The Boring PartsFederalLocal · USLocal · Canada
Athens, Georgia

Athens public meetings in 2025

193 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Wed Dec 17, 2025

Historic Preservation Commission

Public hearing to designate 293 Gran Ellen Drive as a historic landmark

The Historic Preservation Commission will adopt minutes from the November 19 meetings, review several renovation and demolition requests for properties in historic districts, and hold a public hearing to consider designating 293 Gran Ellen Drive as a local historic landmark and adopting design guidelines for it. The commission will also receive updates on its strategic plan and committee reports, and conduct conceptual design reviews for two other properties.

historic-preservationzoningdesignationhearingsplanningdesign-review
✓ Decided: HPC unanimously approved landmark designation for 293 Gran Ellen Dr

The Historic Preservation Commission approved four Certificate of Appropriateness applications—245 Buena Vista Ave, 850 Boulevard, 283 E. Clayton St, and 163 Mell St—each with staff‑recommended conditions, all by a 6‑0 vote. The commission also recommended the designation of 293 Gran Ellen Dr as a local historic landmark and the adoption of its design guidelines, also by a 6‑0 vote. No decisions were made on the conceptual design reviews for 279 Meigs St or 232 Satula Ave. The meeting was adjourned at 8:30 PM.

Wed Dec 17, 2025

Human Relations Commission

Human Relations Commission will review its bylaws for conflict‑of‑interest provisions

The commission will accept the October 22 2025 meeting minutes and hear updates from the Chair and People & Belonging Department. It will review a handout from previous business and discuss a proposed amendment to its bylaws concerning conflicts of interest. The body will also consider plans for a Unity in Community event, participation in MLK activities, and set the 2026 meeting schedule.

governancebylawscommunity-eventspublic-commentmeetings
✓ Decided: Committee approved moving forward with Menstrual project and set next meeting date

The Human Relations Commission accepted the prior minutes and voted to shift Chairperson updates later in the agenda. It approved the recommendation to proceed with the Menstrual project pilot and scheduled the next meeting for November 19, 2025. The commission also assigned Cory and Annesia to order holiday parade supplies on October 24, 2025 and will request the communications department’s help with marketing and social‑media updates.

Tue Dec 16, 2025

TAD Advisory Committee - Mall Area

Committee will decide the 2026 meeting schedule

The Mall Area TAD Advisory Committee will consider setting the meeting dates for 2026. It will also discuss committee membership based on attendance records and future commitments. Additionally, the committee will review capital project partnership priorities for public infrastructure.

tadmeeting-schedulecommittee-membershipinfrastructurepublic-projects
Tue Dec 16, 2025

Mayor & Commission Meetings

Mayor and Commission to consider funding for food and senior services

The Mayor and Commission will discuss supplemental funding for the Food Bank of Northeast Georgia and the Athens Community Council on Aging's Meals on Wheels Program. The body will also consider establishing qualifying fees for the May 19, 2026, General Primary election.

budgetelectionsfood-securitysenior-servicesreal-estate
Tue Dec 16, 2025

Mayor & Commission Meetings

Mayor and Commission to discuss real estate in executive session

The Unified Government of Athens-Clarke County has called a special session for December 16, 2025. The purpose of the meeting is to enter an executive session to discuss the acquisition or disposal of real estate.

real-estategovernment-administration
Tue Dec 16, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Committee to set 2026 meeting schedule

The East Downtown Tax Allocation District Advisory Committee will meet to approve minutes, review staff reports on ACCGov projects, and discuss the 2026 meeting schedule and capital project partnerships.

tadsplanninginfrastructuremeetingsbudget
Mon Dec 15, 2025

Vision Committee

Vision Committee reviews FY27 CDBG, housing counseling and CPP grant process

The Vision Committee will discuss and vote on revisions to its bylaws and elect both interim and regular officers. It will also review the next steps for the FY27 Community Development Block Grant, housing counseling, and CPP grants, including TakeAim training, conflict‑of‑interest considerations, and the opening of Zoom Grant applications with a review deadline of January 20, 2026. The meeting will conclude with scheduling the next session.

governancegrantshousingcdbgelections
Mon Dec 15, 2025

TAD Advisory Committee - Newton Bridge Area

Committee will set the 2026 meeting schedule, skipping Jan 19 holiday

The Newton Bridge Road TAD Advisory Committee will approve the 2026 meeting calendar, noting the January 19 holiday skip. Members will discuss attendance‑based committee composition and future commitments. The group will consider next steps for improvements at the Vincent Drive and Newton Bridge Road intersection. They will also review capital project partnership options and public infrastructure priorities.

meeting-schedulecommitteeinfrastructuretransportationplanning
✓ Decided: Newton Bridge TAD Committee unanimously approved agenda, minutes and staff request

The committee unanimously approved the meeting agenda and the prior meeting minutes. It also unanimously authorized ACCGov staff member Daniel Young to forward a request to the Mayor regarding replacement of non‑participating committee members. An agenda amendment to discuss creating an escrow account for the TAD area was also approved unanimously.

Mon Dec 15, 2025

Mayor & Commission Meetings

Government Operations Committee to discuss employee surveys and leasing policy

The Government Operations Committee is meeting to review the Community Benefits Agreement portion of the Leasing Policy and employee engagement opportunities. The committee will also consider future reviews of the Short Term Rental Ordinance and renter protections.

leasing-policyemployee-engagementshort-term-rentalsrenter-protectionsgovernment-operations
✓ Decided: Committee approved revised nonprofit leasing policy with tiered rates

The Government Operations Committee approved all changes to the nonprofit leasing framework, including tiered lease rates, reduced public‑access hour requirements, and removal of residency‑percentage tracking. A motion to keep Tax Allocation Districts separate was also passed unanimously. The meeting adjourned after unanimous approval of the October 20 minutes and the adjournment motion.

Mon Dec 15, 2025

Mayor & Commission Meetings

Committee to develop ordinance clarifying public right-of-way definition

The Right-of-Way Use Committee will approve its agenda and the November 17, 2025 minutes, hear brief public comments, and begin work on drafting ordinance language that clarifies the definition and allowable uses of the public right-of-way. The draft is to be presented to the full Mayor and Commission no later than the November voting meeting.

right-of-wayordinancepublic-inputcommissionmeeting
Thu Dec 11, 2025

Planning Commission

Rezone of 293 Hoyt Street from P to C‑D district

The Athens-Clarke County Planning Commission will consider a rezoning request for 293 Hoyt Street, changing its designation from P to C‑D. The commission will also hear public comments on a proposed amendment to Title IX of the Code of Ordinances to regulate data centers. In addition, the meeting includes routine items such as staff reports, approval of the November 6, 2025 meeting minutes, and reports from the chair and planning director.

zoningdata-centersplanningminutespublic-hearing
Wed Dec 10, 2025

Hearings Board

Board will consider two sign and building‑size variance requests

The Athens-Clarke County Hearings Board will hear two variance applications. One seeks to eliminate the five‑foot side setback for a ground sign at 1005 Hull Road (C‑G zoning). The other asks to raise the accessory‑building limit from 800 SF to 1,032 SF at 160 Gran Ellen Drive (RS‑15 zoning). A third variance for parking expansion at 345 W. Hancock Avenue was withdrawn before the meeting.

zoningvarianceplanningcommercialresidential
Tue Dec 9, 2025

Athens in Motion Commission

Athens in Motion Commission reviews transit and pedestrian safety updates

The commission is meeting to receive staff updates on transportation planning and safety initiatives. The body will discuss the CDO Plan Revision and the Safe Streets for All Plan. The meeting also includes a year-in-review and reports from corridor and organizational committees.

transportationpedestrian-safetybikingtransiturban-planning
✓ Decided: Commission unanimously approved agenda and minutes, then adjourned

The commission unanimously approved the meeting agenda. The October meeting minutes were also approved unanimously. A motion to adjourn the meeting was moved, seconded, and adopted. The meeting adjourned at 6:21 pm.

