed income and expenses and the Executive Director's report. The board voted to purchase a DDP advertisement in Flagpole.

beautificationadvertisingfinance
✓ Decided: Board unanimously approves treasurer's report and $237.50 ad

The board approved the Treasurer's financial report with a unanimous vote. It also approved a $237.50 flag‑pole advertisement at the discounted nonprofit rate, again unanimously. The meeting was then adjourned by unanimous consent.

Wed Aug 6, 2025

Pension Board

Pension Board to review and adopt FY26 Pension Fund Budget

The Athens-Clarke County Pension Board will meet to adopt the FY26 Pension Fund Budget and elect a Vice Chair. The board will also review investment activity through June 30, 2025, and discuss updated pension projections and plan design.

pensionsbudgetinvestmentsretirement-planninggovernance
✓ Decided: Board unanimously approved FY26 pension budget and changed May meeting date

The pension board approved the FY26 Pension Fund Budget with a unanimous vote. It also elected Jason Pierce as Vice Chair and changed the 2026 staff appreciation meeting date from May 6 to May 20, also unanimously. The board approved the prior meeting minutes, authorized an election for the retiree representative, and adjourned the meeting.

Tue Aug 5, 2025

Mayor & Commission Meetings

Athens-Clarke County to consider multiple rezonings and budget amendments

The Mayor and Commission will vote on several rezoning requests for residential and industrial uses. The body is also considering budget amendments for general fund deficits and grant applications for roadway safety.

zoningbudgetroadshousingpublic-works
✓ Decided: Commission approved $480,000 for water‑treatment plant sludge basin rebuild

The Athens‑Clarke County Commission approved the minutes from prior meetings and, by a consent motion, adopted eleven budget and policy items. Actions included accepting a potential $150,000 GEFA energy grant, creating a residential parking permit zone on O’Farrell Street, funding university traffic‑control reimbursements, setting the associate probate judge salary at 90% of the judge’s salary, adding a full‑time juvenile court staff attorney with $112,919 in funding, and authorizing major water‑treatment projects and a biosolids contract. The consent motion passed with nine affirmative votes.

Mon Jul 28, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee to discuss 100% budget list process

The TSPLOST Advisory Committee is meeting to review a previous presentation made to the Mayor and Commission. The committee will discuss and potentially vote on the process for finalizing the 100% budget list and review specific projects.

transportationbudgetsplostinfrastructure
Mon Jul 28, 2025

Arena District Steering Committee

Committee to review bids for Arena District Development Facilitator

The Arena District Steering Committee will meet to review and discuss submittals for the Development Facilitator Request for Qualifications (RFQ). The body will also approve the agenda and previous meeting minutes.

arena-districtdevelopmentrfqplanning
Tue Jul 22, 2025

Athens in Motion Commission

Athens in Motion Commission to review AiMC Plan revisions

The commission will discuss revisions to the AiMC Plan with Toole and Daniel Sizemore. Members will also receive updates on the Safe Streets for All roadway safety survey and TSPLOST 2026.

transportationbike-pedestrianroad-safetytsplosturban-planning
✓ Decided: Commission approved agenda, minutes and adjourned the meeting

The Athens in Motion Commission unanimously approved the meeting agenda and the June meeting minutes. No public comments were received. The commission then voted to adjourn the session. The next meeting is scheduled for August 26 at 4:00 pm.

Tue Jul 22, 2025

Airport Authority

Athens Ben Epps Airport Authority to review Lexington Corridor update

The Airport Authority will meet to review financial and operations reports and capital improvement project updates. The body will also discuss the Lexington Corridor and strategic plan updates.

airportinfrastructurestrategic-planningaviation
✓ Decided: Authority approves interim committee assignments and minutes

The Airport Authority approved the meeting minutes with one correction after a motion by Elizabeth Higgins and a second by Keith Sanders. The Authority also approved interim committee assignments for Business/Finance, Operating, and Air Service Development committees by unanimous vote. The meeting was then adjourned by unanimous vote.

Sat Jul 19, 2025

Human Relations Commission

Human Relations Commission to review by-laws and work plan

The Human Relations Commission is holding a working session to address administrative updates and planning. The body will review its by-laws, establish a work plan, and assign subcommittees.

government-administrationcommunity-relationspublic-meetings
Wed Jul 16, 2025

Historic Preservation Commission

Historic Preservation Commission to hold training session

The commission is meeting for a training session on project review processes and design guidelines. No business items will be conducted and no decisions will be made during this meeting.

historic-preservationtraininggovernment-procedure
Tue Jul 15, 2025

Mayor & Commission Meetings

Commission to consider $470,000 school resource officer contract

The Mayor and Commission will consider approving a contract with the Clarke County School District for the 2025-2026 School Resource Officer program. The body will also address the appointment of temporary acting clerks and a recommendation for a manager.

policeeducationcontractstransportationappointments
✓ Decided: Commission approved a budget amendment to cover FY 25 General Fund deficits

The Athens‑Clarke County Commission approved a series of items, including a budget amendment to address FY 25 General Fund deficits, a contract for the Sandy Creek Nature Center exhibit, and several rezoning and special‑use requests. All approvals were adopted without a recorded vote. The meeting was adjourned after the motion was approved.

Tue Jul 15, 2025

Mayor & Commission Meetings

Mayor and Commission to hold special session for executive session

The Unified Government of Athens-Clarke County is holding a special called session. The purpose of the meeting is to enter into an executive session to discuss personnel matters and real estate acquisition or disposal.

real-estatepersonnelexecutive-session
✓ Decided: Commission voted unanimously to enter executive session and adjourn

Commissioner Fisher moved to enter executive session and adjourn, and Commissioner Taylor seconded the motion. The motion passed by a unanimous vote. The meeting then adjourned at 5:08 p.m.

Tue Jul 15, 2025

Mayor & Commission Meetings

Commission to consider School Resource Officer agreement for 2025-2026

The Mayor and Commission will meet to discuss the School Resource Officer program contract with the Clarke County School District. The body will also consider the appointment of temporary acting clerks and a manager recommendation from Mayor Girtz.

policeeducationappointmentsgovernment-administration
✓ Decided: Commission approves $15.36 M sewer project and appoints new city manager

The commission unanimously approved the Sanford Stadium Sanitary Sewer Interceptor Improvement Project Phase II and allocated $15,360,000 from the Water & Sewer Enterprise Fund. It also approved the ACCPD School Resource Officer contract for 2025‑2026 and appointed three temporary Acting Clerks. A roll‑call vote confirmed Robert S. Cowell, Jr. as Manager (8‑1‑1). All other motions passed unanimously.

Tue Jul 15, 2025

TAD Advisory Committee - Newton Bridge Area

Newton Bridge Road TAD Committee to review by-laws and project status

The Newton Bridge Road Tax Allocation District Advisory Committee will discuss current funded projects and ACCGov updates. The body is also reviewing its by-laws and meeting schedule.

tax-allocation-districteconomic-developmentinfrastructuregovernment-administration
✓ Decided: Committee approved agenda and minutes, postponed by‑laws, set future meeting dates

The advisory committee unanimously approved the meeting agenda and the prior meeting minutes. By‑laws and agenda format were postponed pending attorney review. The committee set the monthly meeting schedule for August through December on the third Monday of each month. The meeting was then adjourned.

Tue Jul 15, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Advisory Committee to select leadership and review by-laws

The committee is meeting to establish its leadership and operational structure. Members will select a Chair, Vice Chair, and Secretary and review the committee's by-laws. The group will also discuss public infrastructure improvements.

tax-allocation-districtinfrastructuregovernanceeast-downtown
✓ Decided: Committee appoints new Chair, Vice Chair, and Secretary

The East Downtown TAD Advisory Committee unanimously approved its agenda and the minutes from prior meetings. Members voted to appoint Rashe Malcolm as Chair, Taylor Pass as Vice Chair, and Fred Smith as Secretary. The committee also set its meeting schedule for the remainder of 2025. The meeting was then adjourned.

Mon Jul 14, 2025

Athens Cultural Affairs Commission

Athens Cultural Affairs Commission reviews mural projects and public art updates

The commission is discussing the status of several public art installations and upcoming community events. The meeting includes updates on completed murals and the selection process for new art projects.

public-artmuralscommunity-eventsarts-culture
✓ Decided: Commission unanimously approved March minutes

The Athens Cultural Affairs Commission voted to approve the March meeting minutes, with all members in favor. The meeting was then adjourned by a unanimous vote.

Thu Jul 10, 2025

Planning Commission

Planning Commission to review proposed Future Land Use map changes

The Planning Commission is holding a worksession to review the Steering Committee's work on Future Land Use categories and mapping. The body will discuss proposed changes before a final vote scheduled for August 7, 2025.

zoningland-useplanningmapping
Wed Jul 9, 2025

Hearings Board

Hearings Board to consider sign variance for 359 W Hancock Ave

The Athens-Clarke County Hearings Board will review a variance request for a coffee shop located at 359 W Hancock Ave. The petitioner seeks to use a ground sign as a wall sign and apply wall sign placement specifications.

zoningsignagecommercial-developmentvariance
Thu Jul 3, 2025

Planning Commission

Planning Commission to review multiple rezoning and special use requests

The Athens-Clarke County Planning Commission is meeting to consider several rezoning requests and special use permits. The body will also review a planned development amendment and MACORTS items.

zoningland-userezoningspecial-use-permit
✓ Decided: Planning Commission approved rezoning of 180 & 190 Pinecrest Drive to RM‑2

The commission voted 6‑1 to recommend approval of the rezoning from RM‑1 to RM‑2 for 180 & 190 Pinecrest Drive. It also approved the rezoning of 231 Collins Industrial Boulevard to industrial use with conditions (5‑2), the Planned Development amendment for 355 OneTA Street (unanimous), and the rezoning of 360 Hawthorne Extension to RM‑2 (unanimous). The minutes and staff reports were adopted unanimously. No vote was taken on the Old Elberton Road rezoning or the special‑use permit for 159 Marlin Street.

Tue Jun 24, 2025

TAD Advisory Committee - Mall Area

TAD Advisory Committees to select leadership and review project funds

The Mall Area and Newton Bridge Road Tax Allocation District Advisory Committees are holding a combined meeting. The body will select a Committee Chair, Vice Chair, and Secretary, and review summaries of TAD fund accounts and funded projects.

tax-allocation-districteconomic-developmentmall-areanewton-bridge-road
✓ Decided: Mall Area and Newton Bridge Road TAD committees elected new chairs and vice chairs

Both TAD advisory committees unanimously approved their leadership appointments. Susan Bogardus was named Chair and Caitlin May Vice Chair of the Mall Area committee, while Daniel Epting became Chair and Mike Leggett Vice Chair of the Newton Bridge Road committee. Both committees also agreed to defer Secretary duties to staff member Daniel Young.

Tue Jun 24, 2025

Athens in Motion Commission

Athens in Motion Commission to discuss AiMC Plan revision and TSPLOST 2026

The commission will review the timeline for the AiMC Plan revision and receive updates on TSPLOST 2026. Staff will provide reports on park planning, transit, and Vision Zero, including the May monthly crash report.

transportationbike-pedestrianvision-zerotsplosturban-planning
✓ Decided: Commission unanimously approved agenda and minutes, then adjourned

The Athens in Motion Commission approved the meeting agenda, the March minutes and the May minutes, each by unanimous vote. A motion to adjourn was moved, seconded, and approved, ending the meeting at 5:40 pm. No other actions were taken.

Tue Jun 24, 2025

TAD Advisory Committee - Newton Bridge Area

TAD Advisory Committees to select leadership and discuss project goals

The Mall Area and Newton Bridge Tax Allocation District (TAD) Advisory Committees are holding a combined meeting. The body will select a Chair, Vice Chair, and Secretary and identify specific goals for the TADs. Staff will provide summaries of fund accounts and community-identified priority lists.

tax-allocation-districteconomic-developmentnewton-bridge-roadmall-area
✓ Decided: Both TAD committees unanimously elected new chairs and vice chairs

The Mall Area TAD Committee elected Susan Bogardus as chair and Caitlin May as vice chair. The Newton Bridge Road TAD Committee elected Daniel Epting as chair and Mike Leggett as vice chair. Both committees also deferred secretary duties to staff and approved the meeting agenda and prior minutes unanimously.

Tue Jun 24, 2025

Airport Authority

Athens Ben Epps Airport Authority to review FAA grant obligations

The Airport Authority will meet to review financial and operations reports and capital improvement project updates. The body will discuss FAA Grant Assurances and provide an update on the Lexington Corridor.

airportaviationfederal-grantsinfrastructure
✓ Decided: May 2025 meeting minutes approved unanimously

The Authority voted to approve the May 2025 meeting minutes with a unanimous vote. No other formal actions were taken during the session.

Mon Jun 23, 2025

TSPLOST 2026 Advisory Committee

Committee to finalize 150% potential project list for TSPLOST 2026

The TSPLOST Advisory Committee will review Round 5 voting results and set a results threshold. The body aims to complete final voting rounds to finalize a potential project list for recommendation to the Mayor and Commission.

transportationsplostinfrastructurebudget
Wed Jun 18, 2025

Solid Waste Advisory Commission

Solid Waste Advisory Commission to discuss battery safety campaign and AAH cleanup

The commission will review reports on landfill status and recycling facilities. Members will discuss upcoming AAH cleanup dates and a public relations campaign regarding battery safety.

waste-managementrecyclinglandfillpublic-safety
Wed Jun 18, 2025

Historic Preservation Commission

Commission reviews townhome construction and demolition on S. Milledge Avenue

The Historic Preservation Commission is reviewing requests for new construction and demolition within the Milledge Ave. Historic District. The body will also conduct officer elections and receive committee reports.

historic-preservationzoninghousingdemolition
✓ Decided: Commission approved new townhome construction at 997 S. Milledge Ave with conditions

The commission approved the new construction of townhomes at 997 S. Milledge Ave with conditions, passing 4‑1. It unanimously adopted staff report introductions, agenda order changes, and several minutes. Officers were elected, naming Worth VanLinden as Chair and Bobbie Epting as Vice Chair. The conceptual design review for 480 S. Milledge Ave was allowed to proceed with comments only, passing 4‑0.

Wed Jun 18, 2025

Human Relations Commission

Human Relations Commission to discuss Juneteenth and healthcare marketing

The Human Relations Commission will meet to review recent tabling events and plan for an upcoming retreat. The body will also discuss marketing for a healthcare session.

community-outreachhealthcarepublic-events
Tue Jun 17, 2025

Mayor & Commission Meetings

Commission to consider 2025 school district tax levy

The Mayor and Commission will meet for a special session to discuss personnel and consider an ordinance to levy taxes for the Clarke County Board of Education for 2025.

taxeseducationbudgetpersonnel
✓ Decided: Commission unanimously suspends rules to consider a new business item

Commissioners voted unanimously to suspend the Rules of Commission to consider one new business item. A motion was made to adopt Ordinance #25-06-68 to levy and assess taxes for the Clarke County School District for 2025, but the minutes do not record a vote outcome. The meeting was then adjourned by a unanimous vote at 7:03 p.m.

Tue Jun 17, 2025

Mayor & Commission Meetings

Athens-Clarke County holds special session for personnel discussion

The Mayor and Commission will meet for a special called session to enter an executive session. The purpose of the meeting is to discuss personnel matters.

personnelgovernment-administration
✓ Decided: Commission entered executive session and adjourned unanimously

The commission held a special session to discuss confidential personnel matters and real estate acquisition/disposal. Commissioners Link and Taylor moved to enter executive session and adjourn, and the motion passed unanimously. No other decisions were made.

Mon Jun 16, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee to review and vote on Round 4 project results

The TSPLOST Advisory Committee will review the numerical results of Round 4 voting. The body is scheduled to vote on setting a results threshold and discuss the outcomes to further refine the recommended potential project list.

tsplosttransportationinfrastructureathens-ga
✓ Decided: Committee added five projects to final list and removed three low‑vote projects

The committee unanimously approved the June 9, 2025 minutes. It moved four projects with nine votes and one project with eight votes forward to the final recommended list. A motion to conduct Round Five voting live failed in a 5‑5 vote. A later motion to remove projects with two votes and Project 26 passed 8‑2, eliminating three projects from consideration.

Thu Jun 12, 2025

Mayor & Commission Meetings

Mayor & Commission to hold special session for personnel discussion

The Unified Government of Athens-Clarke County will meet for a special called session. The purpose of the meeting is to enter into executive session to discuss personnel matters.

personnelexecutive-sessiongovernment-administration
✓ Decided: Commission approved entering executive session unanimously

The commission voted to enter an executive session to discuss confidential personnel matters. Commissioner Fisher moved, and Commissioner Taylor seconded the motion. The motion passed by a unanimous vote. The meeting adjourned shortly after.

Wed Jun 11, 2025

Hearings Board

Hearings Board to review three variance requests for residential properties

The Athens-Clarke County Hearings Board will consider three requests for variances to existing zoning and land use regulations. These requests involve accessory structure sizes, setbacks, and land disturbance limits.

zoningvariancesresidentialland-use
Tue Jun 10, 2025

Mayor & Commission Meetings

Athens-Clarke County to hold public hearing on FY26 budget

The Mayor and Commission will conduct the third public hearing for the proposed FY26 budget. The body will also consider adopting the FY26 operating and capital budgets, setting 2025 property tax rates, and approving a schedule of fees.

budgetzoningtaxesparkinghealthcareappointments
✓ Decided: Commission approved rezoning of 120.5 acres on Newton Bridge Road

The Athens‑Clarke County Commission adopted an ordinance changing the future land‑use designation of about 120.5 acres at 610‑760 Newton Bridge Road from “Employment Center & Rural” to “Mixed‑Density Residential.” The commission also approved the appointment of Judd T. Drake as the authorized representative for the Classic Center Arena Series 2021‑2023 bonds, accepted the resignation of Clerk Gloria Jean Spratlin, and confirmed Stephanie Thompson as Municipal Court Judge and Administrative Hearing Officer.

Tue Jun 10, 2025

TAD Advisory Committee - Lexington Road

Lexington Road TAD Committee to review capital projects and community outreach

The Lexington Road Tax Allocation District Advisory Committee will review SPLOST and TSPLOST capital projects within the district. The committee will also discuss community outreach strategies and the status of the Community-Identified Priority List.

tax-allocation-districtcapital-projectssplostcommunity-outreachinfrastructure
Tue Jun 10, 2025

Arena District Steering Committee

Arena District Steering Committee to review RFQ and role funding

The Arena District Steering Committee will meet to approve the agenda and previous minutes. The body is scheduled to review and approve a Request for Qualifications (RFQ) and discuss funding for a specific role.

arena-districtfundingprocurement
✓ Decided: Arena District Steering Committee unanimously approves revised RFQ

The committee unanimously approved the meeting agenda and the prior meeting minutes. It then approved the revised Request for Qualifications (RFQ) with all amendments, including removal of language allowing the facilitator to serve as master developer. The members also unanimously agreed that the full committee will review and score RFQ submissions and voted to strike two job‑description bullet points and a sentence about serving as master developer. The meeting was adjourned by unanimous vote.

Mon Jun 9, 2025

Athens Cultural Affairs Commission

Athens Cultural Affairs Commission to receive Master Plan update

The commission will review a Master Plan presentation by Todd Bressi. Members will also receive updates on local mural projects and upcoming community events.

artspublic-artmaster-plancommunity-events
Mon Jun 9, 2025

TSPLOST 2026 Advisory Committee

Committee to review and set thresholds for Round 3 TSPLOST 2026 voting

The TSPLOST Advisory Committee will review the results of Round 3 voting for the 2026 transportation projects. The body will vote on a results threshold and discuss whether to conduct Round 4 voting during the meeting.

transportationsplostinfrastructurevoting
✓ Decided: Committee added seven projects to final list and approved remote voting

The TSAC approved the revised minutes from the June 9 meeting unanimously. It moved three projects with 12‑11‑10 votes, two projects with nine votes, and two projects with eight votes onto the final recommended Potential Projects list. The committee also approved completing the next voting round with the current list and agreed to adjourn and vote from home the following week.

Thu Jun 5, 2025

Audit Committee

Audit Committee to review FY25 status and FY26 workplan

The Audit Committee will review the status of FY25 audits, follow-ups, and special projects. The body will also discuss the FY26 Audit Workplan and receive an update from the Internal Auditor.

auditgovernment-oversightfinanceinternal-audit
✓ Decided: Commission unanimously approved FY26 audit workplan

The committee approved the minutes from the April 3, 2025 meeting unanimously. A motion was made to approve the Transit Department periodic audit and place it on the August Mayor & Commission agenda, though the vote outcome was not recorded. The committee noted that the City Commission had previously approved the FY26 audit workplan, which includes an investigative audit of organizational structure and a follow‑up audit of the Public Utilities Water Business Office. The meeting was adjourned unanimously.

Thu Jun 5, 2025

Mayor & Commission Meetings

Athens-Clarke County to hold second public hearing on FY26 budget

The Mayor and Commission will conduct the second required public hearing on the proposed FY26 budget. This session is held in accordance with the Georgia General Assembly's 1999 Taxpayer Bill of Rights.

budgetpublic-hearingfinance
✓ Decided: Commissioners moved to adjourn the special session

The special called session held a public hearing #2 on the FY26 budget as required by the Taxpayer Bill of Rights. Four members of the public gave comments supporting various budget items. Commissioners Link and Taylor moved to adjourn the session; the minutes do not record a vote or adoption. The session ended at 6:17 p.m.

Thu Jun 5, 2025

Planning Commission

Planning Commission to review three rezoning requests and demolition code amendment

The Athens-Clarke County Planning Commission will consider three land-use requests for properties on Rockwood Boulevard and Jefferson Road. The body will also discuss a text amendment to the Code of Ordinances regarding demolition review procedures.

zoningland-useordinancesdemolitionplanned-development
✓ Decided: Commission recommends approving Rockwood Blvd rezoning with conditions (5-1)

The Planning Commission voted 5-1 to recommend approval of the Rockwood Boulevard rezoning request with specific development conditions. A text amendment to the demolition review procedures was also recommended for approval unanimously. The commission unanimously approved the meeting minutes and the introductory staff reports.

Wed Jun 4, 2025

Arena District Steering Committee

Arena District Steering Committee to review pro forma and parking deck updates

The committee will review an updated detailed pro forma and receive updates on the parking deck. Members will also discuss the search for a development facilitator, including the RFPQ document and timeline.

arena-districteconomic-developmentparkinginfrastructure
✓ Decided: Committee unanimously accepted FY26 Pro Forma and set reporting requirements

The steering committee approved its agenda and the draft minutes from April 30, 2025 without dissent. Commissioners Wright and Culpepper moved to accept the FY26 pro forma and require future pro formas to include current and prior fiscal year actuals each quarter, which passed unanimously. The committee also approved a subcommittee of three members to represent the full committee in scoring development‑facilitator proposals, and then adjourned the meeting unanimously.

Wed Jun 4, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

Keep Athens-Clarke County Beautiful Board approves financial and director reports

The Keep Athens-Clarke County Beautiful Board met to review organizational updates. The board approved the minutes, the treasurer's report on income and expenses, and the Executive Director's report.

community-beautificationboard-meetingfinancial-report
Tue Jun 3, 2025

TAD Advisory Committee- West Broad/Hawthorne Area

West Broad/Hawthorne TAD Committee to discuss outreach and priority lists

The West Broad/Hawthorne Area Tax Allocation District Advisory Committee will provide an update on the Community-Identified Priority List. The committee will also discuss opportunities for Daniel Young to increase TAD awareness through outreach to developers, realtors, and community organizations.

tax-allocation-districtcommunity-outreacheconomic-developmentathens-ga
✓ Decided: Committee approved the meeting agenda unanimously

The advisory committee unanimously approved the meeting agenda. The May 7, 2025 minutes were approved with a modification to section 6.E., receiving four votes in favor and one abstention. The next meeting was scheduled for September 2, 2025, and the meeting was adjourned unanimously.

Tue Jun 3, 2025

Mayor & Commission Meetings

Athens-Clarke County to hold public hearing on proposed FY26 budget

The Mayor and Commission will hold a public hearing on the recommended FY26 budget and consider the issuance of Series 2025 Water and Sewer Refunding Bonds. The body will also review several rezoning requests and ordinances related to short-term rentals and RV occupancy.

budgetzoningbondshousingtransportationordinances
✓ Decided: Commission approved $134M water and sewer bond issuance

The commission suspended rules for all new‑business items and reordered the agenda to address appointments and the water/sewer bond. It adopted a supplemental bond ordinance authorizing $134,060,000 in water and sewer revenue refunding bonds and authorized the mayor and staff to execute the necessary documents. The commission also approved nominations for County Attorney, Internal Auditor, Personnel Hearing Officer, and acting charter officers.

Tue Jun 3, 2025

Mayor & Commission Meetings

Appeal of historic preservation denial for 120 West Cloverhurst Avenue

The Mayor and Commission will hold a special session to consider an appeal regarding a Certificate of Appropriateness for 120 West Cloverhurst Avenue. The appeal follows a unanimous decision by the Historic Preservation Commission to deny modifications to a garage construction design.

historic-preservationzoningpublic-hearingconstruction
✓ Decided: Historic Preservation appeal upheld, commission modifies determination

The commission voted 5‑3 to find the Historic Preservation Commission did not abuse its discretion and to approve and modify its determination for 120 West Cloverhurst Avenue. Commissioners Hamby, Wright, Fisher, Culpepper, and Thornton voted YES; Link, Taylor, and Myers voted NO. A separate motion to adjourn was approved unanimously. The meeting adjourned at 5:46 p.m.

Tue Jun 3, 2025

Mayor & Commission Meetings

Athens-Clarke County holds special session for real estate discussion

The Mayor and Commission are meeting for a special called session. The purpose of the meeting is to enter an executive session to discuss the acquisition or disposal of real estate.

real-estateexecutive-session
✓ Decided: Commission entered and adjourned executive session unanimously

The commission held a special session to discuss real estate matters. A motion to enter executive session was made and passed unanimously. A motion to adjourn the executive session was then made and also passed unanimously. No other substantive actions were taken.

Mon Jun 2, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee to review and vote on Round 2 project results

The committee will review voting numbers from Round 2 and decide on a results threshold. Members will discuss these results and consider holding a Round 3 vote during the meeting.

transportationsplostinfrastructureplanning
✓ Decided: Committee advanced Projects #23, #46, and #67 to the final recommended list.

The TSLOST Advisory Committee approved the May 19, 2025 minutes unanimously. It removed projects that received low vote totals and advanced three high‑vote projects to the final recommended list. The committee also approved voting from home for the next week.

Wed May 28, 2025

Deferred Compensation Board

Deferred Compensation Board to review investment performance and policy

The Board will review quarterly fund performance and plan charges provided by Corebridge Financial. Members will discuss plan design and the annual approval of the Investment Policy Statement.

investmentsemployee-benefitsbudgetgovernance
Wed May 28, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Special meeting to discuss ARPA small business grants

The Joint Development Authority will hold a special called meeting to review the ARPA Small Business Grant Program. The session includes approval of the agenda and minutes, a staff report, and setting the next regular meeting date.

arpa-grantssmall-businessmeeting-procedural
✓ Decided: JDA unanimously approved the ARPA Small Business Grant Program with added COVID‑19 language

The Joint Development Authority approved its draft agenda and the minutes from the May 7 regular meeting, both unanimously. It also approved the ARPA Small Business Grant Program, adding a requirement that applicants attest to COVID‑19 impact, and directed the program to the city manager for review. The Authority authorized staff to send a letter to the city manager about a funding delay and then adjourned the meeting.

Wed May 28, 2025

Human Relations Commission

Human Relations Commission meets Wednesday to review education session and plan June outreach

The Athens-Clarke County Human Relations Commission holds a special called meeting to accept minutes, receive a chairperson’s update, and discuss education sessions and upcoming tabling events. No formal decisions are listed; the agenda is procedural with public comment periods.

human-relationspublic-commenteducationoutreachboilerplate
✓ Decided: Commission approved outreach apparel purchases and shifted chair update

The Human Relations Commission accepted the minutes from the previous meeting. It voted to move the chairperson’s update to after old business. The commission approved purchasing outreach banners, t‑shirts and polos for future events. No other substantive actions were decided.

Tue May 27, 2025

Athens in Motion Commission

Athens in Motion Commission to review TSPLOST 2026 voting and safety reports

The commission will discuss the first round of voting for TSPLOST 2026 projects and receive plan revision updates. Staff will provide reports on park planning, transit, and monthly crash data for March and April.

transportationtsplostbike-pedestrian-safetyvision-zerourban-planning
✓ Decided: Commission unanimously approved the meeting agenda

The agenda for the May 27, 2025 Athens in Motion Commission meeting was approved unanimously after a motion and second. No public comments were received. The meeting was then adjourned following a motion to adjourn. No other substantive actions or votes were recorded.

Tue May 27, 2025

Airport Authority

Athens Ben Epps Airport Authority to meet May 27

The Airport Authority will review financial and operations reports and provide updates on capital improvement projects. The body will also discuss the Lexington Corridor and introduce new members.

airportinfrastructureaviationgovernment
✓ Decided: Airport Authority approves April minutes and appoints new members

The Authority unanimously approved the April meeting minutes. New members William Felt and Elizabeth Higgins were appointed to begin service on July 1, 2025, and Sonny Wilson was confirmed to fill the remainder of Jeff Benjamin's term. The meeting was adjourned by a unanimous motion.

Thu May 22, 2025

Mayor & Commission Meetings

Mayor and Commission to review and discuss FY26 Budget

The Mayor and Commission are meeting to review and discuss the FY26 Budget. The agenda also includes a Special Called Session in Executive Session.

budgetfinancegovernment
✓ Decided: No decisions made; meeting discussed FY26 budget

The commission met to discuss the FY26 mayoral budget proposal and gave closing remarks. No votes were taken and no actions were approved, denied, or tabled.

Thu May 22, 2025

Mayor & Commission Meetings

Cancelled meeting to discuss litigation in private session

The Athens-Clarke County Mayor and Commission called a special session on May 22, 2025, but the meeting was cancelled. The stated purpose was to enter executive session to discuss threatened or pending litigation with an attorney.

cancellationlitigationexecutive-session
Thu May 22, 2025

SPLOST Site Selection Committees

Committee reviews Judicial Center site selection progress

The Athens-Clarke County Judicial Center Site Selection Committee meets to receive an update on the Judicial Center site selection process. Mayor Kelly Girtz provides the update, and the committee discusses the next meeting date.

zoningcapital-projectssplostjudicial-centercommittee
Wed May 21, 2025

Solid Waste Advisory Commission

Solid Waste Advisory Commission to review litter and battery safety campaigns

The Commission will review reports on landfill status, recycling, and collections. The meeting includes discussions on a litter and beautification review and a public relations campaign regarding batteries.

waste-managementrecyclingbeautificationpublic-safety
Wed May 21, 2025

Historic Preservation Commission

Historic Preservation Commission reviews five property alteration requests

The Athens-Clarke County Historic Preservation Commission will meet in person to review five Certificates of Appropriateness for property alterations in historic districts. The meeting includes adoption of minutes, committee reports, and public hearings on proposed new construction, additions, garage replacements, and window replacements.

historic-preservationzoningbuena-vistacobbhamconstructionwindowsgarage
✓ Decided: Historic Preservation Commission approves five property modifications, all unanimously

The Athens-Clarke County Historic Preservation Commission approved five Certificate of Appropriateness requests, each with conditions, and each vote was 5-0. The approved projects were at 1130 Boulevard, 1233 Boulevard, 317 Franklin Street, 232 Satula Avenue, and 360 North Church Street. All procedural motions, including adoption of minutes and staff reports, also passed unanimously.

Wed May 21, 2025

Human Relations Commission

Human Relations Commission reviews past work and plans summer activities

The Athens Human Relations Commission holds a special meeting to accept past minutes, receive a chairperson’s update, and hear public comment on old and new business. The commission will also discuss upcoming summer education sessions and July retreat plans.

human-relationspublic-commenteducationcommunity-outreachlocal-government
Wed May 21, 2025

Pension Board

Athens Pension Board to review investments, policies, and membership

The Athens-Clarke County Pension Board will meet to approve past meeting minutes, review pension investment activity through April 2025, and discuss retirement plan design updates. The board will also adopt its FY26 meeting calendar and work plan, and review its membership composition.

pensioninvestmentsretirement-plansfiscal-year-2026board-membership
✓ Decided: Board adds Pomona Capital XI private‑equity fund to pension portfolio

The board unanimously approved adding Pomona Capital XI as a private‑equity allocation to the pension fund’s investment portfolio. It also approved the FY26 meeting calendar and the FY26 work plan, which includes an amendment to schedule the annual election of the vice chair on August 6, 2025. Earlier items such as the prior meeting minutes and the addition of the private‑equity fund were approved unanimously. The meeting was adjourned at 10:49 a.m.