Tue Dec 9, 2025

TAD Advisory Committee - Lexington Road

Committee will discuss membership criteria and capital project priorities

The Lexington Road TAD Advisory Committee will review updates on ACCGov projects in the district. It will discuss committee membership based on attendance records and future commitments. The committee will also discuss capital project partnerships and prioritize public infrastructure goals.

tax-allocation-districtcommitteeinfrastructuremembershipcapital-projects
Tue Dec 9, 2025

Mayor & Commission Meetings

Discussion of TSPLOST 2026 renewal referendum and project funding

The Mayor & Commission work session will review the TSPLOST 2026 renewal referendum, including the intergovernmental agreement, minimum distribution formula, and a list of Winterville projects. The agenda notes that all reports are draft and no final action will be taken at this session. The body will consider a resolution deadline of Feb 3 and a May referendum for voter approval.

tsplostbudgetinfrastructuretransportationdevelopment
✓ Decided: No decisions were made at the Athens work session on Dec 9, 2025

The Mayor and Commission held a work session with the cities of Bogart and Winterville. The only item discussed was the TSPLOST 2026 presentation by Capital Projects Director Josh Hawkins. No votes, approvals, or other actions were recorded.

Thu Dec 4, 2025

Audit Committee

Audit Committee reviews FY26 status and prepares FY27 workplan

The Athens Audit Committee will review and approve the minutes from the October 2, 2025 meeting. It will discuss the status of the FY26 workplan, including audits and follow‑ups. The committee will begin preparation of the FY27 workplan and receive an update from the internal auditor. The next meeting is scheduled for January 1, 2026.

auditbudgetingplanninggovernance
✓ Decided: Audit Committee unanimously approved the FY26 Organizational Audit

The committee approved the FY26 Organizational Audit with a unanimous vote. It also approved the October 2, 2025 meeting minutes after correcting a scrivener’s error, again unanimously. The January meeting was cancelled by unanimous vote, and the meeting was adjourned.

Thu Dec 4, 2025

Mayor & Commission Meetings

Review of noise ordinance updates for Agricultural Residential and Downtown areas

The Legislative Review Committee will approve the minutes from the October 2, 2025 meeting and allow public input from residents. The committee will review and discuss updates to the noise ordinance in the Agricultural Residential zone and the Commercial Downtown district, including possible objective volume measures. They will also confirm a quorum for the next meeting. The noise ordinance review was assigned to the committee by Mayor Girtz on September 3, 2024.

noise-ordinancepublic-inputminutes-approvalquorumzoning
✓ Decided: Legislative Review Committee approved minutes and adjourned meeting

The committee unanimously approved the October 2, 2025 meeting minutes. Members reviewed downtown noise‑complaint data and discussed possible updates to the noise ordinance. They requested the Attorney’s office to organize ordinance language and enforcement options for review at the next meeting. The meeting was adjourned unanimously at 2:16 p.m.

Wed Dec 3, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Board will approve the Rushton Annual Audit and meeting minutes

The Joint Development Authority will consider approval of the meeting agenda. Directors will vote to approve the minutes from the November 5, 2025 regular meeting. The board will discuss the Rushton Annual Audit. The next regular meeting is set for February 4, 2026.

auditminutesagendagovernancemeeting-schedule
✓ Decided: JDA audit accepted unanimously by all directors

The board approved the draft agenda and the minutes from the November 5 meeting. The audit of the Joint Development Authority’s financial records was accepted without objection. All actions were approved unanimously by the directors present.

Tue Dec 2, 2025

Mayor & Commission Meetings

Commission to consider temporary moratorium on data centers

The Mayor and Commission will hold public hearings on several rezoning requests and special use permits. The body is also considering a temporary moratorium on data centers and the reallocation of ARPA funds for affordable housing.

zoningdata-centersaffordable-housingpoliceshort-term-rentalsinfrastructure
✓ Decided: Commission denied rezoning of 255 Smithonia Road for church use

The Athens‑Clarke County Commission approved a grant application and related budget amendment, adopted a tax foreclosure resolution, and designated Super Bowl Sunday for alcohol sales. It also approved a $1 million corridor planning contract, a sidewalk project, a sewer connection, and an ordinance allowing short‑term rentals. The rezoning request for 255 Smithonia Road was denied.

Wed Nov 19, 2025

Historic Preservation Commission

Historic Preservation Commission reviews six certificate of appropriateness requests

The commission will consider six Certificate of Appropriateness applications for properties in historic districts, including a retaining‑wall modification, a structure‑raising project, accessory‑building roofing, rear‑porch changes, and a conceptual addition and renovation. The meeting also includes adoption of minutes from October 15, 2025 and updates on the strategic plan and committee reports. Public comment is permitted for each agenda item.

historic-preservationzoningdesign-reviewcertificate-of-appropriatenessplanning
Wed Nov 19, 2025

Human Relations Commission

Commission votes on 2026 meeting schedule

The Human Relations Commission will accept the minutes from the October 22, 2025 meeting and review a handout. It will discuss updates from the chairperson and the People & Belonging department. New business includes a vote on the 2026 meeting schedule, a review of the commission bylaws, planning a Unity in the Community event, and a vote on participation in the MLK Parade. The meeting will also set the date for the December meeting.

meetingsschedulebylawscommunityparade
✓ Decided: Committee approved moving forward with the Menstrual Project pilot

The Human Relations Commission voted to move forward with the Menstrual Project recommendation. It also decided to shift the Housing Tour to Spring 2026 and to order supplies for the Holiday Parade on October 24, 2025. The commission will explore November community events such as turkey or jacket drives and will request assistance from the communications department for social‑media and marketing guidance. Previous meeting minutes were accepted and chairperson updates were moved later in the agenda.

Wed Nov 19, 2025

Solid Waste Advisory Commission

Solid Waste Advisory Commission to discuss C&D Reuse Program

The Commission will review division reports from July and August and discuss the C&D Reuse Program with the Executive Director of Historic Athens. The body will also address by-law amendments and a grant update.

waste-managementrecyclinglandfillgrants
Wed Nov 19, 2025

Arena District Steering Committee

Arena District Steering Committee to vote on Development Facilitator scope of work

The committee will review and vote on the scope of work for a Development Facilitator. Members will also review Q3 reports regarding EWBI and Classic Center Arena Bonds.

arena-districteconomic-developmentbondscontracts
✓ Decided: Committee unanimously approved Accenture's revised development facilitator scope

The steering committee approved the October 16 minutes unanimously. It also approved, without dissent, the amended scope of work for Accenture as the development facilitator. The agenda was not approved, the next meeting was set for Dec. 7, and the meeting was adjourned unanimously.

Tue Nov 18, 2025

Mayor & Commission Meetings

Commission to approve funding and agreements for College Square Pedestrian Plaza

The Athens‑Clarke County Mayor and Commission will consider a series of actions for the College Square Pedestrian Plaza project. Items include approving an intergovernmental agreement with the Athens Downtown Development Authority, amending the Parking Management Agreement for 20 more years, authorizing a construction easement, and allowing up to $1.5 million in supplemental TSPLOST funding. The commission will also confirm the selection of Sheridan Construction as the construction contractor for the plaza.

pedestrian-plazatsplostparking-managementconstruction-contractbudget
✓ Decided: Reallocation of ARPA funds for affordable housing approved

The Athens-Clarke County Commission adopted several grant acceptances and resolutions, including the Byrne Justice Assistance Grant and a resolution on judicial tax foreclosures. It approved multiple infrastructure projects such as the Vincent Drive sidewalk design, a private pump station at 1125 Prince Ave, and a raw water conveyance concept. The commission also approved the reallocation of recaptured ARPA funds for affordable housing projects. No vote tallies were recorded for these items.

Tue Nov 18, 2025

Mayor & Commission Meetings

Mayor and Commission to hold special session for executive session

The Unified Government of Athens-Clarke County is holding a special called session. The purpose of the meeting is to enter into an executive session to discuss pending or threatened litigation.

legal-affairsexecutive-sessiongovernment-administration
✓ Decided: Commission approved $1.5 M funding and agreements for College Square Pedestrian Plaza

The commission entered executive session to discuss pending litigation and then adjourned it. In a later session, commissioners suspended the rules to consider a single item and unanimously approved an intergovernmental agreement with the ADDA, an amendment to the Parking Management Agreement, a temporary construction easement, and up to $1,500,000 in TSPLOST funding for the College Square Pedestrian Plaza. The mayor and staff were authorized to execute all related documents.

Tue Nov 18, 2025

Mayor & Commission Meetings

Commission considers contractor and funding for College Square Pedestrian Plaza

The Mayor and Commission will consider the contractor selection and final IGA agreement for the College Square Pedestrian Plaza. This project aims to transform a section of College Avenue into a public pedestrian space using local and TSPLOST funds.

tsplostpedestrian-plazainfrastructurecollege-avenuetransportation
Tue Nov 18, 2025

TAD Advisory Committee - East Downtown Area

East Downtown TAD Committee to hold visioning session and discuss mayoral resolution

The East Downtown Tax Allocation District (TAD) Advisory Committee will meet to discuss the area's vision. The committee will also consider a resolution for the Mayor & Commission.

tax-allocation-districturban-planningeast-downtowneconomic-development
✓ Decided: Committee unanimously approved request for a joint TAD committees meeting before December

The East Downtown TAD Advisory Committee approved a motion to request a meeting with all TAD committees and leadership prior to the December Mayor and Commission meeting. The amended agenda and the September 16 minutes were also approved, each with three votes in favor and one abstention. No other new business was acted on, and the open discussion item was postponed due to time constraints.

Mon Nov 17, 2025

SPLOST Oversight Committee

Committee to decide on $300,000 solar installation at Fire Station #9

The SPLOST Oversight Committee will consider confirming the project concept for SPLOST 2020 Project 11 Sub‑Project #15, a solar photovoltaic system at Fire Station #9 with an estimated contract of $300,000. The committee will also review and approve the September 15, 2025 meeting minutes and examine monthly and expenditure reports for the SPLOST program. Additional items include discussion of Project 27 Facilities Equipment Systems Replacement (Sub‑project #5) and scheduling the next meeting.

spostrenewable-energysolarcapital-projectsbudgetpublic-safetyoversight
Mon Nov 17, 2025

TAD Advisory Committee - Newton Bridge Area

Committee to discuss Vincent Drive and Newton Bridge Road intersection improvements

The Newton Bridge Road TAD Advisory Committee will meet to review staff reports and project updates. The body will discuss next steps for intersection improvements at Vincent Drive and Newton Bridge Road.

roadsinfrastructuretransportationplanning
Mon Nov 17, 2025

TSPLOST Oversight Committee

Committee to confirm CY26 Pavement Maintenance Program road list

The TSPLOST 2023 Oversight Committee will review and approve the May 19, 2025 meeting minutes, examine monthly project and financial reports for 2018 and 2023, and consider action on Project 21 – the Calendar Year 2026 Pavement Management Program road list. The committee will decide whether the listed roadways and maintenance activities are consistent with the Initial Project Statement for Project 21. The meeting also includes other business and sets the next meeting for December 15, 2025.

pavementmaintenancetransportationbudgetgrantsoversight
Mon Nov 17, 2025

Mayor & Commission Meetings

Committee reviews updates to Public Right-of-Way ordinance language

The Right-of-Way Use Committee is meeting to discuss ordinance language updates regarding the definition and allowable uses of the public right-of-way. The goal is to provide a common understanding for staff and the public to improve safety and reduce debris storage.

public-right-of-wayordinancepublic-safetyzoning
✓ Decided: Ad Hoc Committee moves ordinance updates to December agenda, approves agenda

The committee unanimously approved its agenda and the October 28, 2025 meeting minutes. A motion was passed to forward the revised ordinance language for inclusion in the December agenda‑setting meeting. The next meeting was scheduled for December 15, 2025 at 2:00 p.m. to review a homeless‑focused storage solution proposal. The meeting was then adjourned unanimously.

Wed Nov 12, 2025

Hearings Board

Hearings Board to consider yard setback variances for 150 Cloverhurst Terrace

The Athens-Clarke County Hearings Board will review a request from Jeremy Field for two variances at 150 Cloverhurst Terrace. The petitioner is seeking to reduce the required side and rear yard setbacks for a single-family residential property.

zoningvarianceresidential
Wed Nov 12, 2025

Mayor & Commission Meetings

Fire department pay study and budget impact presented for discussion

The commission will review a draft classification and compensation study for the Athens‑Clarke County Fire Department, including projected salary and pension costs for the next five years and a proposed 20‑step pay plan. The meeting also includes an update on the Capital Projects Service Delivery Plan. No formal actions will be taken; the session is for information only.

fire-paycollective-bargainingbudgetcapital-projectsclassification-study
✓ Decided: Commission discussed fire pay plan and capital projects; no decisions taken

The meeting consisted of a work session where the commission reviewed the fire pay plan/collective bargaining and the capital projects service delivery plan. No votes, approvals, denials, or other formal actions were recorded. The session ended without any substantive decisions.

Wed Nov 12, 2025

Deferred Compensation Board

Board reviews investment consultant report and deferred compensation plan updates

The Deferred Compensation Board will approve the minutes from the August 13, 2025 meeting and hear the Investment Consultant’s Report covering fund performance, plan charges, and potential fund changes. The board will discuss its own roles, term lengths for board representatives, and updates to the deferred compensation plan design. An annual performance review of the investment consultant and actuarial services will also be considered. Announcements include the GAPPT Annual Conference in March 2026 and a joint meeting with the Pension Board in January 2026.

deferred-compensationinvestmentboard-governanceannouncementsplan-design
✓ Decided: Board extended term limits for employee and resident participants to three years

The Deferred Compensation Board voted unanimously to adopt Option #2, extending term limits for both employee participants and the resident participant from two to three years. It also approved moving participants under age 39 into target‑date funds, changed the automatic enrollment period from 30 to 45 days, and authorized the chair to sign paperwork for a fund change. All motions were passed unanimously.

Mon Nov 10, 2025

Athens Cultural Affairs Commission

ACAC discusses public art calls and upcoming gallery events

The Athens Cultural Affairs Commission will review minutes from the previous month and receive updates on completed training and upcoming art calls. The group will also discuss an exhibit at the Lyndon House and the Lantern Parade for 2026.

artspublic-artcouncilgallerypoet-laureateeducationoutreach
✓ Decided: Commission unanimously approved motion to adjourn the meeting

The Athens Cultural Affairs Commission held its regular monthly meeting and discussed upcoming events, staff updates, and community announcements. The only formal action taken was a unanimous vote to adjourn the meeting. The next regular meeting is scheduled for 1/12/2026.