Tue May 20, 2025

Mayor & Commission Meetings

Mayor and Commission to hold public hearing on FY26 budget

The Athens-Clarke County Mayor and Commission will hold a public hearing on the proposed FY26 budget. The meeting also includes a consent agenda with funding allocations for energy efficiency grants, parking deck repairs, road projects, and housing initiatives, as well as zoning and land-use decisions.

budgetzoninghousingroadsparksenergy-efficiencypublic-hearing
✓ Decided: Commission approved motion to adjourn; no decisions were made

The meeting concluded with a motion to adjourn that was approved by the commission. No votes were taken on any agenda items, and no substantive decisions, approvals, or denials were recorded.

Tue May 20, 2025

Mayor & Commission Meetings

Special session called to discuss personnel matters in private

The Athens-Clarke County Mayor and Commission will hold a special called session to enter executive session for discussion of personnel matters under Georgia state law. No public votes or decisions are scheduled.

personnelexecutive-sessiongovernment
Tue May 20, 2025

Mayor & Commission Meetings

Executive session called for personnel matters only

The Mayor and Commission will hold a special called session to enter executive session for discussion of personnel matters as permitted under Georgia state law. No substantive decisions or votes are scheduled.

personnelexecutive-sessiongovernment-procedure
✓ Decided: Commission approved entering executive session and adjourned unanimously

The commission entered executive session to discuss confidential personnel matters. A motion to enter executive session and adjourn was made, seconded, and passed by a unanimous vote. The meeting adjourned at 5:40 p.m.

Tue May 20, 2025

Mayor & Commission Meetings

Athens-Clarke County to hold public hearing on proposed FY26 budget

The Mayor and Commission will hold a special called session to conduct a public hearing. The purpose of the meeting is to receive public input on the proposed FY26 budget.

budgetpublic-hearingfinance
✓ Decided: Commission voted unanimously to adjourn the special session

The commission held a public hearing on the proposed FY26 budget but took no budget actions. Commissioner Wright moved to adjourn, Thornton seconded, and the motion passed unanimously. The meeting adjourned at 7:24 p.m.

Mon May 19, 2025

TSPLOST Oversight Committee

Oversight Committee to review Prince Avenue and N. Athens transportation concepts

The TSPLOST Oversight Committee will discuss proposed project concepts for transportation improvements on Prince Avenue/Jefferson Road and N. Athens. The body will also review monthly revenue and expenditure reports for the 2018 and 2023 TSPLOST programs.

tsplosttransportationroadsinfrastructurebudget
Mon May 19, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee to review and discuss Round 1 voting results

The TSPLOST Advisory Committee will meet to review numerical results from the first round of voting. The committee will vote to set a results threshold and discuss specific project names associated with the votes.

tsplosttransportationvotinginfrastructure
✓ Decided: Committee advances Milledge Makeover project and removes low‑vote projects

The committee unanimously approved the May 5, 2025 meeting minutes. It voted 8‑1 to remove projects that received only 0 or 1 votes. A motion to remove projects with 2 votes failed 4‑5. The Milledge Makeover project (project 34) was moved forward to the final recommended list unanimously. A motion to advance all 9‑vote projects except project 19 was rejected 4‑6.

Mon May 19, 2025

TAD Advisory Committee - Newton Bridge Area

Newton Bridge Road TAD Committee discusses development and fund access

The Newton Bridge Road Tax Allocation District (TAD) Advisory Committee is meeting to discuss the TAD area and future development. The committee will review a process to streamline access to limited funds and provide updates on corridor projects.

tax-allocation-districteconomic-developmentinfrastructuretraffic-studynewton-bridge-road
✓ Decided: Committee unanimously approved agenda, minutes and adjourned

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the January 13, 2025 meeting. No substantive policy or funding decisions were made. The committee then adjourned unanimously.

Wed May 14, 2025

Hearings Board

Board to weigh variance waiving development limits at 475 First Street

The Athens-Clarke County Hearings Board will hear five variance requests at its May 14 meeting. Petitioners seek exemptions from zoning rules for residential development, a church expansion, and a downtown coffee shop sign. No decisions are made at this meeting; the board will discuss and potentially rule on each request.

hearings-boardvarianceszoningresidential-developmentchurchsignagesidewalkathens-clarke-county
✓ Decided: Board approves 170 International Drive lot‑increase variance, tables 359 Hancock signs

The Hearings Board approved variances for 475 First Street, 170 International Drive, 1125 Newton Bridge Road, and 6425 Jefferson Road. It denied the sign variance at 359 West Hancock Avenue and voted to table both sign variances there until the July meeting. All other items were procedural.

Tue May 13, 2025

Mayor & Commission Meetings

Commission reviews FY26 budget with elected officials

The Mayor and Commission hold a budget review session, meeting individually with constitutional and elected officials including the Tax Commissioner, Sheriff, and judges. This is a working session to discuss the FY26 budget ahead of public hearings and final adoption in June. The agenda also outlines upcoming public hearings and the adoption schedule.

budgetpublic-hearingmillage-ratetaxcommission-review
✓ Decided: No decisions made at the May 13 budget meeting

The commission met on May 13, 2025 to discuss budget requests from elected officials and the FY26 mayor’s proposed budget. No votes were taken and no actions were approved, denied, or tabled.

Tue May 13, 2025

Mayor & Commission Meetings

Mayor & Commission to hold special session for personnel matters

The Unified Government of Athens-Clarke County will hold a special called session. The purpose of the meeting is to enter into an executive session to discuss confidential personnel matters.

personnelexecutive-sessiongovernment-administration
✓ Decided: Commission entered executive session and adjourned by unanimous vote

The commission voted unanimously to enter executive session to discuss confidential personnel matters. They then voted unanimously to adjourn the meeting.

Tue May 13, 2025

Mayor & Commission Meetings

Work session to review countywide data strategy and capital projects

The Mayor and Commission will hold a work session to discuss several items for future consideration, including a countywide data strategy, proposed corridor improvements on Prince Avenue/Jefferson Road, TSPLOST 2023 project 14 in North Athens, a Leisure Services Master Plan, youth facility partnerships, the Center for Racial Justice & Black Futures, and next steps for North Avenue. No final votes will be taken; the session is informational only.

work-sessiondata-strategytransportationcapital-projectsleisure-servicesracial-justiceyouth-enrichmenttsplost
✓ Decided: Commission work session held; no decisions were made

The May 13, 2025 work session of the Athens-Clarke County Mayor and Commission discussed several items for future consideration, including the County Data Alliance, Prince Avenue Jefferson Road Corridor, TSPLOST Project 14, Leisure Services Master Plan, youth and community enrichment facility partnerships, the Center for Racial Justice & Black Futures, and North Avenue next steps. No actions were approved, denied, or tabled, and no votes were recorded. The meeting adjourned at 2:52 p.m.

Mon May 12, 2025

Athens Cultural Affairs Commission

Cultural Affairs Commission to vote on library recommendation

The Athens Cultural Affairs Commission will vote on a library recommendation and review ongoing projects, including a mural installation at the Greenway Loop and a new call for artists at the Costa Building. The commission will also hear updates on Poetry Month events and a Bishop Park selection. New members Nasrin and Elizabeth will be welcomed.

artsculturepublic-artlibrarymuralspoetrymeeting
Mon May 12, 2025

SPLOST Oversight Committee

Committee to consider $1.58M solar and efficiency upgrade for East Side Library

The SPLOST 2020 Oversight Committee will vote on a proposed project concept to reallocate $1,582,000 for solar panels and energy efficiency upgrades at the East Side Library. The committee will also approve minutes from the April 21 meeting and review monthly reports on SPLOST program finances and project updates.

splostoversight-committeerenewable-energyenergy-efficiencysolareast-side-libraryathens-clarke-county
Thu May 8, 2025

Mayor & Commission Meetings

Mayor & Commission hold FY26 budget overview and review

This meeting is dedicated to the FY26 budget overview presented by Mayor Girtz, followed by commission review and discussion. The meeting includes a break and continues with further budget discussion. Upcoming budget meetings and a public hearing are scheduled for May 13, 15, 20, and possibly May 22.

budgetfiscal-year-2026mayor-and-commissionpublic-hearing-scheduled
✓ Decided: Commission discussed budget items, but made no decisions

The May 8, 2025 meeting of the Athens-Clarke County Mayor and Commission was held at the Planning Auditorium. Commissioners reviewed the remaining budget public and TBOR hearing calendar and allowed time for questions and comments. No votes were taken and no actions were approved, denied, or tabled.

Thu May 8, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD committee to discuss affordable housing and infrastructure

The East Downtown Tax Allocation District Advisory Committee will discuss affordable housing strategies and hear presentations on public infrastructure improvements from ACCGov departments and Historic Athens. The meeting also includes welcoming new members and approving previous minutes.

tax-allocation-districtaffordable-housingpublic-infrastructuredowntown-developmentathensadvisory-committee
✓ Decided: No official decisions made; quorum absent

The East Downtown TAD Advisory Committee meeting on May 8, 2025 did not have a quorum, so no official business was conducted. The Finance Department reported a projected TAD fund balance of $865,129.39 as of 12/31/24, with $605,590.57 designated for the east side of the North Oconee River and $259,538.82 for the west side. Guest speakers provided updates on public utilities, transportation projects, and historic preservation, but no actions were approved or denied.

Wed May 7, 2025

TAD Advisory Committee- West Broad/Hawthorne Area

Committee to vote on Community-Identified Priorities List

The West Broad/Hawthorne Area TAD Advisory Committee will meet to discuss new business. The committee is scheduled to vote on a Community-Identified Priorities List for the Mayor and Commission to consider.

tax-allocation-districtcommunity-prioritiesurban-development
✓ Decided: Committee approved community priority list for TAD fund allocation

The West Broad/Hawthorne Area TAD Advisory Committee unanimously approved its agenda and the minutes from the March 4, 2025 meeting. New member Heidi Davison was welcomed. The committee also unanimously adopted the Community‑Identified Priority List, allocating 50% to public infrastructure, 25% to economic development, 15% to housing, and 10% to youth development. No other substantive actions were taken.

Wed May 7, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA to consider ARPA workforce grants and property acquisition

The Joint Development Authority will discuss a new ARPA-funded Workforce Development and Small Business Grant Program, hold an executive session on property acquisition, and receive updates on the Turntable Revolving Loan Fund. Routine items include approval of minutes, new member and counsel introductions, and the treasurer's report.

economic-developmentgrantsworkforcesmall-businesspropertyloanspublic-finance
✓ Decided: Board tables ARPA grant program discussion and schedules special meeting

The directors unanimously approved the agenda and the minutes from the February 5, 2025 meeting. New director Amanda Mooney and new counsel Emily Escoe were introduced. The discussion of the ARPA Workforce Development Small Business Grant Program was tabled and a special meeting was set for May 28, 2025 to finalize it. The board also moved to close the meeting for an executive‑session property‑acquisition discussion and then adjourned.

Wed May 7, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB Board approves $150 for popsicles, appoints new members

The Keep Athens-Clarke County Beautiful Board met on May 7, 2025, and approved the minutes, treasurer's report, and executive director's report. A motion to spend $150 on popsicles was approved unanimously. The board also appointed new board member positions under new business.

keep-athens-clarke-county-beautifulboardpopsiclesappointments
✓ Decided: Board approved next year’s officer slate, naming Chico Rozier as treasurer

The board approved the March meeting minutes and the Treasurer’s financial report. A $150 request for popsicles for a litter‑pickup event was approved. The “Tired of Trash Tracker” recycling event was approved. The board also approved the upcoming officers, appointing LaDarius Thomas as Chair, Ezra Schley as Vice‑Chair, Catie Floyd as Secretary, and Chico Rozier as Treasurer.

Tue May 6, 2025

Mayor & Commission Meetings

Commission to consider 207-acre residential development on Atlanta Highway despite denial recommendation

The Mayor and Commission will vote on consent agenda items including TSPLOST greenway projects and grant acceptances, hold public hearings on several rezoning and special use requests (with planning commission recommendations), and consider new business such as animal services contingency funding and HVAC repairs.

zoningpublic-hearingtsp-lostgreenwayresidential-developmentcommercial-barpublic-librarybudget-amendment
✓ Decided: Commission approved multiple funding ordinances, including a $1.987 M airport taxiway project

The commission unanimously consented to twelve items covering transit, greenway, police, and housing initiatives. It adopted ordinances to add $153,310 from Georgia Power for an Oconee Rivers underpass, up to $400,000 FHWA grant for a greenway trail, and a $1.654 M GDOT grant for airport taxiway rehabilitation, among other actions. It also approved several grant applications and plans, including the FY26 CDBG and HOME action plans and a HUD EDI grant request of up to $721,000. All actions were authorized for the mayor and staff to execute.

Tue May 6, 2025

TAD Advisory Committee - Lexington Road

Lexington Road TAD Committee to vote on community priority list

The Lexington Road Tax Allocation District (TAD) Advisory Committee will hold a regular meeting to vote on a Community-Identified Priority List and discuss consolidating the TAD Advisory Committee. The committee will also welcome new members and approve previous meeting minutes.

tax-allocation-districtadvisory-committeelexington-roadcommunity-prioritiesconsolidationathensgeorgia
✓ Decided: Committee approves 100% of TAD funds for public infrastructure

The advisory committee voted to allocate all TAD funds to public infrastructure improvements (4‑0‑1 abstain). It also unanimously opposed consolidating the TAD advisory committees. The agenda, minutes, and adjournment were approved unanimously.

Mon May 5, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee to preview voting spreadsheet for 2026 projects

The TSAC will preview a voting spreadsheet for TSPLOST 2026 projects and hold a round-robin discussion on projects. They will also vote on approving minutes from the April 21 meeting. The committee continues preparations for project selection.

tspolsttransportationadvisory-committeeathens-georgiameetingvotingprojects
✓ Decided: Committee unanimously approved April 21 minutes

The TSAC approved the minutes from the April 21, 2025 meeting with a unanimous vote. No other actions or votes were taken at this meeting. The committee will conduct its first official round of voting within the next two weeks and will discuss the results at the May 19 meeting.

Thu May 1, 2025

Mayor & Commission Meetings

Committee to discuss updating noise ordinance for residential and downtown zones

The Legislative Review Committee will discuss potential updates to the noise ordinance, focusing on non-agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district. The committee may also consider adopting objective volume measures. The agenda also includes approval of previous minutes and public input on the item.

noisezoningdowntownagricultural-residentialordinancepublic-hearingcommittee
✓ Decided: Committee approved March minutes and postponed downtown noise discussion

The Legislative Review Committee unanimously approved the March 6, 2025 minutes and then adjourned the meeting. Members agreed to defer further discussion of downtown noise concerns to a future meeting. Staff were asked to return with possible revisions to the special‑event permit and to consider noise impacts in agricultural zones. The next meeting is set for June 5, 2025.

Thu May 1, 2025

Mayor & Commission Meetings

Commission to hold executive session on personnel matters

This is a special called session of the Mayor and Commission solely to enter an executive session to discuss confidential personnel matters, as permitted by Georgia law. No other business or public decisions are scheduled.

personnelexecutive-sessiongovernment-procedureathensclarke-countymayor-and-commission
✓ Decided: Commission voted unanimously to enter executive session

The commission unanimously approved entering executive session to discuss confidential personnel matters. Afterward, they unanimously approved adjourning the meeting. No other actions were taken.

Thu May 1, 2025

Mayor & Commission Meetings

FY26 budget hearing: $13.2M requested for quasi-governmental agencies, up 7.3%

The Mayor and Commission are holding a public hearing to discuss FY26 funding requests from quasi-governmental and other agencies. The total request is $13.2 million, a 7.3% increase from FY25, with $7.7 million from the general fund. Agencies include the Athens Regional Library System, Classic Center Authority, Western Judicial Circuit Public Defender, and others. No votes are scheduled; this is a hearing to review the requests.

budgetquasi-governmentallibrarypublic-defenderhotel-motel-taxclassic-centerbehavioral-healthfy26
Thu May 1, 2025

Planning Commission

Planning Commission to consider short-term rental regulations

The Athens-Clarke County Planning Commission will hold a public hearing and consider multiple items, including two text amendments to the Code of Ordinances regarding short-term rentals and recreation vehicle occupancy, as well as several rezoning, special use, and planned development requests. The meeting will also include approval of previous minutes and a MACORTS review.

planning-commissionzoningshort-term-rentalsrecreation-vehiclesrezonespecial-useplanned-development
✓ Decided: Planning Commission approves rezoning of Newton Bridge Road and several special uses

The commission approved the rezoning of parcels on Newton Bridge Road to Mixed Density Residential with conditions, passing both the future land use and zoning motions unanimously. It also approved special‑use permits for 581 S. Harris Street (5‑1), 284 Bailey Street (unanimously) and 1580 Barnett Shoals Road (unanimously). The commission adopted a recommendation to improve short‑term‑rental enforcement, passing 4‑3. All other items were noted as comment‑only.