Thu Nov 6, 2025

Planning Commission

Planning Commission will consider a text amendment to short‑term rental ordinance

The commission will introduce staff reports, approve the October 2, 2025 meeting minutes, and review MACORTS. It will consider two old‑business items: a master planned development petition for 2415 Jefferson Road and a rezoning and special‑use permit request for 115 McClung Road. New business includes three special‑use permit requests for 250 Little Street, rezoning requests for 1065‑1085 Hull Road and 255 Smithonia Road, and a text amendment to Title IX of the Code of Ordinances concerning short‑term rentals. The meeting will conclude with reports from the chair and planning director and miscellaneous announcements.

zoningdevelopmentshort-term-rentalsplanningland-use
✓ Decided: Commission approves rezoning of 115 McClung Road and related special‑use permit

The Planning Commission recommended approval of the rezoning of 115 McClung Road from Commercial‑General to Employment‑Office and also approved a special‑use permit for the same site, with votes of 6‑1 and 5‑2 respectively. It approved the 2415 Jefferson Road master‑planned development with three conditions, passing 4‑3. The commission also approved special‑use permits for two units (A208 and A303) at 250 Little Street, each by a 6‑1 vote. Routine items to place staff reports and prior minutes into the record were adopted unanimously.

Wed Nov 5, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB board approves funding and minutes for November meeting

The Keep Athens-Clarke County Beautiful board convened at Synovus Bank to approve meeting minutes, a treasurer's report, and an executive director's report. The board unanimously approved funding up to $150 for Bring Back the Chipper donuts.

kaccbboard-meetingbudgetdonationscommittee-updates
✓ Decided: Board approved $150 funding for Christmas Tree Chipper

The board unanimously approved the October meeting minutes and the treasurer’s financial report. It also approved a $150 allocation for a Christmas tree chipper. The board set the retreat date for December 3 at Trappeze Pub. All motions were passed with no opposition.

Wed Nov 5, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Joint Development Authority to review routine agenda items and reports

The Joint Development Authority will consider routine agenda approvals, a treasurer's financial report, an update on the ARPA Small Business Grant, and a staff audit report. No substantive policy changes or new contracts are on the agenda.

governmentbudgetgrantsauditmeeting
✓ Decided: Directors unanimously approved the agenda and minutes, and tabled the Treasurer’s Report

The board approved the draft agenda and the minutes from the September 17 special meeting by unanimous vote of all four directors present. The Treasurer’s Report was postponed to the next meeting, also by unanimous consent. The meeting was then adjourned.

Wed Nov 5, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA will discuss an update on the ARPA Small Business Grant

The Joint Development Authority will hold a special called meeting to approve its agenda and the minutes from the September 17, 2025 meeting. The treasurer will present a report, and the board will receive an update on the ARPA Small Business Grant and a staff report on the Rushton audit. The meeting will also set the date for the next regular session.

grantsfinanceauditmeetingdevelopment
Wed Nov 5, 2025

Pension Board

Board reviews 2025 valuation results and discusses plan design

The Athens-Clarke County Pension Board will approve the minutes from its August 6, 2025 meeting and receive updates on board membership and the retiree representative election. It will review pension investment activity through September 30, 2025, examine the July 1, 2025 valuation results and discuss plan design, and conduct an annual performance review of its investment manager and actuarial services. The agenda also includes an announcement of the GAPPT Annual Conference for March 2026 and a period for employee comments.

pensioninvestmentsvaluationboardperformance-review
✓ Decided: Board approves August minutes, postpones performance review to Feb 2026

The board unanimously approved the regular meeting minutes from August 6, 2025. The board agreed to postpone the Annual Performance Review of the Investment Manager and Actuarial Services until the February 4, 2026 meeting. The meeting was adjourned unanimously at 11:27 a.m.

Tue Nov 4, 2025

Mayor & Commission Meetings

Athens-Clarke County to consider $28.7 million pavement maintenance program

The Mayor and Commission will vote on the Calendar Year 2026 Pavement Maintenance Program and various zoning amendments. The body is also discussing infrastructure projects and a funding request for the Food Bank of Northeast Georgia.

roadszoningbudgethousinginfrastructure
✓ Decided: Commission approves $1.76 M road grant and adopts multiple ordinances

The commission approved the minutes from October meetings and accepted two street right‑of‑way notices. It unanimously consented to the CY2026 Pavement Maintenance Program, including a $1,756,898.36 grant application and related ordinance. Additional ordinances created yellow curbing on Herring and Reese Streets, amended the FY2026 budget for solid‑waste CHaRM processing, and elected not to require mobile‑home decals. Finally, a $1,853,086.77 contract was awarded for culvert replacement on Lavender and Roberts Roads.

Tue Oct 28, 2025

Athens in Motion Commission

Commission will consider approvals for Barber Street bike and pedestrian improvements

The Athens in Motion Commission will discuss the proposed CY26 Pavement Management Program and seek feedback. It will vote on several actions for the Barber Street bike and pedestrian improvements, including plan approvals and a design services supplement. The meeting will also provide updates on capital projects, staff reports, and committee activities.

bike-pedestrianpavement-managementcapital-projectsplanningtransportation
✓ Decided: Barber Street bike/ped improvements for segments 1‑2 approved, design supplement for segment 3

The commission unanimously approved the meeting agenda and the September meeting minutes. It approved the proposed preliminary and right‑of‑way plans for Barber Street Segments 1 and 2 and authorized staff to move those plans to final design, ROW acquisition, and bid phases. The commission also approved a professional services supplement for on‑call designer Alfred Benesch and Company to address sidewalk gaps in Segment 3. The meeting was adjourned at 6:03 pm.

Tue Oct 28, 2025

Mayor & Commission Meetings

Committee reviews updates to Public Right-of-Way ordinance definitions

The Right-of-Way Use Committee is discussing updates to ordinance language regarding the definition and allowable uses of public rights-of-way. The goal is to create a common understanding for staff and the public to be presented to the full Mayor and Commission by the November Voting Meeting.

ordinancepublic-safetyright-of-wayinfrastructure
✓ Decided: Committee approved agenda, minutes and adjourned unanimously

The Ad Hoc Committee on Public Right of Way approved the meeting agenda and the October 10, 2025 minutes, each with a unanimous vote. No substantive policy changes or ordinances were adopted. The committee set a next meeting for November 17 and will research a locker pilot for unhoused individuals.

Wed Oct 22, 2025

Human Relations Commission

Human Relations Commission to discuss Menstrual Project and housing tour

The Human Relations Commission will meet to review updates on the Menstrual Project and a housing tour. The body will also discuss holiday parade planning and November events.

human-relationshousingcommunity-eventspublic-health
✓ Decided: Committee approved moving forward with Menstrual project recommendation

The Human Relations Commission accepted the prior meeting minutes and voted to postpone Chairperson updates. It approved the Vice Chair's recommendation to advance the Menstrual project pilot. Cory and Annesia were tasked with ordering holiday parade supplies on October 24, 2025, and the commission agreed to hold its next meeting on November 19, 2025.

Tue Oct 21, 2025

Mayor & Commission Meetings

Mayor and Commission consider $15 million development agreement for 295 E. Dougherty St.