Wed Apr 30, 2025

Arena District Steering Committee

Committee to finalize Development Facilitator job description for Arena District

The Arena District Steering Committee will approve previous meeting minutes, hear an updated parking plan report from the Classic Center Authority, and finalize the job description for a Development Facilitator role.

arena-districtsteering-committeeparkingdevelopment-facilitatorclassic-centerjobs
✓ Decided: Committee approves revised Development Facilitator job description with added qualifications

The steering committee amended the agenda to add Item D for pro forma clarification and approved the April 4, 2025 meeting minutes, both unanimously. It approved the revised Development Facilitator job description with naming and qualification amendments. The committee adopted the August 2024 detailed pro forma format for future quarterly updates and set the next meeting for June 4, 2025 at 10 a.m. The meeting was then adjourned unanimously.

Sat Apr 26, 2025

Athens in Motion Commission

Athens in Motion Commission workshop to shape future walking and biking network

The Athens in Motion Commission holds a two-day workshop to review and update the 2018 Athens in Motion Plan, focusing on goals, community engagement, network connectivity, and project prioritization. The workshop includes a walking tour, group bike ride, and a design charrette for bicycle and pedestrian improvements. Commissioners will provide input on strategies and criteria for investment.

walkingbikingtransportation-planningcommunity-engagementinfrastructureathens
Fri Apr 25, 2025

Athens in Motion Commission

Athens in Motion Commission to hold workshop on walking and biking networks

The Athens in Motion Commission is holding a two-day workshop to update goals and strategies for walking and biking in Athens. Commissioners will review community engagement findings, map priority routes, and develop design improvements for bicycle and pedestrian infrastructure.

bikingpedestrian-safetyurban-planningtransportationinfrastructure
Thu Apr 24, 2025

Airport Authority

Athens Ben Epps Airport Authority to discuss leadership and strategic planning

The Airport Authority will review financial and operations reports and provide updates on capital improvement projects. The body will discuss the Lexington Corridor and the selection of a Vice Chair. Members will also review the final version of a Fact Sheet and revisions to Goal 4(1) of the Strategic Plan.

airportleadershipstrategic-planninginfrastructure
✓ Decided: Authority members unanimously confirmed Mr. Sanders as Vice Chair

The board unanimously approved the March meeting minutes. Members voted unanimously to confirm Mr. Sanders as Vice Chair through the end of the year. The board approved the list of options for distributing the airport Fact Sheet and chose an inexpensive two‑sided version for large‑scale distribution. The meeting was adjourned by unanimous vote.

Mon Apr 21, 2025

Mayor & Commission Meetings

Government Operations Committee to review BAC procedures

The Government Operations Committee will meet to recommend updates to BAC procedures. The committee will also track several items assigned for future consideration regarding leasing policies, rental ordinances, and employee engagement.

government-operationsleasing-policyshort-term-rentalsrenter-protectionsemployee-engagement
Mon Apr 21, 2025

TSPLOST Oversight Committee

TSPLOST committee to vote on East Athens transit shelter, sidewalk concept

The TSPLOST Oversight Committee will consider confirming that the proposed concept for TSPLOST 2023 Project 10, East Athens Transit Improvements Sub-Project #1, is consistent with the initial project statement. The concept includes installing sheltered transit stops, sidewalks, lighting, and safety improvements at five locations such as Peter Street and Vine Street. The committee will also approve minutes from January and March meetings and review monthly program reports.

tsplosttransitsidewalkseast-athenspedestrian-safetyinfrastructureathens
Mon Apr 21, 2025

SPLOST Oversight Committee

Committee to review E911 phone system replacement project

The SPLOST Oversight Committee will meet to discuss the proposed project concept for the E911 Phone System Replacement Project. The body will also review monthly project updates and expenditure reports for the 2005, 2011, and 2020 SPLOST programs.

sploste911public-safetybudgetinfrastructure
Mon Apr 21, 2025

TSPLOST 2026 Advisory Committee

Committee to hear presentations on Milledge Makeover and Pilot Neighborhood Transportation projects

The TSPLOST 2026 Advisory Committee will hear presentations on two projects: Project #34 (Milledge Makeover) and Project #40 (Pilot Neighborhood Transportation Improvements Program). The committee also plans to review previous discussion, receive a tutorial on the voting system, and consider selection criteria. No votes are scheduled for this meeting.

transportationroadssafetypedestrianbicyclepublic-hearingcommittee
✓ Decided: Committee unanimously approved the April 14, 2025 meeting minutes

The TSPLOST Advisory Committee voted to approve the minutes from the April 14, 2025 meeting. The motion was made by Stephen Wright, seconded by Carl Blount, and passed unanimously. No other TSAC actions or votes were taken at this meeting.

Wed Apr 16, 2025

Solid Waste Advisory Commission

Commission to discuss battery dangers and plastic bag ban update

The Solid Waste Advisory Commission will receive reports on landfill status, recycling facility, and collections, and discuss a May 3 community cleanup. New business includes a presentation on battery hazards in waste. The committee will also receive updates on long-standing items: a proposed plastic bag and Styrofoam ban ordinance requiring data collection, and referrals from the Mayor and Commission on residential collection zones and environmental justice.

solid-wasterecyclinglandfillplastic-bag-banbattery-hazardsenvironmental-justicecomposting
Wed Apr 16, 2025

Historic Preservation Commission

HPC to consider demolition and new construction at 541 Nantahala Ave

The Historic Preservation Commission will vote on five Certificate of Appropriateness requests, including full demolition and new construction, modifications to walkways, windows, and porches. A conceptual design review for a new house and garage at 1130 Boulevard is also on the agenda. Additionally, the commission will receive updates on the strategic plan and committee reports.

historic-preservationcertificate-of-appropriatenessdemolitionnew-constructiondesign-reviewcommittee-updates
✓ Decided: Commission approved five historic‑preservation projects, all by unanimous vote

The Athens‑Clarke County Historic Preservation Commission approved five project applications, each passing with a 4‑0 vote. Approvals included demolition and new construction at 541 Nantahala Ave, modifications at 317 S. Milledge Ave and 180 Woodlawn Ave, a side‑porch enclosure at 147 Hall St, and rear‑wall and front‑entry changes at 290 W. Clayton St. No other substantive actions were taken.

Wed Apr 16, 2025

Human Relations Commission

Human Relations Commission to vote on bylaws and review Juneteenth coordinator

The Human Relations Commission will meet to vote on its bylaws and review a recommendation for a Juneteenth event coordinator. The body will also discuss educational sessions and upcoming event tabling.

human-relationsbylawsjuneteenthcommunity-events
✓ Decided: Committee approved moving forward with the Menstrual & Diaper Project

The Human Relations Commission accepted the minutes from the previous meeting. It voted to move forward with the Menstrual & Diaper Project proposal. It also voted to amend the agenda to review the commission bylaws. No other substantive decisions were recorded.

Tue Apr 15, 2025

Mayor & Commission Meetings

Consider first amendment to acting manager Brad Griffin's employment agreement

The Mayor and Commission are holding a special called session to consider a first amendment to the employment agreement with Acting Manager Brad Griffin. Public input is allowed on this single agenda item. No other substantive business is listed.

employmentgovernmentpublic-meetingathens-clarke-county
✓ Decided: Mayor extends Acting Manager contract through June 3, 2025

The Commission unanimously suspended its rules to consider a new business item. It then unanimously approved Mayor Girtz's recommendation to extend Acting Manager Bradley A. Griffin's contract through June 3, 2025 and to execute the first amendment to his employment agreement. Mayor Girtz announced new members for several Tax Allocation District committees. The meeting was adjourned unanimously.

Tue Apr 15, 2025

Mayor & Commission Meetings

Acting Manager Brad Griffin's contract extended to June 4, 2025

The Mayor and Commission will hold a special called session to discuss real estate acquisition, then consider and likely approve an amendment extending Acting Manager Brad Griffin's term to June 4, 2025. Following that, an Agenda Setting Session will review consent agenda items including budget amendments for greenway and transit projects, a grant for the drug task force, and the School Resource Officer program contract. The commission will also receive staff reports on several zoning and ordinance amendments, with public input allowed.

acting-manageremployment-agreementbudgettsplostgreenwaypoliceschool-resource-officerzoning
✓ Decided: Commission adjourned; no votes taken on agenda items

The Mayor and Commission meeting was adjourned at 8:51 p.m. after a motion by Commissioner Fisher was seconded by Commissioner Link and approved. No votes were taken on any of the agenda items discussed.

Tue Apr 15, 2025

Mayor & Commission Meetings

Commission to hold closed session on real estate acquisition or disposal

This is a special called session with the sole purpose of entering executive session to discuss real estate acquisition and/or disposal. No votes or public decisions are scheduled; the agenda consists only of roll call, a statement of purpose, entering closed session, and adjournment.

real-estateexecutive-sessionprocedural
✓ Decided: Commission voted unanimously to enter executive session and adjourn

Commissioners Davenport and Wright moved, and the commission unanimously approved, a motion to enter executive session to discuss real estate matters and then adjourn the meeting. No other actions were taken.

Mon Apr 14, 2025

Athens Cultural Affairs Commission

Commission to vote on library recommendation, discuss park selection and update

The Athens Cultural Affairs Commission will vote on a library recommendation, discuss the Bishop Park selection process, and receive an update on the Linnentown project. The commission also recognizes Poetry Month and plans outreach for summer festivals and a July Poetry in the Park event.

artsculturelibraryparkspublic-artcommunity-events
Mon Apr 14, 2025

TSPLOST 2026 Advisory Committee

TSPLOST committee hears 7 project presentations, introduces voting system

The TSPLOST Advisory Committee will hear presentations on seven proposed transportation projects, including bike lanes, crosswalks, and corridor improvements. The committee will also finalize previous meeting minutes and introduce its voting system for project prioritization.

transportationtsplostadvisory-committeebike-lanespedestrian-safetycomplete-streetsathens
✓ Decided: Committee unanimously approved April 7 meeting minutes

The advisory committee voted to approve the minutes from the April 7, 2025 meeting. The motion was made by Carey Rivers, seconded by Bryan Gomez, and passed unanimously. No other actions or votes were taken on the presented projects.

Tue Apr 8, 2025

Mayor & Commission Meetings

Eminent domain for W. Broad pedestrian improvements

The Mayor and Commission will hold a special called session to consider right-of-way acquisition and eminent domain for TSPLOST 2018 Project 13, specifically the W. Broad Street and W. Hancock Avenue roundabout sub-project for pedestrian improvements. This is the only substantive item on the agenda. Public input will be allowed.

transportationinfrastructureeminent-domainpedestrian-safetytsplostathens-clarke-county
✓ Decided: Commission unanimously approved eminent‑domain acquisition for SR 10 @ CR 993/W. Hancock Ave project

The Commission adopted a resolution that authorizes condemnation of the required right‑of‑way and easements for the SR 10 @ CR 993/W. Hancock Ave intersection improvements. The resolution also empowers the Mayor, Manager, County Attorney and Special Counsel to prepare and sign all necessary acquisition documents. The motion to adopt the resolution and the motion to adjourn both passed unanimously.

Tue Apr 8, 2025

Mayor & Commission Meetings

Commission to consider eminent domain for W. Broad/Hancock roundabout

This special called session will consider authorizing eminent domain to acquire rights-of-way for the TSPLOST 2018 Project 13 roundabout at W. Broad Street and W. Hancock Avenue. The resolution would allow condemnation if voluntary property acquisitions fail. Public comment is permitted for up to three minutes per speaker.

tsplosttransportationpedestrian-improvementseminent-domainright-of-wayroundaboutathens-clarke-county
✓ Decided: Commission approved motion to adjourn the meeting

The Mayor & Commission Work Session met on April 8, 2025 at 120 W. Dougherty Street. Commissioners discussed five agenda items but no votes were taken on them. A motion to adjourn, moved by Commissioner Thornton and seconded by Commissioner Davenport, was approved.

Mon Apr 7, 2025

TSPLOST 2026 Advisory Committee

TSAC reviews six transportation project proposals for TSPLOST 2026

This meeting is the seventh presentation session of the TSPLOST 2026 Advisory Committee. Members will review and discuss six specific project proposals covering intersection safety, drainage improvements, and bus route expansions. No votes or decisions are scheduled; the committee is gathering information for future recommendations.

transportationtsplostadvisory-committeeinfrastructureintersection-safetydrainagebus-routeathens-ga
✓ Decided: Committee unanimously approved March 31, 2025 minutes

The TSPLOST Advisory Committee approved the minutes from the March 31, 2025 meeting with a unanimous vote. No other actions or votes were taken at this session. The next committee meeting is scheduled for April 14, 2025 at 5:30 p.m.

Fri Apr 4, 2025

Arena District Steering Committee

Arena District Steering Committee to review bond repayments and parking

The committee will receive presentations on eastern downtown parking needs and bond repayment obligations. Members will consider a motion to establish quarterly performance updates relative to the Classic Center Authority's pro forma.

arena-districtparkingbondseconomic-developmentclassic-center
✓ Decided: Committee approved quarterly updates and set April 30 meeting

The steering committee unanimously approved a motion for quarterly updates on performance relative to the pro forma. They scheduled the next meeting for April 30, 2025 at 10 a.m. The meeting was then adjourned by unanimous vote.

Thu Apr 3, 2025

Audit Committee

Audit committee to review FY25 workplan status and discuss FY26 workplan

The Audit Committee will review and approve minutes from March 6, 2025, receive a status update on the FY25 Audit Workplan including audits, follow-ups, and special projects, and discuss the proposed FY26 Audit Workplan. The meeting also includes an update from the Internal Auditor and scheduling of the next meeting on May 1, 2025. No specific contracts, dollar amounts, or public hearings are on the agenda.

auditcommitteeathensclarke-countygovernmentworkplan
✓ Decided: Audit Committee unanimously approves FY26 Option A audit workplan

The committee approved the March 6 meeting minutes. It voted to adopt the FY26 Option A audit workplan for Fire, Emergency Management and Capital Projects. Members also cancelled the May and July meetings and set the next meeting for June 6, 2025.

Thu Apr 3, 2025

Planning Commission

Planning Commission to consider short-term rental rule changes and 10 land-use items

The Athens-Clarke County Planning Commission will hold a public hearing on April 3, 2025, to decide or discuss 12 items. These include two old business items (a special use and a master planned development amendment) and ten new business items, among them rezonings, special uses, and three text amendments regarding appeals, sign variances, and short-term rentals. The meeting also includes general business such as approval of minutes and a MACORTS review.

zoningplanning-commissionshort-term-rentalsrezonespecial-usetext-amendmentathenspublic-hearing
✓ Decided: Planning Commission approved rezoning of 1075 Gaines School Road with a condition

The commission voted unanimously to approve the rezoning of 1075 Gaines School Road from C‑O (PD) to C‑N, adding a condition that no drive‑through uses are permitted. Several other items were decided: the short‑term rental text amendment was tabled 6‑1; 110 W. Hancock Avenue special‑use request was denied unanimously; the 4500 & 4530 Atlanta Highway master‑planned development amendment was denied unanimously; and three additional rezoning and special‑use requests were approved unanimously.

🏢 Building at this address: Covenant Presbyterian Church
Wed Apr 2, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB Board discusses litter clean-up, fundraising, and board nominations

The Keep Athens-Clarke County Beautiful Board approved minutes, heard the treasurer's report on income and expenses, and reviewed the executive director's report. Committee discussions included a Baxter Street litter clean-up, fundraising events, and feedback to the Government Operations Committee. Under new business, the board discussed forming a nominating committee for new board members starting July 1st.

community-beautificationlitter-cleanupboard-meetingfundraisingnominationsgovernment-committee
✓ Decided: Board approved the Treasurer’s $5,407.46 report with a unanimous vote

The board unanimously approved the March meeting minutes. It also approved the Treasurer’s report showing $5,407.46 in income and $1,245.20 in expenses. The Executive Director’s report was approved without opposition, and the meeting was adjourned by unanimous consent.