The commission will vote on a consent agenda that includes adopting the 2026 pavement maintenance program, adding two free holiday parking days, approving a solar panel contract for Fire Station #9, waiving $37,549 in water and wastewater fees for the 195 Bray St affordable housing project, and authorizing several parking prohibitions and a culvert replacement contract. They will also discuss new business items such as CHARM contingency funding, a revised MOU with the Board of Regents, the $15 million development agreement for 295 E. Dougherty St., and a work order for Phase II of the North Oconee River sanitary sewer interceptor project.

pavementparkingsolarhousinginfrastructuredevelopmentsewertaxes
✓ Decided: Mayor and Commission approved a solar panel project for Fire Station #9

The commission approved the 2026 Pavement Maintenance Program roadway list and added Indigenous Peoples’ Day and Juneteenth as free parking holidays. It also approved a solar panel installation at Fire Station #9, waived $37,549 in water and wastewater fees for the 195 Bray St affordable‑housing project, and adopted parking prohibitions on Herring and Reese Streets. Additionally, the body authorized a culvert‑replacement contract, and adopted a resolution to stop issuing mobile‑home decals.

Tue Oct 21, 2025

Mayor & Commission Meetings

Commission to approve holiday lighting MOU with downtown development authority

The Athens-Clarke County Mayor and Commission will consider a Memorandum of Understanding with the Athens Downtown Development Authority to install and maintain a holiday lighting display on College Avenue and Clayton Street. The meeting also includes an executive session to discuss a real estate acquisition or disposal, as authorized by state law. Members of the public may address the commission on agenda items for up to three minutes each.

holiday-lightingdowntown-developmentreal-estateexecutive-sessionpublic-input
✓ Decided: Commission approves holiday lighting MOU, suspends rules, and enters executive session

The commission voted 9‑yes to suspend its rules for a single new business item. It then approved the Memorandum of Understanding with the Athens Downtown Development Authority for a holiday lighting display along College Avenue and Clayton Street. A third 9‑yes vote placed the commission into executive session to discuss real‑estate acquisition or disposal. The meeting was adjourned unanimously.

Tue Oct 21, 2025

TAD Advisory Committee - East Downtown Area

Open discussion and visioning session for the East Downtown TAD area

The East Downtown TAD Advisory Committee will hold an open discussion and visioning session for the district. The meeting includes routine approvals of the agenda and minutes from September 16, 2025. Staff will provide updates on ACCGov projects in the TAD and report that there are no funded TAD requests at this time.

tax-allocation-districteconomic-developmentplanningcommunity-engagement
Mon Oct 20, 2025

SPLOST Oversight Committee

Committee to review Fire Station #9 solar project concept

The SPLOST Oversight Committee will review a proposed solar photovoltaic system for Fire Station #9, which would cost approximately $300,000. The committee is asked to confirm if the project concept aligns with the initial project statement.

splostsolarfire-stationoversightbudgetrenewable-energy
Mon Oct 20, 2025

Athens Cultural Affairs Commission

Commission will vote on Memorial Park and Animal Services proposals

The Athens Cultural Affairs Commission will discuss and vote on two recommendations: a presentation on Memorial Park and a presentation on Animal Services. The meeting also includes updates on a canceled poetry event, the start of a public art training course, and details about upcoming art exhibits and calls for submissions.

cultural-affairsartpublic-artparksanimal-services
Mon Oct 20, 2025

TAD Advisory Committee - Newton Bridge Area

Committee will discuss membership and vision for Newton Bridge TAD

The Newton Bridge Road TAD Advisory Committee will meet to discuss its membership and hold an open visioning session for the TAD area. No funded projects or rezoning actions are on the agenda. The meeting includes a staff report updating on ACCGov projects and TAD requests, which currently have none.

tadplanningcommunity-engagementmembershipathens-ga
✓ Decided: Committee unanimously approved agenda and prior meeting minutes

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the September 15, 2025 meeting. No funding requests, project updates, or new actions were approved. Discussion of committee membership and a visioning session were postponed pending potential TAD committee consolidation.

Mon Oct 20, 2025

TSPLOST Oversight Committee

Committee to review 2026 Pavement Maintenance Program roadway list

The TSPLOST Oversight Committee will discuss whether the proposed roadway list for the Calendar Year 2026 Pavement Maintenance Program aligns with the project's initial statement. The committee will also review monthly project and revenue reports for the 2018 and 2023 TSPLOST programs.

roadsinfrastructurebudgettsplost
Mon Oct 20, 2025

Mayor & Commission Meetings

Commission to consider updates to BAC procedures and Community Benefits Agreement

The Government Operations Committee will approve the September 15, 2025 meeting minutes and discuss several policy updates. Items include recommended changes to the Board of Adjustments and Appeals (BAC) procedures and revisions to the Community Benefits Agreement portion of the Leasing Policy. The committee will also review the recently approved Short Term Rental Ordinance and consider future actions on renter protections and employee engagement.

governancepolicyhousingshort-term-rentalsemployee-engagement
✓ Decided: Commission approved minutes and referred historic property issues to Property Committee

The committee unanimously approved the minutes from the September 15, 2025 meeting. Members agreed to refer the discussion of county‑owned historic properties to the Property Committee for further study. The meeting was adjourned by unanimous vote.

Thu Oct 16, 2025

Arena District Steering Committee

Arena District Steering Committee to interview development facilitator candidates

The committee will hold oral presentations and interviews with short-listed submitters for the Arena District Development Facilitator RFQ. Members will then discuss these presentations to move forward with the selection process.

arena-districtdevelopmentprocurementplanning
✓ Decided: Committee unanimously approved agenda, minutes and adjourned

The steering committee approved the meeting agenda with a unanimous vote. The draft minutes from the previous meeting were also approved unanimously. The meeting was then adjourned by unanimous consent. No substantive development decisions were made.

Wed Oct 15, 2025

Historic Preservation Commission

Commission reviews structure raising at 127 Nantahala Ave.

The Historic Preservation Commission will review requests for structural changes and security installations in the Boulevard and Downtown Historic Districts. The body will also consider a conceptual design for a facade modification and rooftop addition.

historic-preservationzoningdowntownboulevard-district
✓ Decided: Historic Preservation Commission approved a gated entry with dark coating condition

The commission approved Russell Edwards’ request for a retractable gate at 121 E. Clayton St, requiring a dark coating on the gate (vote 3‑1). It also accepted additional images for the gate as Exhibit A (unanimous) and recused member Chris Jackson from the vote. Officers were elected, naming Ted Rossier as chair and Bobbie Epting as vice‑chair (5‑0). Several routine items, including staff report introductions and minute adoptions, were passed unanimously.

Wed Oct 15, 2025

Arena District Steering Committee

Committee to interview candidates for Arena District Development Facilitator

The Arena District Steering Committee is meeting to conduct oral presentations and interviews. The committee will evaluate short-listed submitters for the Arena District Development Facilitator RFQ.

arena-districtdevelopmentrfqinterviews
✓ Decided: Committee unanimously approved agenda, minutes and adjourned the meeting

The Arena District Steering Committee approved its October 15 agenda and the August 20 draft minutes by unanimous vote. The committee also voted unanimously to adjourn the meeting. No other actions were taken.

Wed Oct 15, 2025

Mayor & Commission Meetings

Commission reviews Affordable Housing Trust Fund and market findings

The commission will hear an overview of the Affordable Housing Trust Fund and a market overview with key findings from HTF research and interviews. Q&A sessions will follow each presentation. No formal actions or votes are scheduled for this meeting.

affordable-housinghousing-trust-fundresearchcommunity-development
Tue Oct 14, 2025

Mayor & Commission Meetings

Mayor and Commission hold work session on land use and short-term rentals

The Mayor, Commission, and Planning Commission are holding a joint work session to discuss future updates. No final actions will be taken during this meeting.

planningzoningshort-term-rentalsland-use
✓ Decided: No decisions made; commission discussed land use and short‑term rentals

The joint Mayor & Commission and Planning Commission work session met on October 14, 2025 at the Dougherty Street Auditorium. Commissioners and planning members discussed updates to the Future Land Use Plan and the Short‑Term Rental Ordinance. No formal actions, approvals, or votes were recorded on these items.

Fri Oct 10, 2025

Mayor & Commission Meetings

Draft ordinance to clarify definition and uses of public right-of-way

The Right-of-Way Use Committee will approve its agenda and the minutes from the October 3, 2025 meeting. It will allow public comments on items listed in the agenda, limited to three minutes per speaker. The committee is tasked with developing ordinance language that clarifies the definition of “Public Right-of-Way” and its allowable uses, to be presented to the full Mayor and Commission by the November voting meeting. The meeting will also set the date for the next committee session and confirm a quorum.

right-of-wayordinancepublic-safetycommitteemeeting
✓ Decided: Committee agreed to refine sidewalk obstruction ordinance language

The committee unanimously approved the agenda and the minutes from the October 3 meeting. Members discussed sidewalk obstruction data and agreed that citations and warnings, not arrests, are appropriate for first offenses. They decided to refine the draft ordinance language on storage limits, bike‑parking exceptions, peaceful gatherings, and bus‑stop areas, and to gather more examples from other cities before final recommendations. The next meeting was set for October 24, 2025.

Wed Oct 8, 2025

Hearings Board

Hearings Board to hear two residential variance requests

The Athens-Clarke County Hearings Board will consider two variance requests for single-family residential properties. One request seeks to increase the front yard parking allotment above 25%, and the other seeks to reduce the rear yard setback from 20 feet to 10 feet.

zoningvarianceresidentialplanninghearings-board
Tue Oct 7, 2025

Mayor & Commission Meetings

Commission adopts $200,000 Recreational Trails Grant for Southeast Clarke Park

The Athens-Clarke County Mayor and Commission will adopt several ordinances, including a grant for a recreational trail project at Southeast Clarke Park. They will also approve multiple service and supplier contracts and consider rezoning applications for industrial and commercial uses. A public hearing will be held on the planning commission's recommendations for those rezoning requests.

zoningcontractsbudgettransportationparkspublic-works
✓ Decided: Commission approved $3 M grant application for Memorial Park master plan

The Athens‑Clarke County Commission approved several grant applications and funding measures, including a $3 million Georgia Outdoor Stewardship Program grant for the Memorial Park Master Plan and a $200,000 Recreational Trails Program grant for Southeast Clarke Park trail improvements. It also authorized new Leaf & Limb staffing, a $1.65 million federal transit grant application, and awarded contracts for transit surveillance and airport fuel services. The minutes of prior meetings were approved and the Local Emergency Operations Plan was adopted.

Fri Oct 3, 2025

Mayor & Commission Meetings

Ad Hoc Committee to update Public Right-of-Way ordinance language

The Right-of-Way Ad Hoc Committee is meeting to develop ordinance updates regarding the definition and allowable uses of public rights-of-way. The committee aims to present these updates to the full Mayor and Commission by the November Voting Meeting.

right-of-wayordinancepublic-safetyzoning
✓ Decided: Committee agreed to rewrite obstruction ordinance to cover all public areas

The commission unanimously approved the meeting agenda (including September 23 minutes) and the September 23 minutes themselves. The committee agreed to replace fixed timeframes with flexible language and to use the term “public area” in a revised obstruction ordinance. Attorney Courtney Davis will draft the revised ordinance and staff will verify enforcement data before the next meeting on October 10.

Thu Oct 2, 2025

Audit Committee

Audit Committee will review FY26 audit workplan and approve prior meeting minutes

The Audit Committee will consider and approve the minutes from its August 7, 2025 meeting. It will receive a status report on the FY26 audit workplan, covering current audits and follow‑up items. The committee will also hear an update from the internal auditor. The next meeting is scheduled for November 6, 2025.

auditfinanceoversightgovernance
✓ Decided: Audit Committee unanimously approves August 7 meeting minutes

The committee approved the minutes from the August 7, 2025 meeting by unanimous consent. Members then reviewed the FY26 Organizational Structure Audit, noting its informational nature and discussing its language and clarity. Commissioners agreed to postpone any formal vote on the audit report until questions are answered, likely in December. No other substantive actions were voted on.

Thu Oct 2, 2025

Planning Commission

Rezoning and special‑use permit request for 115 & 125 McClung Road considered

The Athens‑Clarke County Planning Commission will adopt staff reports, approve the September 4, 2025 meeting minutes, and review MACORTS. It will consider an old‑business Special Use Permit for 480 S. Milledge Avenue and three new‑business items: a rezoning and Special Use Permit for 115 & 125 McClung Road, a text amendment to the code on home occupations, and a text amendment on veterinary clinics and kennels. The public may address the commission for up to three minutes on each agenda item.

zoningspecial-use-permitcode-amendmentplanning-commissionpublic-hearing
✓ Decided: Planning Commission approved prior minutes and tabled rezoning request

The commission approved the September 4, 2025 Planning Commission meeting minutes. The rezoning and special‑use permit request for 115 & 125 McClung Road was tabled after the applicant withdrew it prior to the meeting. No other items were decided.

Thu Oct 2, 2025

Mayor & Commission Meetings

Legislative Review Committee to discuss updates to the city noise ordinance

The Legislative Review Committee will approve the minutes from the September 4, 2025 meeting, allow brief public comments, and review the existing noise ordinance. Members will discuss possible updates for non‑agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district, including the use of objective volume measurements. The committee will also confirm a quorum for the next meeting on November 6, 2025.

noise-ordinancezoningpublic-hearingcommissionagenda
✓ Decided: Committee approved September 4, 2025 minutes

The Legislative Review Committee unanimously approved the September 4, 2025 meeting minutes. Members discussed possible updates to the city noise ordinance but did not adopt any changes, instead directing staff to keep evaluating models from other jurisdictions and related enforcement options. The meeting was adjourned unanimously.

Wed Oct 1, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

Board unanimously approves meeting minutes and financial and director reports

The Keep Athens-Clarke County Beautiful Board met on October 1, 2025 at Synovus Bank – Downtown. The board approved the prior meeting minutes, the Treasurer’s Report, and the Executive Director’s Report, each by unanimous motion. Committee updates were given for Business and Industry, Events, and Outreach/PR. Old and new business items were discussed but no decisions were recorded.

governancefinancereportscommittees
✓ Decided: Board unanimously approved September minutes and financial reports

The board voted to approve the September meeting minutes. The Treasurer’s Report showing a net operating loss of $932.53 was approved. The Executive Director’s Report, including revenue and expense details, was also approved. The meeting was then adjourned.

Tue Sep 30, 2025

Mayor & Commission Meetings

Mayor and Commission will hold an executive session on personnel matters

The Athens Mayor and Commission met in a special called session on September 30, 2025. The meeting was called to enter an executive session to discuss personnel matters under O.C.G.A. § 50-14-3(b)(2). No other agenda items were scheduled beyond roll call and adjournment.

executive-sessionpersonnelgovernmentathens
✓ Decided: Commission entered executive session and adjourned unanimously

The special session was called to discuss confidential personnel matters. Commissioners voted unanimously to enter executive session, then unanimously voted to adjourn the meeting.