Tue Apr 1, 2025

Mayor & Commission Meetings

Commission to consider resolution supporting current Board of Elections composition

The Mayor and Commission will hold a special called session to consider a resolution supporting the current composition of the Athens-Clarke County Board of Elections. The regular meeting includes a consent agenda with multiple items such as adoption of ordinances for special events, aircraft rescue equipment, and transportation planning funding. Public hearings will be held on rezoning requests for a short-term rental at 475 North Church Street and a mixed-use development at 450/460 Gaines School Road, as well as a modification to the Western Downtown Athens Local Historic District. Other items include approval of community partnership funding, various contracts, and discussions on old business items.

electionszoninghistoric-districtshort-term-rentalmixed-use-developmentbondpublic-hearing
✓ Decided: Commission approved $1.37 M funding for an aircraft rescue and fire‑fighting vehicle

The commission adopted a resolution keeping the current Clarke County Board of Elections composition (8‑YES, 2‑NO) and approved several ordinances, including a special‑events fee amendment and funding for an aircraft rescue and fire‑fighting vehicle totaling $1,374,945 (8‑YES, 2‑NO). It also approved $326,150 for the Newton Bridge Tax Allocation District and adopted resolutions recognizing Athens Pride Month and Juneteenth.

Tue Apr 1, 2025

Mayor & Commission Meetings

Commission to vote on resolution maintaining Clarke County Board of Elections composition

The Mayor and Commission are holding a special called session to consider a single item: a resolution to maintain the composition of the Clarke County Board of Elections. Public input will be allowed before a vote. No other business is on the agenda.

electionsboard-of-electionsresolutionathens-clarke-countyspecial-session
✓ Decided: Commission approved $1.37M grant‑funded aircraft rescue fire‑fighting vehicle

The Commission adopted a resolution keeping the current composition of the Clarke County Board of Elections (8‑YES, 2‑NO). It also approved several ordinances, including changes to the special‑events code, funding for an aircraft rescue and fire‑fighting vehicle using $1.374 M in FAA and GDOT grants, $326,150 for Newton Bridge Road improvements, and resolutions recognizing Pride Month and Juneteenth. All actions were approved by an 8‑2 vote, except the special‑events ordinance which was part of the same consent motion.

Mon Mar 31, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee to review six transportation project presentations

The Transportation SPLOST 2026 Advisory Committee will meet to review project presentations and discuss project costs. The committee will also consider the approval of minutes from the March 24, 2025 meeting.

transportationinfrastructuresplostroadspedestrian-safety
✓ Decided: Committee approved prior meeting minutes, no new actions taken

The committee unanimously approved the minutes from the March 24, 2025 meeting. No TSAC actions or votes were taken on any of the presented projects.

Thu Mar 27, 2025

TAD Advisory Committee - Mall Area

Mall Area TAD committee to review priority list and membership structure

The Mall Area Tax Allocation District Advisory Committee meets to discuss an update on a community-identified priority list submitted to the Mayor and Commission, and to consider membership, reappointments, and a possible consolidation of TAD advisory committees. The meeting includes approval of December 2024 minutes and routine procedural items.

tax-allocation-districtadvisory-committeeathensgeorgiacommunity-prioritiesmembership
Tue Mar 25, 2025

Mayor & Commission Meetings

Mayor and Commission to discuss FY26 budget with proposed $3.27M deficit

The Mayor and Commission are discussing the Acting Manager's proposed FY26 General Fund budget, which projects a $3.27M deficit on $198.3M in revenues and $201.6M in expenditures. The presentation highlights 'Big Rocks' - major expenditure or revenue challenges - including recommended funding of $5.57M for items such as public safety pay adjustments and other operating needs. Only 10 of 104 capital requests are funded, totaling $6.99M of the $26.26M requested. No final decisions are being made at this work session; the budget will be further refined before adoption.

budgetpublic-safetypay-increasescapital-fundingdeficitfleet-replacementnarcan
✓ Decided: Commission reviewed FY26 budget recommendation, no decisions taken

The commission met on March 25, 2025, to review the Acting Manager’s FY26 General Fund Capital budget recommendation. No votes were taken and no actions were approved, denied, or postponed. The meeting adjourned at 4:42 p.m.

Tue Mar 25, 2025

Mayor & Commission Meetings

Commission to vote on accepting Judge Jolles' resignation effective March 28

The Mayor and Commission will consider a resolution to accept Judge Marcy Jolles’ resignation as Municipal Court Judge and Administrative Hearing Officer, rejecting her request to extend to June 30 and keeping the original March 28 date. The meeting also includes public comment on this single item. The resolution directs staff to post the vacancy and secure interim replacements.

judge-resignationmunicipal-courtpersonnelvacancyinterim-appointmentpublic-hearing
✓ Decided: Commission appointed Jim Davis as interim municipal court judge

The Commission adopted a resolution keeping Judge Marcy Jolles' resignation effective March 28, 2025 and directing HR to post the vacancy and seek interim attorneys. Mayor Kelly Girtz nominated Jim Davis as interim Municipal Court Judge and Interim Administrative Hearing Officer, and the Commission approved the nomination. All related motions passed unanimously or with seven affirmative votes. The meeting adjourned at 3:38 p.m.

Tue Mar 25, 2025

Athens in Motion Commission

Athens in Motion discusses merging Greenway Commission trails into its scope

The Athens in Motion Commission will consider cancelling its April 22 meeting due to a plan revision workshop and TSPLOST presentations. They will also discuss merging the Greenway Commission's trails into Athens in Motion as proposed by the Government Operations Committee. Updates on TSPLOST 2026 corridor project cost estimates for Milledge Avenue and Broad Street will be presented, along with a plan revision workshop scheduled for April 26-27.

transportationpedestrian-safetytsplostgreenwayboard-consolidationplan-revisionvision-zero
✓ Decided: Commission unanimously approved the agenda and minutes, then adjourned

The Athens in Motion Commission approved the meeting agenda and the prior meeting minutes without opposition. Commissioners decided to keep the April 22 meeting on the calendar. A motion to adjourn the meeting was moved, seconded, and carried.

Tue Mar 25, 2025

Airport Authority

Athens Ben Epps Airport Authority to review strategic plan and leadership

The Airport Authority will meet to review financial and operations reports and provide updates on capital improvement projects. The body will discuss leadership and conduct a strategic plan review via the Business/Finance committee.

airportinfrastructurestrategic-planningaviation
✓ Decided: Dr. Napier elected Authority Chair and Mr. Alexander appointed Operating Committee Chair

The board approved the January minutes with one abstention and approved the February minutes unanimously. Members elected Dr. Napier as the Authority Chair and appointed Mr. Alexander as chair of the Operating Committee, both by unanimous vote. The Vice Chair position was not decided and will be addressed at the April meeting.

Mon Mar 24, 2025

TSPLOST 2026 Advisory Committee

TSPLOST Advisory Committee reviews 7 potential projects for 2026

The TSPLOST Advisory Committee will hear presentations on seven proposed transportation projects, including traffic calming, bus stop improvements, and sidewalk projects. The committee will also approve minutes from March 17 and discuss next steps. No decisions are being made at this meeting; it is a review session.

transportationtsplostadvisory-committeetraffic-calmingsidewalksbus-stopsroad-improvements
✓ Decided: Committee approved prior minutes; no project actions taken

The committee unanimously approved the minutes from the March 17, 2025 meeting. No votes or actions were taken on any of the presented projects. The next meeting is scheduled for March 31, 2025.

Mon Mar 24, 2025

TAD Advisory Committee - Newton Bridge Area

Newton Bridge Road TAD committee to discuss consolidating advisory committees, traffic study

The Newton Bridge Road Tax Allocation District (TAD) Advisory Committee will discuss a community-identified priority list and a traffic study (ATLAS/ICE) under old business, along with an update on corridor projects. Under new business, the committee will consider consolidating TAD advisory committees and address membership terms and roll-offs. The meeting is a regular business meeting with discussion items; no formal votes are expected.

tadadvisory-committeenewton-bridge-roadtraffic-studycommunity-prioritiesmembershipconsolidation
Wed Mar 19, 2025

Solid Waste Advisory Commission

SWAC to discuss plastic bag ban ordinance and residential collection zones

The Solid Waste Advisory Commission will review public comments, approve February minutes, and receive reports from Keep Athens-Clarke County Beautiful, the Recycling/RMPF/TRS, Collections Division, and Landfill Status. Old business includes the AAH cleanup on May 3rd and Leaf and Limb/Bulky Waste Collection. New business features a presentation and discussion on community beautification and litter. The commission will also note pending items: a draft ordinance to eliminate plastic bags and Styrofoam containers, and a referral from Mayor & Commission on residential collection zones and franchise arrangements.

solid-wasteplastic-bag-banstyrofoam-banrecyclinglandfillbeautificationcollections
Wed Mar 19, 2025

Historic Preservation Commission

Historic Preservation Commission to review five property modification requests

The commission will consider Certificates of Appropriateness for exterior changes to properties in the West Downtown, Bloomfield, and Reese St. historic districts. The body will also receive updates on its strategic plan and committee reports.

historic-preservationzoningbuilding-permitsathens-ga
✓ Decided: Rear addition modification at 120 W. Cloverhurst Ave denied

The Historic Preservation Commission denied the request to modify a rear addition at 120 W. Cloverhurst Ave (vote 4‑0). It approved a mechanical screening at 183 W. Clayton St with no conditions (vote 3‑1) and approved window replacement at 369 N. Finley St with specific conditions (vote 4‑0). Earlier agenda items, including staff reports and minutes, were adopted unanimously.

Wed Mar 19, 2025

Human Relations Commission

Athens Human Relations Commission meets for updates and subcommittee work

The special called meeting of the Human Relations Commission will consider approval of February minutes, hear updates from the People & Belonging Department, and discuss old business including an educational session, subcommittee roles, and the commission website. New business involves a feedback letter to the BAC and a housing tour. Public comment is permitted on both old and new business.

human-relationscommissionathensgeorgiameetingsupdatespublic-commenthousing
✓ Decided: Human Relations Commission approved engagement banner and added disability duties

The commission accepted the prior meeting minutes and received updates from the People & Belonging Department. It defined three subcommittees—Community Outreach & Engagement, Policy Review, and Housing & Economic Justice. The commission voted to approve a new engagement banner on its website and to integrate the duties of the Commission on People with Disabilities into its workplan. The board also discussed a collaborative housing‑inequity tour with county commissioners and community stakeholders.

Tue Mar 18, 2025

Mayor & Commission Meetings

Commission to consider $320,000 for alternative courthouse operations

The Mayor and Commission are considering a budget amendment to fund alternative courthouse operations for up to 12 weeks during the renovation of a pedestrian elevator. The funding would support staff overtime, facility rentals, and security equipment.

budgetcourthouseinfrastructurepublic-safety
✓ Decided: Agenda setting session held; no votes taken

The Mayor and Commission held an agenda setting session on March 18, 2025, to discuss 28 items, including funding requests, rezoning proposals, and various project approvals. No votes were taken during this session; all items were only discussed for future action. The meeting adjourned at 9:05 p.m.

Tue Mar 18, 2025

Mayor & Commission Meetings

Special session to consider courthouse operations contingency funding

The Mayor and Commission are holding a special called session to consider a contingency funding request for courthouse operations. Following that discussion, the body will enter executive session for real estate acquisition or disposal, personnel matters, and a legal conference on threatened or pending litigation. Public input is allowed on the funding item before the vote.

budgetcourtsgovernment-operationsexecutive-sessionreal-estatepersonnellitigation
✓ Decided: Commission approves $320K for alternative courthouse operations

The Mayor and Commission unanimously approved ordinance #25-03-26, amending the FY2025 budget to provide up to $320,000 in contingency funding for alternative courthouse operations while the first pedestrian elevator is renovated. The funding reallocates $320,000 from the General Fund operating contingency to cover personnel costs for the Sheriff's Office and Police Department ($37,800 each) and up to $244,400 in operating expenses for Superior Court. The Commission also announced the first Arena District Steering Committee meeting for April 4, 2025, and entered executive session before adjourning.

Mon Mar 17, 2025

TSPLOST 2026 Advisory Committee

TSPLOST committee hears presentations on 14 transportation projects

The TSPLOST Advisory Committee will hear presentations on 14 proposed projects including pedestrian crossings, bus shelters, road widenings, and a bridge replacement. The committee will also approve minutes from the previous meeting and discuss prior topics. No votes on these specific projects are scheduled; this is a presentation and discussion session.

transportationroadspedestrian-safetybus-sheltersbridge-replacementtspolostathens
✓ Decided: TSAC adopts revised alternate project process for TSPLOST 2026

The TSPLOST 2026 Advisory Committee approved minutes from March 10, 2025, and adopted staff's recommendation for handling alternate project submissions, with a modification allowing submitters to make one change without necessarily reducing the budget. The motion carried unanimously with one abstention. No project funding decisions were made; the committee heard presentations on 13 proposed projects.

Mon Mar 17, 2025

Mayor & Commission Meetings

GOC to discuss restarting Land Bank Authority, BAC procedures

The Government Operations Committee will consider approving December 2024 minutes and discuss several long-standing items, including a plan to restart the Land Bank Authority and updates to Board of Assessors procedures. The meeting is open to the public but does not typically receive public comments unless requested by the chair.

government-operations-committeeland-bank-authorityshort-term-rentalsfair-housingemployee-engagementrenter-protectionsmeeting-minutes
✓ Decided: Committee recommends reactivating Land Bank Authority with $250K funding

The Government Operations Committee voted unanimously to recommend reactivating the Land Bank Authority and designating $250,000 in funding, though no funds are immediately allocated. The committee also discussed updates to BAC procedures, including stipends and removal criteria, but took no formal action on those items.

Mon Mar 17, 2025

TSPLOST Oversight Committee

TSPLOST committee to review $1.9M Westchester pedestrian improvements

The Oversight Committee will consider confirming the project concept for TSPLOST 2023 Project 16, Westchester Area Pedestrian Improvements, which includes sidewalks, crosswalks, and ADA upgrades. They will also review two subprojects under Electrify the Fleet and monthly financial reports for the 2018 and 2023 TSPLOST programs. The meeting is open for public viewing but not public comment.

tsplosttransportationpedestrian-improvementselectric-vehiclesfleet-electrificationtransitathens-clarke-county
✓ Decided: TSPLOST committee meeting suspended due to lack of quorum

The Athens-Clarke County TSPLOST Oversight Committee meeting was suspended at 5:25 p.m. because fewer than the required number of members were present. No substantive decisions were made, and the scheduled action items were not discussed. The next meeting is tentatively set for April 21, 2025.

Mon Mar 17, 2025

SPLOST Oversight Committee

Committee considers $1.4M aircraft rescue vehicle purchase

The SPLOST Oversight Committee will review a proposal to purchase a new Aircraft Rescue and Fire Fighting vehicle and equipment for the Athens-Ben Epps Airport. The body will also discuss a proposed concept and framework for a mobile medical facility.

airportpublic-safetysplostemergency-vehicleshealthcare
✓ Decided: SPLOST committee approves airport fire truck and mobile medical facility projects

The SPLOST 2020 Oversight Committee unanimously approved two project concepts: purchasing a new Aircraft Rescue and Fire Fighting Vehicle for the airport and a Mobile Medical Facility, both consistent with their initial project statements. They also approved the January 27, 2025 meeting minutes and discussed a BAC feedback letter and monthly financial reports.

Wed Mar 12, 2025

Future Land Use Steering Committee

Steering Committee to review first draft of Future Land Use Map

The committee is reviewing the first cut of the Future Land Use Map, including proposed adjustments and a final inset area review for Prince Ave. The meeting includes an opportunity for public comment on the proposed map.

zoningland-useplanningprince-ave
✓ Decided: Committee adjusts future land use map, adds 'corridor of significance'

The Future Land Use Steering Committee discussed and made preliminary adjustments to the future land use map, including introducing a new term 'corridor of significance' for Gaines School Road and changing several parcels to different designations. The committee voted 9-0 to change Elizabeth and Willow streets to downtown (DT) designation. No final decisions were made; the map will go out for public comment.