Wed Sep 24, 2025

Human Relations Commission

Human Relations Commission discusses community projects and upcoming events

The commission will review updates from the Chairperson, Inclusion Office, and subcommittees, and hear public comments on old and new business. Topics include the Menstruation Project, subcommittee groups, a housing tour update, and planning for October events and the Christmas Parade. No formal decisions or contracts are listed on the agenda.

human-relationscommunity-projectseventspublic-commenthousinginclusion
✓ Decided: William Redding appointed as Human Relations Commission secretary

The commission voted to appoint William Redding as secretary, replacing Mary Frances O’Neil. The committee also decided to form subcommittees to develop a float for the December 4th ACCGov Parade of Lights. Other topics such as the Faith and Blue Festival and the Housing Tour were discussed but no formal actions were taken.

Tue Sep 23, 2025

Athens in Motion Commission

Commission will discuss the Barber Street bike and pedestrian project.

The Athens in Motion Commission will hold its monthly meeting on September 23, 2025 to review agenda items and take public comment. Commissioners will receive updates on TSPLOST 2026, a plan revision, and staff reports, and will consider several capital projects including the Barber Street bike and pedestrian project and concept approvals for sidewalk improvements on W. Broad & Hancock, Stonehenge, and Sycamore Drive. Additional items include a notice of award for an RCP planning grant and updates on bike rack installations, transit, and regional planning.

transportationbike-pedestriancapital-projectstsplostsidewalksplanning
✓ Decided: AiMC will accept sharrows for Barber Street segment 4 to speed project

The commission approved the meeting agenda and the August meeting minutes unanimously. The commission decided to accept, rather than recommend, sharrows for segment 4 of the Barber Street Bicycle & Pedestrian Improvements Project to accelerate completion of the remaining segments. The meeting was adjourned after a motion to adjourn was moved and seconded.

Tue Sep 23, 2025

Mayor & Commission Meetings

Committee will draft ordinance updates defining public right-of-way uses

The Ad Hoc Right-of-Way Use Committee will consider updates to the city ordinance that clarify the definition and allowable uses of public right-of-way, including sidewalks, bike lanes and vehicle lanes. The committee will also confirm a quorum for its next meeting on September 30, 2025. Public comments are invited on agenda items.

right-of-wayordinancepublic-safetycity-governmentmeeting
✓ Decided: Committee tasked staff to research public right‑of‑way ordinance updates

The committee unanimously approved the meeting agenda. It directed staff to work with the County Attorney’s Office and ACCPD to research and propose updates to the public right‑of‑way ordinance. The next meeting was scheduled for Friday, October 3, 2025. The meeting was adjourned by unanimous vote.

Tue Sep 23, 2025

Airport Authority

Airport Authority will review minutes and hear manager reports on finances and projects

The Athens Ben Epps Airport Authority will review and approve the August meeting minutes. The Airport Manager will present reports on finances, operations, capital improvement projects, and marketing and outreach activities. Old business includes a Lexington Corridor update, for which no report is available. No new business is scheduled, and committee updates will be provided before adjourning.

financeoperationscapital-projectsmarketingmeetings
✓ Decided: August meeting minutes approved unanimously

The Authority approved the August meeting minutes with a unanimous vote. The meeting was then adjourned unanimously. No other substantive actions were decided at this session.

Sat Sep 20, 2025

Mayor & Commission Meetings

Commission will discuss FY27 budget and upcoming TSPLOST 2026 funding

The Athens-Clarke County Mayor & Commission will review the FY27 budget and longer‑term financial plans. They will also consider the TSPLOST 2026 proposal, a capital‑projects delivery framework, and a response to zoning questions. The meeting includes a mid‑point review of the manager’s 90‑day observations and a discussion of top priority areas for the next year.

budgetzoningcapital-projectstransportationstrategic-planning
✓ Decided: Retreat meeting discussed projects and budget but made no decisions

Commission members met at a retreat to discuss the Capital Project Delivery Framework, the TSPLOST 2026 initiative, and the FY27 budget and beyond. No votes were taken, and no actions were approved, denied, or tabled. The meeting adjourned at 1:24 PM.

Fri Sep 19, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA will vote to prequalify a new loan applicant and finalize the grant slate

The Joint Development Authority will consider three main actions: approving the meeting agenda, approving the minutes from the August 6, 2025 regular meeting, and voting to prequalify a new loan applicant. In old business, the board will finalize the JDA grant slate. The next regular meeting is scheduled for November 5, 2025.

developmentfinancegrantmeetingplanning
✓ Decided: JDA advances revolving loan fund request to underwriting phase

The Joint Development Authority unanimously approved the meeting agenda, moved a new revolving loan fund request to the underwriting phase, and approved revised allocations for the ARPA Workforce Development Small Business Grant program. All motions were passed unanimously by the four directors present.

Fri Sep 19, 2025

Mayor & Commission Meetings

Mayor & Commission retreat will discuss FY27 budget and upcoming projects

The Athens-Clarke County Mayor and Commission will hold a two‑day retreat to review priority areas for the next year, respond to zoning questions, and assess the manager's 90‑day observations. Sessions will cover the Capital Projects Delivery Framework, the TSPLOST 2026 initiative, and the budget for fiscal year 2027 and beyond. The agenda includes breaks, a tour of Gainesville, and a group dinner.

budgetzoningcapital-projectsstrategic-planningretreat
✓ Decided: No formal decisions were made at the September 19 retreat

The Athens-Clarke County Mayor and Commission held a retreat on September 19, 2025 at The Vault in Gainesville. Commissioners discussed the top three priority areas for the next year, responded to zoning questions, reviewed the manager's 90‑day observations, and toured Gainesville. No votes, approvals, or other formal actions were recorded.

Wed Sep 17, 2025

Historic Preservation Commission

Historic Preservation Commission reviews permits for windows, demolition, and design changes

The Athens-Clarke County Historic Preservation Commission will meet to review requests for Certificates of Appropriateness regarding window replacements, chimney removal, and a full demolition. The body will also discuss conceptual designs for new additions and exterior modifications in various historic districts.

historic-preservationzoningdemolitionarchitecturebuilding-permitsathens-clarke-county
Wed Sep 17, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

Board will vote to prequalify a new loan applicant for the JDA

The Joint Development Authority will consider approving the prequalification of a new loan applicant. Directors will also finalize the JDA grant slate under old business. Routine items include approving the agenda, approving minutes from the August 6, 2025 meeting, and setting the next regular meeting date.

joint-developmentfinanceloansgrantsgovernment
Wed Sep 17, 2025

Solid Waste Advisory Commission

SWAC to consider draft ordinance banning plastic bags and Styrofoam

The Athens-Clarke County Solid Waste Advisory Commission will approve the August 2025 meeting minutes, review July and August division reports, and discuss old business items such as the AAH cleanup and the Made to be Remade grant update. In new business, the commission will consider a draft ordinance that would eliminate plastic bags and Styrofoam containers at points‑of‑purchase, with a 12‑month phase‑in and data collection on impacts. The meeting will be streamed live and public comments can be emailed to the SWAC secretary.

waste-managementordinanceplastics-banlandfillcompostingenvironmental-justice
Tue Sep 16, 2025

TAD Advisory Committee - Mall Area

Mall Area TAD Advisory Committee to review project updates and 2026 schedule

The committee will receive staff reports on ACCGov projects and funded requests within the Mall Area Tax Allocation District. Members will also discuss the 2026 meeting schedule and a resource called Take Aim.

tax-allocation-districtinfrastructureplanningathens-clarke-county
✓ Decided: Committee approved agenda, minutes and set 2026 meeting schedule

The Mall Area TAD Advisory Committee unanimously approved the meeting agenda and the prior meeting minutes. The committee accepted a proposed schedule for its 2026 meetings. Members were informed about the Take Aim resource via email, and the meeting was adjourned unanimously.