Tue Mar 11, 2025

Mayor & Commission Meetings

Special called session to enter executive session on personnel, real estate

The Mayor and Commission are holding a special called session solely to enter executive session, as allowed by state law, to discuss confidential personnel matters and potential real estate acquisition or disposal. No public votes or decisions are scheduled; the meeting is procedural and non-public.

governmentpersonnelreal-estateexecutive-sessionprocedural
✓ Decided: Commission enters executive session for personnel, real estate

The Mayor and Commission held a special called session solely to enter executive session for confidential personnel matters and real estate acquisition/disposal. No substantive decisions were made in open session. The motion to enter executive session and adjourn passed unanimously.

Tue Mar 11, 2025

Mayor & Commission Meetings

Commission to review $2.1M in HOME and CDBG funding recommendations

The Mayor and Commission will hold a work session to discuss FY26 HOME and CDBG funding recommendations for affordable housing and community development projects, totaling about $2.1 million. They will also consider options for increased housing and receive annual updates from the Athens Homeless Coalition and Neighborhood Leaders. A special called session precedes the work session for an executive session on confidential personnel matters and real estate acquisition. No final action is taken at this work session.

housingfederal-grantshomeless-coalitionneighborhood-leadersplanningaffordable-housingcommunity-development
✓ Decided: Work session held; no votes taken on housing or funding

The Mayor and Commission held a work session on March 11, 2025, to discuss FY26 HOME, CDBG, and CPP funding recommendations, options for increased housing, and annual updates from the Athens Homeless Coalition and Neighborhood Leaders. No votes were taken during the session; the only action was adjournment, which was approved unanimously.

Tue Mar 11, 2025

TAD Advisory Committee - Lexington Road

Lexington Road TAD committee to vote on bylaws and chair, discuss community priority list

The Lexington Road Tax Allocation District Advisory Committee will vote on its by-laws and appoint a committee chair. The committee will also discuss prioritized community input to create a priority list for the Mayor and Commission, and determine its 2025 meeting schedule.

tax-allocation-districtadvisory-committeebylawscommunity-inputathenslexington-road
✓ Decided: Lexington Rd TAD committee recommends 100% funding for public infrastructure

The Lexington Rd TAD Advisory Committee unanimously approved recommending that 100% of TAD funds be allocated to public infrastructure improvements, with housing, economic development, and youth development receiving 0%. The committee also confirmed Dr. Cshanyse Allen as Chair and Rhett Butler as Vice-Chair, and delayed a vote on by-laws to a future meeting. They discussed consolidating TAD committees, a process expected to take two years, and set their 2025 meeting schedule.

Mon Mar 10, 2025

Athens Cultural Affairs Commission

ACAC discusses 'Red Bass' installation and Public Art Master Plan update

The Athens Cultural Affairs Commission will review updates on public art projects, including the newly installed 'Red Bass' at Akins Ford Arena and a call for Bishop Park pedestrian gates. The commission will also conduct new member interviews and receive a presentation on the Public Art Master Plan.

public-artcultural-affairscommission-meetingathens-gaart-installation
✓ Decided: Commission approves February minutes, hears public art updates

The Athens Cultural Affairs Commission unanimously approved the February meeting minutes. The commission received updates on several public art projects, including the completed installation at Akins Ford Arena, the Bishop Park pedestrian gates call, and the East Athens Library mural project. A draft Public Art Master Plan is in progress, with a final draft expected in April.

Mon Mar 10, 2025

TSPLOST 2026 Advisory Committee

TSPLOST committee to hear presentations on six projects from mayor and others

The TSPLOST Advisory Committee will hear presentations on six proposed transportation projects at its March 10 meeting, including a bridge, trail improvements, fleet electrification, and traffic signals. The committee will also approve minutes from the previous meeting and review prior discussion. No votes or decisions are expected at this presentation-focused meeting.

transportationtspolostadvisory-committeeinfrastructuretrailsbridgetraffic-signalfleet-electrification
✓ Decided: TSAC votes to consider alternative project submissions

The TSPLOST 2026 Advisory Committee approved the minutes from the previous meeting and heard presentations on six projects. The committee voted 6-3 with one abstention to consider alternative submissions from project submitters. No project approvals or denials were made during this meeting.

Thu Mar 6, 2025

Audit Committee

Audit Committee to review FY25 workplan and prepare FY26 plan

The Audit Committee will discuss the status of FY25 audits, follow-ups, and special projects. The body will also begin preparation for the FY26 Audit Workplan.

auditgovernment-oversightfinance
✓ Decided: Audit Committee adopts bylaws, reviews FY26 workplan

The Audit Committee unanimously adopted its bylaws with an added condition that chair elections occur at the first meeting of the calendar year. The committee also reviewed the draft FY26 audit workplan, discussing potential audits and projects, and the Internal Auditor agreed to bring two options for the workplan to the next meeting. No final decisions were made on the workplan.

Thu Mar 6, 2025

Mayor & Commission Meetings

Noise ordinance review for ag-residential and downtown zones

The Legislative Review Committee will discuss potential updates to the noise ordinance, focusing on non-agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district. The committee may also consider using objective volume measures. Other agenda items include approving February meeting minutes and confirming a quorum for the next meeting.

noise-ordinancezoningdowntownagricultural-residentialpublic-inputlegislative-review
✓ Decided: Committee reviews noise ordinance, discusses Fairgrounds complaints

The Legislative Review Committee discussed potential updates to the noise ordinance, focusing on noise in Agricultural Residential zones and amplified sound downtown. No formal decisions were made; staff will gather complaint data and draft possible ordinance changes for the next meeting.

Thu Mar 6, 2025

Planning Commission

Planning Commission to consider master planned development at 450 & 460 Gaines School Road

The Athens-Clarke County Planning Commission will hold a public hearing and consider a Type I Master Planned Development and Special Use request for 450 & 460 Gaines School Road, which would rezone the properties from Main Street Business/Traditional Neighborhood to Main Street Business and from C-O/RS-15 to C-N/RM-2. The commission will also hear a Type II Special Use request for 475 N. Church Street. A text amendment on short-term rentals has been rescheduled for April.

planning-commissionzoningspecial-usemaster-planned-developmentshort-term-rentalsathensclarke-county
✓ Decided: Planning Commission recommends approval for Gaines School Rd mixed-use project

The Planning Commission recommended approval of a master planned development at 450 & 460 Gaines School Road, including a zoning change and future land use amendment, with conditions. The commission also recommended approval of a special use permit for 475 N. Church Street. No other substantive decisions were made.

Wed Mar 5, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

Board discusses merging KACCB, Tree Council, and ORGC

The Keep Athens-Clarke County Beautiful Board met and approved motions to request committee funds for ICAW books and Greenlife Award registration. The board discussed potential beverage fundraisers at The Globe and Old Pal, a property assessment and encampment protocol, and a possible merger of the KACCB, Tree Council, and ORGC boards.

environmentbeautificationboard-mergerfundraisersencampmentsclean-upvolunteer
✓ Decided: KACCB board approves funding for compost books and Green Life Awards

The board approved $453.76 for compost books to distribute to schools and $105 for three Green Life Awards. They also discussed a potential consolidation with other environmental boards, with staff to respond by March 12. The meeting lacked a quorum, so minutes approval was deferred to email.

Tue Mar 4, 2025

TAD Advisory Committee- West Broad/Hawthorne Area

TAD Committee to review public input and discuss utilities

The West Broad/Hawthorne Area TAD Advisory Committee will discuss with Public Utilities potential areas to address in the district and review results from public input gathered through an online survey and community events. They will also consider a community-identified priority list. No formal decisions are scheduled; this is a discussion and review session.

tadtax-allocation-districtwest-broad-hawthorneathenspublic-inpututilitiescommunity-development
✓ Decided: TAD committee discusses sewer capacity limits for proposed hotel

The West Broad/Hawthorne TAD Advisory Committee met and discussed sewer capacity issues affecting a proposed hotel at 155 Alps Road, noting insufficient capacity and the need for private holding tanks. They reviewed public input and discussed consolidating the separate TAD advisory committees into one. No formal votes were taken on these items; the committee approved the agenda and previous minutes, and scheduled a special meeting for May 7 to vote on a community-identified priorities list.

Tue Mar 4, 2025

Mayor & Commission Meetings

Commission to vote on rezoning 207 acres on Barnett Shoals Road for mixed-use

The Mayor and Commission will consider a consent agenda including a biosolids hauling contract extension ($520,000 from reserves), a downtown parking deck rate adjustment, and several grant and project approvals. Public hearings will be held on four planning commission recommendations, most notably a rezoning of 207 acres on Barnett Shoals Road for residential and commercial mixed-use. Old business items include a pavement maintenance contract award, non-profit lease extensions, and a proposed increase to Clarke County Health Board environmental health fees.

zoningrezoninghousingmixed-usebudgetparkingfeespublic-works
✓ Decided: Commission approves 12-item consent agenda including parking rate hike to $2/hour

The Mayor and Commission approved a 12-item consent agenda, including a $520,000 budget amendment for biosolids hauling, grant applications for domestic violence prosecution and recycling equipment, a $306,000 water main relocation for a GDOT roundabout, a $306,341 design task order for the Athena Industrial Park water line, $367,592.94 for transit bus engines, a $2.00/hour parking deck rate increase, and acceptance of a housing audit. They also approved a rezoning at 995 Gaines School Road for a medical center, denied a special use for an office at 728 Cobb Street, held two items for 1055 Hull Road, and approved a large rezoning at Barnett Shoals Road with conditions. Additionally, they denied a request to recapture ARPA funds, approved a $400,000 contract for pedestrian improvements, awarded a $3,985,101 pavement maintenance contract, extended non-profit leases, and approved health fee increases.

Tue Mar 4, 2025

Mayor & Commission Meetings

Athens-Clarke County holds special session for personnel matters

The Unified Government of Athens-Clarke County is holding a special called session. The purpose of the meeting is to enter into an executive session to discuss confidential personnel matters.

personnelexecutive-sessiongovernment-administration
Mon Mar 3, 2025

TSPLOST 2026 Advisory Committee

Committee hears presentations on six transportation projects for TSPLOST 2026

The TSPLOST 2026 Advisory Committee is meeting to hear presentations on six proposed transportation projects, including downtown connectivity, airport capital improvements, and several road intersection upgrades. The committee will also approve minutes from the previous meeting and discuss next steps. No votes are expected at this informational session.

tsplosttransportationadvisory-committeeathensroad-projectsdowntown-connectivityairportintersection-improvements
✓ Decided: TSPLOST committee hears project presentations, takes no votes

The TSPLOST 2026 Advisory Committee met on March 3, 2025, and approved the minutes from the February 24 meeting unanimously. Five project presentations were given, covering downtown connectivity, airport improvements, and several road intersection projects. No actions or votes were taken on any projects.

Wed Feb 26, 2025

Pension Board

Review actuarial analysis for pension plan options and consider revised by-laws

The Pension Board will review an actuarial analysis of proposed pension plan options presented by Aon and consider adoption of revised By-Laws. The meeting also includes employee comments or other issues.

pensionretirementby-lawsactuarial-analysisbenefitsgovernment
✓ Decided: Pension Board recommends Rule of 85 option to Mayor & Commission

The Athens-Clarke County Pension Board voted to recommend Option #3 (Rule of 85 for unreduced early retirement) to the Mayor & Commission for consideration in the FY26 budget. The motion passed 4-2 with one abstention. The board also approved amended by-laws and requested a cost estimate for counting prior ACCGov service toward pension vesting for returning employees.

Tue Feb 25, 2025

Airport Authority

Airport Authority to hear Lexington Corridor update, routine reports

The Athens Ben Epps Airport Authority is holding its regular monthly meeting. The agenda includes review of January minutes, airport manager reports on finances, capital projects, and marketing, and an update on the Lexington Corridor under old business. No new business is listed. The meeting is largely procedural with no major decisions or financial actions specified.

airportauthoritymeetingupdateslexington-corridorathens
✓ Decided: Airport Authority meeting lacks quorum, no decisions made

The Athens Ben Epps Airport Authority met on February 25, 2025, but lacked a quorum, so no official decisions were made. The January meeting minutes were not approved and will be reconsidered at the next meeting. The board heard reports on finances, capital projects, and marketing, but took no formal action.

Tue Feb 25, 2025

Athens in Motion Commission

Athens in Motion Commission to vote on 2025 Work Plan

The commission will review the 2024 report and vote on the 2025 Work Plan. Members will also discuss the Athens in Motion Plan revision process and receive updates on TSPLOST 2026.

transportationpedestrian-safetytsplosturban-planningbiking
✓ Decided: Athens in Motion Commission approves 2024 report and 2025 work plan

The Athens in Motion Commission unanimously approved its 2024 annual report and 2025 work plan. The commission also accepted the agenda and previous meeting minutes unanimously. Staff provided updates on TSPLOST 2026, the Athens in Motion Plan revision, and various transportation and park projects. No substantive policy decisions were made beyond the approvals.

Mon Feb 24, 2025

Future Land Use Steering Committee

Steering Committee reviews first draft of Future Land Use Map

The Future Land Use Steering Committee is meeting to review the first cut of the Future Land Use Map. The discussion will focus on areas that remain unchanged, name changes for intents, and specific changes to nodes and corridors.

zoningland-useplanningmapping
Mon Feb 24, 2025

TSPLOST 2026 Advisory Committee

TSPLOST advisory panel hears six project presentations for 2026 program

The TSPLOST 2026 Advisory Committee will receive presentations on six proposed transportation projects: Safe Routes Program, Smart City Technology, Traffic Signal Infrastructure Improvements, Intersection Improvement Program, Traffic Signage Replacement Program, and Vision Zero Action Plan Implementation. The committee will also approve minutes from its February 10 meeting and review prior discussion. No votes or decisions are scheduled—this is the first round of project briefings.

transportationtsplostadvisory-committeeproject-presentationstraffic-safetyinfrastructure
✓ Decided: TSPLOST advisory panel hears 6 project presentations, takes no votes

The TSPLOST 2026 Advisory Committee held its first presentation meeting, hearing from staff on six proposed projects: intersection improvements, safe routes, Vision Zero, smart city technology, traffic signals, and signage replacement. No actions or votes were taken; the meeting was informational only.

Thu Feb 20, 2025

Athens Cultural Affairs Commission

Athens Cultural Affairs Commission to score public-art applicants for Linnentown Lane

The commission is meeting to review and score applicants for a public art project on Linnentown Lane. Members will discuss criteria and then select top candidates, determining next steps for the installation.

public-artcultural-affairsathenslinnentown-laneselection-meeting
Thu Feb 20, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Advisory Committee to discuss affordable housing and priorities

The East Downtown TAD Advisory Committee will discuss the community-identified priority list and consider its approval by Mayor and Commission. They will also review a recap of affordable housing discussions, covering demographic needs and successful housing models. The committee will propose a 2025 meeting schedule and discuss membership terms and reappointments.

tax-allocation-districttadathensaffordable-housingcommunity-prioritiesadvisory-committee
✓ Decided: East Downtown TAD Committee approves 2025 meeting schedule

The East Downtown TAD Advisory Committee met on February 20, 2025, and unanimously approved the agenda and the minutes from May 16, 2024. They approved the 2025 meeting schedule for May 15, August 21, and November 20. The committee discussed affordable housing strategies, including land bank programs and partnerships, but took no formal votes on these topics. They also noted the need to formalize a vote for the committee chairperson.

Wed Feb 19, 2025

Solid Waste Advisory Commission

Solid Waste Commission to hear PFAS presentation, discuss bulky waste collection

The Solid Waste Advisory Commission will meet to approve minutes from January, receive updates from divisions including recycling and landfill, and review old business items such as a cleanup event and facility tour. Under new business, the commission will hear a presentation on PFAS from Atlantic Coast Consulting. The meeting also includes discussion of leaf and limb/bulky waste collection and a grant submission.

solid-wasteadvisory-commissionrecyclinglandfillpfasplastic-bag-banbulky-wasteleaf-and-limb
Wed Feb 19, 2025

Historic Preservation Commission

Historic Preservation Commission to rule on five COAs, including downtown storefront change

The Athens-Clarke County Historic Preservation Commission will hold a public hearing to decide on five certificates of appropriateness (COAs) for changes to historic properties. Old business includes modifying a previously-approved rear addition at 180 Woodlawn Ave. New business covers accessory structures at 628 and 850 Boulevard, a garage addition at 170 Westview Dr, and a storefront modification at 220 College Ave downtown. Committee reports and a strategic plan update are also on the agenda.

historic-preservationcertificates-of-appropriatenessathens-gacoaaccessory-structuresdowntownstorefront-modificationgarage-addition
✓ Decided: Historic Preservation Commission approves 5 COAs, one with 3-2 vote

The Athens-Clarke County Historic Preservation Commission approved all five certificates of appropriateness (COAs) on its agenda, including modifications to rear additions, accessory structures, a garage addition, and a storefront opening. One approval, for a garage addition at 170 Westview Dr., passed 3-2 with two members voting against. The commission also adopted minutes from previous meetings and discussed strategic planning updates.

Wed Feb 19, 2025

Human Relations Commission

Human Relations Commission to discuss flags and community projects

The Human Relations Commission will meet to review updates from the People & Belonging department. The body will discuss ongoing efforts regarding flag raising and educational series development, as well as new business items.

community-relationspublic-outreachgovernment-administration
✓ Decided: HRC votes to remove two inactive members, sets Pride and Juneteenth flag dates

The Human Relations Committee approved a formal recommendation for Pride and Juneteenth flag raisings, with Pride from June 1-15 and Juneteenth from June 15-July 4. The committee also voted to formally remove two inactive members, Tamika Curry and Darius Binion, due to inactivity. Updates were provided on the period project and Women's History Month events, and the committee discussed creating an Instagram account.

Tue Feb 18, 2025

Mayor & Commission Meetings

Commission to consider rezoning 207 acres on Barnett Shoals Road for mixed-use

The Mayor and Commission will first hold a special called session to enter executive session on confidential personnel matters. Then, in the agenda setting session, they will discuss consent agenda items for the March 4 voting meeting, including a $1.2 million biosolids hauling contract extension and several infrastructure projects. They will receive staff reports on seven rezoning and special use requests, most notably a 207-acre mixed-use rezoning on Barnett Shoals Road. New business includes a downtown parking deck rate increase from $1.50 to $2.00 per hour, ARPA funding recapture for affordable housing, and a proposal to intervene in Georgia Power rate cases.

zoningrezoninghousinginfrastructureparkingbudgetgrantspublic-transportation
✓ Decided: Agenda setting session held; no votes taken on 21 items

The Mayor and Commission held an agenda setting session on February 18, 2025, to discuss 21 items, including rezoning requests, contracts, and grants. No votes were taken during this session; all items were only discussed for future action. The meeting adjourned at 9:07 p.m.

Tue Feb 18, 2025

Mayor & Commission Meetings

Special called session for executive session on personnel

This is a procedural special called session of the Athens-Clarke County Mayor and Commission. The only purpose is to enter executive session to discuss confidential personnel matters, as allowed under state law. No public votes or decisions are scheduled.

meetingpersonnelexecutive-sessionprocedural
✓ Decided: Commission enters executive session for personnel matters

The Mayor and Commission held a special called session solely to enter executive session to discuss confidential personnel matters under state law. The motion to enter executive session and adjourn passed unanimously. No substantive decisions were made.

Mon Feb 17, 2025

Future Land Use Steering Committee

Committee reviews first cut of Future Land Use Map

The Future Land Use Steering Committee will discuss the first draft of the Future Land Use Map, covering areas not changing, reclassified designations, and specific changes in nodes and corridors. No votes or formal decisions are expected; the session is a working discussion.

land-usezoningplanningathens-clarkesteering-committee
Mon Feb 17, 2025

SPLOST Oversight Committee

Oversight Committee to review facilities equipment replacement project

The SPLOST Oversight Committee will consider whether the proposed concept for Sub-Project #4 of the Facilities Equipment Systems Replacement Project aligns with its initial statement. The body will also review monthly project and expenditure reports for the 2005, 2011, and 2020 SPLOST programs.

splostfacilities-maintenancebudgetinfrastructure
✓ Decided: SPLOST committee approves Project 27 sub-project concept

The SPLOST 2020 Oversight Committee unanimously approved the Project Concept for Project 27, Sub-Project #4 (Facilities Equipment Systems Replacement), confirming it aligns with the initial project statement. They also approved the January 27, 2025 meeting minutes. No other substantive decisions were made.

Wed Feb 12, 2025

Hearings Board

Hearings Board to consider lot coverage variance for 105 Beaverdam Drive

The Athens-Clarke County Hearings Board will review a request from Sean J. Sanders. The petitioner is seeking a variance to increase the maximum allowable lot coverage for a residential property.

zoningvarianceresidentialland-use
✓ Decided: Hearings Board tables Beaverdam Drive variance request

The Athens-Clarke County Hearings Board met on February 12, 2025, and handled routine procedural items, including approving the official record and prior meeting minutes. The only substantive item, a variance request for 105 Beaverdam Drive, was tabled until the next regular meeting, with a 6-1 vote.

Tue Feb 11, 2025

Mayor & Commission Meetings

Annual audit presented; no material weaknesses, repeat segregation-of-duties comments

This is a work session with no final votes. Commissioners will hear the annual financial audit for FY2024, which received an unmodified opinion and found no material weaknesses, but includes repeat comments on segregation of duties in several elected offices and issues with deposit timeliness. They will also discuss the 2025-2029 Transit Development Plan.

auditfinancetransitpublic-safetyinternal-controlsaccountinggovernment
✓ Decided: Work session reviews annual financial report and 2025 transportation plan

The Mayor and Commission held a work session on February 11, 2025, to discuss the annual financial report and the 2025 Transportation Development Plan. No votes were taken during this session; it was informational only.

Mon Feb 10, 2025

TSPLOST 2026 Advisory Committee

TSAC reviews project presentation format, approved goals and selection criteria

The TSPLOST 2026 Advisory Committee (TSAC) holds its second orientation meeting. Members will review and approve the minutes from the February 3 meeting, discuss the Mayor and Commission-approved goals and selection criteria, and review the format for upcoming project presentations. No votes on specific projects are scheduled; the meeting is procedural to prepare for future project deliberations.

tspolsttransportationadvisory-committeeathensgeorgiapublic-meetingorientation
✓ Decided: TSAC approves Feb 3 minutes, names co-vice chairs

The TSPLOST Advisory Committee approved the February 3, 2025 minutes unanimously. After a tie vote for vice chair, Cary Rivers and Isabel Scott agreed to split the role and were named co-vice chairs. The committee also reviewed predesignated projects, past project presentations, and a voting tool demonstration. No other substantive decisions were made.

Mon Feb 10, 2025

Athens Cultural Affairs Commission

Public art installations and master plan updates before Athens Cultural Affairs Commission

The Athens Cultural Affairs Commission will review and approve January minutes, hear a chair report on filling two vacancies, and receive staff updates on completed and upcoming public art projects. Items include new sculptures at Old Winterville Rd and Akins Ford Arena, a completed mural, and calls for artists for Bishop Park gates and the Linnentown selection panel. The commission will also get an update on the Public Art Master Plan.

public-artcultural-affairssculpturemuralspublic-art-master-plancity-commission
✓ Decided: ACAC approves January minutes, hears public art project updates

The Athens Cultural Affairs Commission approved the January meeting minutes unanimously, with Frances abstaining. The commission received updates on several public art projects, including the Firefly Trail sculpture installation, a completed piece at Akins Ford Arena, and an open RFQ for pedestrian gates at Bishop Park. No other formal votes were taken; the meeting was primarily informational and procedural.

Mon Feb 10, 2025

Future Land Use Steering Committee

Committee reviews first cut of Future Land Use Map

The Future Land Use Steering Committee will discuss the first draft of the updated land use map, including what areas are not changing, what is renamed, and where changes occur (nodes, corridors, other unique areas). The meeting also includes follow-up from prior discussions and scheduling the next meeting.

land-useplanningzoningathens-clarke-countysteering-committeefuture-land-use-map
Mon Feb 10, 2025

TAD Advisory Committee - Newton Bridge Area

Newton Bridge TAD panel to discuss developer communication, traffic study quote

The Newton Bridge Road Tax Allocation District Advisory Committee will review the community priority list, a traffic study quote, and discuss developer communications for the 1125 Newton Bridge Road project. New business includes a summary of affordable housing discussions and upcoming membership term changes.

tadtax-allocation-districtathens-georgianewton-bridge-roadaffordable-housingadvisory-committeetraffic-study
Thu Feb 6, 2025

Audit Committee

Audit Committee reviews workplan status prepares FY26 plan

The Audit Committee will review and approve minutes from December 2024, receive a status update on the FY25 Audit Workplan, and begin preparation for the FY26 Audit Workplan. The Internal Auditor will also provide an update. This meeting is primarily procedural with no new action items or financial decisions.

auditcommitteegovernmentworkplaninternal-auditor
✓ Decided: Audit Committee unanimously approves FY25 Housing & Community Development audit

The Audit Committee unanimously approved the FY25 Periodic Audit of the Housing & Community Development (HCD) Department, which included four formal recommendations (one agreement, three partial agreements). The committee also approved the December 5, 2024 meeting minutes and discussed the FY26 audit workplan, but took no formal action on it. The meeting was conducted via audio only due to video malfunction.

Thu Feb 6, 2025

Planning Commission

Rezoning request for 1055 Hull Road to General Business before Planning Commission

The Athens-Clarke County Planning Commission will review several rezoning, special use, and planned development amendment requests. Key items include a rezone of 1055 Hull Road to General Business, a master planned development amendment for multiple properties on Barnett Shoals Road, and special use requests for 110 W. Hancock Avenue and 728 Cobb Street. A planned development amendment at 995 Gaines School Road and a text amendment on short-term rentals rescheduled to March are also noted.

zoningrezoningspecial-useplanned-developmentland-useathens-clarke-countyplanning-commission
✓ Decided: Planning Commission recommends approval of Barnett Shoals Rd master plan amendment

The Planning Commission recommended approval of a master planned development amendment for properties on Barnett Shoals Rd, Lakewood Dr, and Park Ridge Ct, changing zoning to Traditional Neighborhood with conditions including EV charging stations and a ban on drive-throughs. They also recommended approval of a rezone at 1055 Hull Rd and a special use permit at 728 Cobb St, tabled a special use request for 110 W. Hancock Ave, and approved a planned development amendment at 995 Gaines School Rd.

Thu Feb 6, 2025

Mayor & Commission Meetings

Legislative Review Committee to discuss process for Tax Allocation Districts

The Legislative Review Committee will approve prior minutes, hear public input, and discuss developing a process for creating or amending Tax Allocation Districts (TADs). The committee also notes a future review of the noise ordinance, including in Agricultural Residential and Commercial Downtown zones.

committeetax-allocation-districtsnoise-ordinanceeconomic-developmentpublic-inputpolicy
✓ Decided: Committee recommends no new TADs or amendments

The Legislative Review Committee voted 4-1 to move the tax allocation district (TAD) topic out of committee with no action, recommending no new TADs and no amendments to existing TADs. The motion allows for future project-specific TADs but does not establish a process for them. Commissioner Myers voted against, citing the need for a process for project-specific TADs.

Wed Feb 5, 2025

Deferred Compensation Board

Deferred Compensation Board to review plan changes and investment performance

The Board will discuss proposed changes to the deferred compensation plan following a joint meeting with the Pension Board. They will also review investment performance, update plan documents, and approve minutes from a prior meeting.

deferred-compensationretirementinvestmentsplan-administrationcity-employees
✓ Decided: Board votes to replace ClearBridge Small Cap Growth Fund

The Deferred Compensation Board unanimously approved replacing the ClearBridge Small Cap Growth Fund (A) with an alternative to be selected by Corebridge at the next meeting, with an estimated replacement date of May 2025. The board also approved a float agreement with Empower Retirement, authorizing the Chair and Secretary as signatories. Minutes from the August 14, 2024 meeting were approved unanimously. No other substantive decisions were made.

Wed Feb 5, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA to vote on new legal counsel, get loan update

The Joint Development Authority will discuss and vote on appointing new legal counsel for the board. It will also receive an update on repayments for the Turntable Revolving Loan Fund. The meeting includes routine approval of minutes and reports.

economic-developmentlegal-counselloansathens-clarke-countywinterville
✓ Decided: JDA hires Emily Escoe as legal counsel, subject to conflict waiver

The Joint Development Authority voted unanimously to engage Emily Escoe as its new legal counsel, contingent on obtaining a conflict-of-interest waiver from the Food Bank and the JDA chair. The board also approved the agenda and minutes from the December 11, 2024 special meeting. Staff reported that all loans, including Classic City Construction, are being repaid on schedule, freeing up an additional $10,000 for lending, and that a related lawsuit in Oconee County Court was dropped.

Wed Feb 5, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

Routine KACCB board meeting with no substantive agenda items

The Keep Athens-Clarke County Beautiful Board is meeting for a routine monthly session. The agenda is entirely procedural, with no specific discussions, decisions, or public hearings listed. Only the approval of previous meeting minutes and adjournment are scheduled.

keep-athens-clarke-county-beautifulboard-meetingproceduralathens-georgia
✓ Decided: Board approves $300 sponsorship for pollinator symposium

The board approved a $300 sponsorship for Monarchs Across Georgia's Pollinator Symposium. They also approved the January minutes and the treasurer's report, and discussed updates on events and fundraising.

Wed Feb 5, 2025

Pension Board

Pension Board to adopt by-laws and discuss real estate investment

The Athens-Clarke County Pension Board will hold a special called meeting to review a real estate investment proposal from PFM, consider adopting updated by-laws from the County Attorney's Office, and hear employee comments.

pensionreal-estateby-lawsinvestmentsathens-clarke-county
✓ Decided: Pension Board approves real estate fund and new by-laws

The Athens-Clarke County Pension Board unanimously approved a $1.67% portfolio investment in Blue Vista Real Estate Partners VI, a private real estate fund. The board also adopted new by-laws, amended to allow employee members to elect a Vice Chair, and unanimously elected Jason Pierce as Vice Chair for the remainder of FY25.

Wed Feb 5, 2025

Pension Board

Pension Board to review actuarial analysis of plan options

The Pension Board and Deferred Compensation Board will meet to discuss actuarial analysis regarding proposed pension and deferred compensation plan options. The meeting also includes a period for employee comments.

pensionsemployee-benefitsactuarial-analysisdeferred-compensation
✓ Decided: Pension and deferred comp boards review plan options, no decisions made

The Athens-Clarke County Pension and Deferred Compensation Boards held a specially called joint meeting to review actuarial analysis from Aon on potential plan design enhancements. No formal decisions were made; the boards discussed various options for pension and deferred compensation changes, including a request for a new 3% employer match option to be developed. The boards will present recommendations to the Mayor & Commission in April.

Tue Feb 4, 2025

Mayor & Commission Meetings

Athens-Clarke County considers four rezoning requests for multi-family housing

The Mayor and Commission will hold public hearings on four rezoning requests for multi-family and commercial developments. The body will also consider several ordinances, including airport funding and a police foundation donation.

zoninghousingairportpolicebudget
✓ Decided: Commission approves multiple rezoning and funding items

The Mayor and Commission approved several rezoning requests, including mixed-use development at 1280 Oconee Street, multi-family housing at 218 North Avenue, 1691 Milledge Avenue Extension, and 997 South Milledge Avenue, each with conditions. They also approved a text amendment clarifying halfway house regulations, accepted a $500,000 donation for the Real-Time Crime Center, and authorized a $4.8 million grant application for infrastructure projects. A resolution to address Black minority inequities was held for 60 days.

Mon Feb 3, 2025

Vision Committee

Vision Committee to review FY26 Community Partnership Program applications and recommend funding

The Vision Committee will review FY26 Community Partnership Program (CPP) applications, including scoring and rankings, to determine funding recommendations. Members will discuss eligible activities aligned with the FY23-25 ACCGov Strategic Plan and available funding gaps. The meeting also covers confidentiality, abstention from voting, and the remaining schedule.

community-partnershipsfundinggrantsvision-committeestrategic-planathens-georgia
✓ Decided: Vision Committee recommends $971,655.70 in FY26 CPP funding

The Vision Committee reviewed and discussed FY26 Community Partnership Program (CPP) applications, recommending funding for 11 agencies totaling $971,655.70. They set a 75-point minimum threshold for review, but reduced funding for several agencies to stay within the $1 million available. The committee approved the meeting minutes unanimously.

Mon Feb 3, 2025

Vision Committee

Vision Committee reviews FY26 CDBG application scores and rankings

The ACCGov Vision Committee is meeting to review and score FY26 Community Development Block Grant (CDBG) applications. Topics include HCD staff overview, mission statement, confidentiality and abstention rules, FY26-30 Consolidated Plan goals, funding gaps, and eligible activities. The committee will discuss application rankings for public services, affordable housing, economic development, and public facilities.

community-developmentcdbghousingfundingpublic-servicesaffordable-housingeconomic-developmentpublic-facilities
✓ Decided: Vision Committee reviews FY26 CDBG applications, approves minutes

The Vision Committee met to review FY26 Community Development Block Grant (CDBG) applications and combined ratings with HCD staff. No funding decisions were made; HCD staff will develop funding recommendations for Mayor and Commission (M&C) approval and send them to the committee for approval. The committee approved the meeting minutes unanimously.

Mon Feb 3, 2025

TSPLOST 2026 Advisory Committee

TSPLOST 2026 Advisory Committee holds orientation meeting

The TSPLOST 2026 Advisory Committee meets for orientation to review the TSPLOST program, committee duties, and timelines. The agenda includes discussion of a vice-chair and an attendance policy. No project proposals or funding decisions are on this agenda; future meetings will cover project review guidelines and presentation formats.

tsplosttransportationadvisory-committeeathens-georgiaorientationinfrastructure
✓ Decided: TSPLOST 2026 advisory committee holds orientation, no votes taken

The TSPLOST 2026 Advisory Committee held its orientation meeting on February 3, 2025. Members reviewed the TSPLOST overview, committee duties, and timelines for the pre-referendum and advisory process. No actions or votes were taken at this meeting.

Wed Jan 29, 2025

Human Relations Commission

Human Relations Commission to vote on Pride and Juneteenth flag raising

The Human Relations Commission will meet to review a resolution regarding Black minority inequities and the scope for a Juneteenth Event Coordinator RFP. The body is scheduled to vote on Pride and Juneteenth flag raising and discuss the development of an educational series.

human-relationscivil-rightsjuneteenthpridepublic-events
✓ Decided: HRC approves Black Inequities Resolution with changes

The Human Relations Committee approved the proposed Resolution to Address Black Inequities with changes. The committee tabled discussion on raising the Pride and Juneteenth Flags until the next meeting. They also reviewed the Juneteenth Event Coordinator RFP scope, expressing a desire for public safety assistance with parking. The next meeting was set for February 19, 2025.

Tue Jan 28, 2025

Airport Authority

Airport Authority to consider zoning requests for two properties

The Athens Ben Epps Airport Authority will meet to review minutes, hear operational and financial reports, discuss the Lexington Corridor update, and elect a chair and vice-chair. The board will also consider two zoning requests at 1280 Oconee St/300 Ann St and 450-460 Gaines School Rd.

airportzoningelectionscapital-projectsathens
✓ Decided: Airport Authority re-elects Benjamin as Chair, approves zoning request

The Athens Ben Epps Airport Authority approved the October meeting minutes as corrected and unanimously re-elected Jeff Benjamin as Chair. The Authority also approved a zoning request for 450-460 Gaines School Rd., despite objections from a citizen representative. No other substantive decisions were made.

Tue Jan 28, 2025

Athens in Motion Commission

Athens in Motion Commission discusses TSPLOST 2026 project submissions

The commission is reviewing the status of submitted TSPLOST 2026 projects and preparing for an annual year-in-review meeting. Members will also discuss 2025 priorities and receive updates on bike, pedestrian, and safety initiatives.

transportationtsplostpublic-safetybike-pedestrianvision-zero
✓ Decided: Athens in Motion Commission approves agenda and minutes, discusses bike racks and trails

The Athens in Motion Commission met on January 28, 2025, and approved the agenda and previous meeting minutes unanimously. No public comments were made. The commission discussed bike rack distribution, trail projects, and set priorities for the year, but no substantive policy decisions were made.

Mon Jan 27, 2025

TSPLOST Oversight Committee

Oversight Committee to review 2025 Pavement Maintenance Program

The TSPLOST Oversight Committee will meet to review monthly project and financial reports for the 2018 and 2023 programs. The committee is asked to confirm if the Roadway List and Project Resolution for the CY25 Pavement Maintenance Program is consistent with the initial project statement.

tsplostroadspavingbudgetinfrastructure
✓ Decided: Committee approves CY25 pavement maintenance roadway list

The TSPLOST Oversight Committee unanimously approved the minutes from October, November, and December 2024 meetings. They also unanimously confirmed that the CY25 Pavement Maintenance Program roadway list and project resolution are consistent with the Initial Project Statement for SPLOST 2020 Project 21. No other substantive decisions were made.

Mon Jan 27, 2025

SPLOST Oversight Committee

Oversight Committee to review Vincent Drive pedestrian project concept

The SPLOST Oversight Committee will consider whether the proposed project concept for the Vincent Drive Pedestrian Improvements Project is consistent with its initial project statement. The committee will also review monthly project and expenditure reports for the 2005, 2011, and 2020 SPLOST programs.

splostpedestrian-safetyinfrastructurebudgetsidewalks
✓ Decided: Committee approves Vincent Drive pedestrian project concept

The SPLOST 2020 Oversight Committee approved the project concept for the Vincent Drive Pedestrian Improvements (Project 31), confirming it aligns with the Initial Project Statement. The committee also unanimously approved the minutes from the December 16, 2024 meeting. No other substantive decisions were made.

Fri Jan 24, 2025

Mayor & Commission Meetings

✓ Decided: Mayor & Commission hold mini-retreat on budget, land use, strategy

The Mayor and Commission held a mini-retreat to discuss the HB581 overview, preliminary FY26 budget forecast, future land use planning, and strategic planning. No formal votes or decisions were made; the meeting was for discussion and planning purposes only.

Thu Jan 23, 2025

TAD Advisory Committee - East Downtown Area

TAD Advisory Committee holds affordable housing exploratory meeting

The East Downtown Tax Allocation District (TAD) Advisory Committee is meeting to discuss affordable housing strategies. The body aims to identify ways to incentivize developers and share resources among community stakeholders.

affordable-housingtax-allocation-districteconomic-developmentathens-ga
Thu Jan 23, 2025

Mayor & Commission Meetings

Commission to discuss $500K QuikTrip donation for Real-Time Crime Center

The Mayor and Commission will hold an agenda setting session to discuss items for future voting, including accepting up to $500,000 from QuikTrip Corporation via the Athens-Clarke Police Foundation for the Real-Time Crime Center, multiple rezoning requests for multi-family housing, and infrastructure projects such as the East Side Library schematic design and Vincent Drive pedestrian improvements. The meeting also includes old business on the Newton Bridge Road TAD Advisory Committee and a resolution on Black minority inequities. This is a work session; formal votes are expected at the February 4 meeting.

policezoninghousingbudgetinfrastructurepublic-safety
✓ Decided: Agenda setting session held; no votes taken

The Mayor and Commission held an agenda setting session on January 23, 2025, to discuss 16 items, including fund transfers, donations, rezoning requests, and infrastructure projects. No votes were taken during the session. Mayor Girtz announced appointments to the TSPLOST Advisory Committee.

Thu Jan 16, 2025

Athens Justice and Memory Project

Justice & Memory Project meets for routine updates

The Athens Justice & Memory Project holds a regular meeting to discuss updates on Linnentown signage and public art. The agenda includes a moment of silence, approval of previous minutes, and the chairperson's report. No votes or major decisions are scheduled.

justicememorylinnentownsignagepublic-artmeeting
Wed Jan 15, 2025

Solid Waste Advisory Commission

SWAC to discuss extending landfill life and potential CHaRM fee changes

The Solid Waste Advisory Commission will hear reports on recycling, collections, and landfill status, then consider old business including a cleanup event and facility tour. New business includes a discussion of fees for the Community Hazardous Waste Recycling (CHaRM) center and ideas to extend the life of the landfill.

solid-wastelandfillrecyclingfeescleanupathens-clarke-county
✓ Decided: Solid Waste Commission discusses leaf/limb changes, landfill fee hike

The Solid Waste Advisory Commission met and approved the November 2024 minutes. They discussed proposed changes to leaf and limb collection, including a possible pilot program and ordinance revisions for community piles and vacant lot collection, with a vote expected in March 2025. Staff proposed increasing the landfill tipping fee to $70/ton in the FY26 budget and banning mattresses, but no formal decisions were made on these items. The commission also discussed CHaRM fees, with staff proposing to waive battery fees starting in February.

Wed Jan 15, 2025

Historic Preservation Commission

Public hearing on removing 110 W. Hancock from local historic district

The commission will hold a public hearing to recommend removing 110 W. Hancock Ave from the Western Downtown Athens Local Historic District. Seven certificates of appropriateness are up for decision or discussion, including modifications to properties in Bloomfield, Cobbham, Milledge Avenue, Downtown, and Boulevard historic districts. An agenda review precedes the hearing.

historic-preservationcertificates-of-appropriatenesspublic-hearingboundary-modificationdowntownresidentialathens
✓ Decided: HPC recommends denial of removing Saye Building from historic district

The Historic Preservation Commission recommended denial of a request to remove the Saye Building (110 W. Hancock Ave) from the Western Downtown Historic District, voting 5-0. The commission also approved five certificates of appropriateness, including one for a storefront modification at 233 E. Clayton St. that staff had recommended denying. All decisions were unanimous.

Wed Jan 15, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB board to review routine reports and discuss programs

This is a routine monthly board meeting of the Keep Athens-Clarke County Beautiful board. The agenda includes approval of minutes, treasurer's report, executive director's report, committee updates, and discussion of upcoming events. No specific decisions, proposals, or financial figures are listed in the agenda.

board-meetingbeautificationroutineathens-clarke-countypublic-meeting
✓ Decided: KACCB board approves $10k BRACE grant for electronic sign

The board approved the treasurer's report, which included a $10,000 BRACE grant for an electronic sign, $1,150 in memberships from Georgia Gives Day, and a $500 donation. They also approved up to $500 for Green Life Awards. The executive director reported that the Keepin' It Clean and Brewtiful event was cancelled due to low revenue, and the board is exploring other event options.

Wed Jan 15, 2025

Human Relations Commission

Human Relations Commission to discuss American Freedmen Proposal and branding updates

The Athens Human Relations Commission will hold a regular meeting to approve minutes, receive updates on People & Belonging initiatives, and discuss several old and new business items. Key discussions include development of outreach materials, the commission's role in upcoming events, logo and branding progress, and the American Freedmen Proposal. Public comment periods are scheduled for both old and new business.

human-relationsbelongingoutreachbrandingamerican-freedmenpublic-commentevents
✓ Decided: HRC elects new chair, vice-chair; schedules special meeting

The Human Relations Committee accepted previous minutes, received updates from the Inclusion Office and People & Belonging, and voted to elect Melonee Lewis as chair and Morgan Lyle as vice-chair. The committee also approved a special called meeting on January 29, 2025, to discuss the Juneteenth RFP scope, Juneteenth/Pride flag raising, and the Resolution to Address Black Inequities. No substantive decisions were made on old or new business beyond these actions.

Wed Jan 15, 2025

Pension Board

Pension Board to discuss assumption study impact on FY25-26 contributions

The Pension Board will discuss results of an assumption study and its impact on fiscal year 2025 and 2026 contribution requirements. They will also review pension investment activity through December 2024 and discuss retirement plan design. Other business includes board membership updates, approval of prior meeting minutes, and performance review of professional firms.

pensioninvestmentsretirementfinanceathens-clarke-countyassumption-studyboard-meeting
✓ Decided: Pension Board adopts new actuarial assumptions for FY25 costs

The Athens-Clarke County Pension Board unanimously adopted the January 2025 assumption study results, which lower retirement age assumptions and reduce medical coverage liabilities, allowing Aon to finalize FY25 pension costs. The board also approved the November 6, 2024 meeting minutes and discussed plan design changes ahead of a February 5 joint meeting.

Tue Jan 14, 2025

Mayor & Commission Meetings

Vincent Drive sidewalk project concept and recommended option presented

At this work session, staff presented the Vincent Drive Sidewalk Project concept with three options and recommended Option #2 (Holland Youth Sports Complex to Winery Way). The project, funded by SPLOST 2020 with a $1.84 million budget, faces a $1.61 million funding gap. Staff also discussed proposed changes to the leaf and limb collection program, including on-demand service options, and the CY25 Pavement Management Program resurfacing list. No final action is taken at work sessions.

sidewalkspedestrian-safetyleaf-and-limbsolid-wastesplosttransportationpublic-works
✓ Decided: Work session discusses sidewalk, leaf pickup, and paving plans

The Mayor and Commission held a work session on January 14, 2025, to discuss three items: the Vincent Drive Sidewalk Project, Leaf & Limb Program opportunities, and the CY25 Pavement Management Program Resurfacing List. No votes were taken, and no formal decisions were made. The meeting adjourned at 2:13 p.m.

Mon Jan 13, 2025

Athens Cultural Affairs Commission

Athens Cultural Affairs Commission reviews public art projects and membership

The commission is meeting to discuss updates on the Public Art Master Plan and the Linnentown selection panel. The body will also address membership renewals and a current vacancy.

public-artcultural-affairsappointmentscommunity-planning
✓ Decided: Athens Cultural Affairs Commission approves December minutes, hears project updates

The Athens Cultural Affairs Commission held its regular monthly meeting on January 13, 2025, and unanimously approved the December minutes. The meeting was largely informational, with staff reporting on the completion of the Georgia Music History interior mural, the upcoming installation of the Big Red Bass sculpture, and the Firefly Trail piece. No substantive policy decisions were made; the commission discussed upcoming projects, selection panels, and community events.

Mon Jan 13, 2025

TAD Advisory Committee - Newton Bridge Area

TAD Committee to review priority list outcome and TAD fund spending process

The Newton Bridge Road TAD Advisory Committee will review the outcome of the community-identified priority list vote by the Mayor and Commission on January 7, 2025, and discuss the process for spending TAD funds. The committee will also hear from SPG Planners + Engineers about general time phases and corridor improvements. No final decisions are scheduled; items are for discussion and guidance.

tadtax-allocation-districtnewton-bridge-roadinfrastructureplanningathens
✓ Decided: Newton Bridge TAD committee reviews funding, procurement rules

The committee discussed the Mayor's proposed Community Development Ordinance for corridor safety and multi-modal access, which was tabled by the Mayor and Commission until February. They reviewed procurement rules for TAD funds, noting that purchases over $50,000 require formal bidding unless using on-call contracts. The committee also discussed a master plan for the corridor with SPG Planners, but no formal decisions were made beyond approving the agenda and minutes.

Tue Jan 7, 2025

Mayor & Commission Meetings

Commission to consider amending $600,000 loan to Athens Housing Authority for North Downtown project

The Mayor and Commission will hold an organizational meeting including swearing-in of new and returning commissioners and election of Mayor Pro Tem. Key business items include a consent agenda with several grant applications and infrastructure projects, and a new business item to amend an intergovernmental agreement for a $600,000 loan to the Athens Housing Authority. Other old business includes discussions on boulevard traffic changes, a TAD advisory list, and housing counseling funding recommendations.

organization-meetinghousinggrantsroad-improvementspublic-transportationbudgetsplost
✓ Decided: Commission approves $7,500 settlement for Charles Hardy claim

The Mayor and Commission held its 2025 organizational meeting, swearing in newly elected and reelected commissioners. The Commission approved a $7,500 settlement for Charles Hardy's claims, denied a substitute motion to reject it, and approved several grants and project concepts. It also elected Commissioner Fisher as Mayor Pro Tem and appointed Bradley A. Griffin as Acting Manager.

Thu Jan 2, 2025

Planning Commission

Planning Commission to consider text amendment clarifying halfway house regulations

The Planning Commission will hold public hearings on several rezoning and master planned development proposals, including a text amendment to clarify regulations on halfway houses. Two items are marked for discussion only: a large rezone at 610-760 Newton Bridge Road and a preliminary planned development at 450-460 Gaines School Road. The commission will also approve November 2024 meeting minutes and hear a MACORTS review.

zoningplanningrezonemaster-planned-developmenthalfway-housespublic-hearingathens-clarke-county
✓ Decided: Planning Commission recommends approvals, tables Atlanta Highway PD amendment

The Athens-Clarke County Planning Commission voted unanimously to table a master planned development amendment for 4500 & 4530 Atlanta Highway and 145 Bedgood Road at the applicant's request. The commission recommended approval for several rezoning and development requests, including 1280 Oconee Street, 1691 Milledge Avenue Extension, 218 North Avenue, and 997 S. Milledge Avenue, with conditions on some. Two items were discussion-only, and a text amendment on halfway houses was approved.