Tue Sep 16, 2025

TAD Advisory Committee - Lexington Road

Committee will review capital projects funded by SPLOST and TSPLOST in the TAD

The Lexington Road TAD Advisory Committee met on September 16, 2025 to discuss ongoing and upcoming matters for the tax allocation district. The agenda included routine items such as approval of the agenda and minutes, a staff report on ACCGov projects, and updates on the community‑identified priority list and bylaws. New business focused on reviewing capital projects funded by SPLOST and TSPLOST, confirming that there are currently no public utilities projects, and setting the 2026 meeting schedule. The committee also introduced the Take Aim resource and scheduled the next meeting for December 9, 2025.

tax-allocation-districtcapital-projectssplosttsplostmeeting-schedulecommunity-priorities
✓ Decided: Committee unanimously approved the 2026 meeting schedule

The Lexington Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the May 6, 2025 meeting. The committee also unanimously approved the schedule for its 2026 meetings (March 17, June 16, September 15, and December 15). No new public‑utilities projects were identified, and no funding decisions were made.

Tue Sep 16, 2025

Mayor & Commission Meetings

Mayor & Commission to approve $3.5M loan for North Downtown Athens Phase 2

The Athens‑Clarke County Mayor and Commission will consider a range of contracts, grant applications, and infrastructure projects. Items include a five‑year aviation fuel supply contract with Titan Aviation Fuels, a $701,963 SPLOST facilities equipment replacement, and a $3.5 million soft‑pay loan to support the $64.5 million North Downtown Athens Phase 2 redevelopment. The board will also review a water‑and‑wastewater connection fee exemption for Meissner’s $250 million campus investment and approve pedestrian improvement designs for Sycamore Drive. Additional agenda items cover transit fleet surveillance, airport fuel services, and adoption of the Local Emergency Operations Plan.

transportationfinanceinfrastructurehousingwaterparks
✓ Decided: Mayor and Commission agenda-setting session held, no decisions made

The September 16, 2025 meeting was an agenda‑setting session. No votes were taken on any items, and the commission did not approve, deny, or table any proposals. The meeting was adjourned at 8:02 p.m. after a motion to approve the session.

Tue Sep 16, 2025

Mayor & Commission Meetings

Commission to approve MOU for Sanford Stadium Phase II sewer project

The Mayor and Commission will consider approval of a Memorandum of Understanding with the University of Georgia Athletic Association for construction of the Phase II sanitary sewer interceptor at Sanford Stadium. They will also discuss any other old business items and may enter executive session after adjournment to discuss a real‑estate acquisition or disposal under §50‑14‑3(b)(1)(B). Public input is allowed on agenda items for up to three minutes per speaker.

sewerinfrastructureuniversityreal-estatepublic-inputcommission
✓ Decided: Commission unanimously approved MOU for Phase II Sanford Stadium sewer project

The commission approved a Memorandum of Understanding between ACCGov and the University of Georgia Athletics Association to design and construct Phase II of the Sanford Stadium sanitary sewer interceptor improvement project. They also authorized the mayor and staff to execute all related documents. A motion to enter executive session for discussion of real‑estate acquisition or disposal was also approved, all by unanimous vote.

Tue Sep 16, 2025

TAD Advisory Committee - East Downtown Area

Advisory committee to approve agenda, minutes and hear staff updates

The East Downtown TAD Advisory Committee will approve the agenda and the August 21, 2025 minutes, receive staff updates, and set the date for the next meeting. No new or unfinished business items are listed.

tax-allocation-districtmeetingagendaminutesstaff-reports
✓ Decided: Committee unanimously approved agenda and prior meeting minutes

The East Downtown TAD Advisory Committee approved its agenda and the minutes from the August 21, 2025 meeting both by unanimous vote. The meeting was then adjourned by unanimous consent. No substantive project decisions were made.

Mon Sep 15, 2025

SPLOST Oversight Committee

Committee to vote on SPLOST Project 27 Sub‑Project #5 funding request

The SPLOST 2020 Oversight Committee will review and approve the minutes from the April 21, 2025 meeting, examine several SPLOST monthly and financial reports, and decide whether to confirm that the proposed concept for SPLOST 2020 Project 27, Facilities Equipment Systems Replacement, Sub‑Project #5 is consistent with its initial project statement. The decision involves $701,693 of available funding out of a total $3,879,690 allocated to Project 27. The agenda also includes scheduling items for future meetings.

spostfinancefacilitiescapital-projectsoversightbudget
Mon Sep 15, 2025

TAD Advisory Committee - Newton Bridge Area

Committee will discuss future land use and visioning for Newton Bridge Road TAD

The Newton Bridge Road TAD Advisory Committee will approve the agenda and minutes, receive a staff report on ACCGov projects and note that no TAD requests have been funded, and hold a new business discussion with ACCGov Planning and Zoning staff about future land use and visioning. The meeting will also address the status of ACCGov-issued email addresses.

land-useplanningzoningeconomic-developmenttax-allocation-district
✓ Decided: Committee approved agenda and minutes, then adjourned

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the August 18, 2025 meeting. No new funding requests or project approvals were made. The committee discussed the future land‑use map, traffic study schedule, and sewer capacity, then adjourned.

Mon Sep 15, 2025

TSPLOST Oversight Committee

Committee reviews pedestrian improvement concepts for Stonehenge neighborhood

The TSPLOST 2023 Oversight Committee is meeting to determine if the proposed project concepts for the Stonehenge Neighborhood Area Pedestrian Improvements Project are consistent with the initial project statement. The body will also review monthly project, revenue, and expenditure reports for the 2018 and 2023 TSPLOST programs.

tsplostpedestrian-safetysidewalksstonehenge-neighborhoodinfrastructurebudget
Thu Sep 11, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

JDA reviews applications for ARPA Small Business Grant program

The Joint Development Authority will consider applications for its ARPA Workforce Development Small Business Grant program. No other substantive items appear on the agenda besides routine approvals. The meeting is a special called meeting on September 11, 2025.

workforce-developmentsmall-businessgrantseconomic-development
Wed Sep 10, 2025

TAD Advisory Committee - North Avenue

Committee will decide on public input sessions for infrastructure, housing, and development

The North Avenue TAD Advisory Committee will discuss how to gather public input on community‑identified priorities, including infrastructure improvements, affordable housing, economic development partnerships, and youth development. It will also set the 2026 meeting schedule and introduce the Take Aim resource. The meeting includes routine approvals of the agenda and prior minutes.

public-inputhousinginfrastructureeconomic-developmentyouth-developmentschedule
Wed Sep 10, 2025

Hearings Board

Variance to reduce side setback for ground sign at 1005 Hull Road

The Athens-Clarke County Hearings Board will consider two variance requests. One request seeks to reduce the side setback allowance for a ground sign at 1005 Hull Road (VAR-2025-08-1572). The other request seeks to increase the maximum square footage allowed for an accessory building at 160 Greenwood Drive (VAR-2025-08-1573). Both items are scheduled for discussion and decision at the September 10, 2025 meeting.

zoningvariancesplanningdevelopment
Tue Sep 9, 2025

Mayor & Commission Meetings

Vision Zero Safety Action Plan status update presented at work session

The Athens Mayor and Commission held a work session with draft reports only. No final actions were taken. Officials provided updates on several future‑consideration projects, including pedestrian improvements and emergency planning. The session was open to the public but did not accept public comments.

transportationpublic-workssafetyplanningemergency
✓ Decided: No actions taken; commission held work session to discuss five items

The Athens-Clarke County Mayor and Commission met for a work session on September 9, 2025. Commissioners discussed five agenda items, each noted as "questions only" or a status update. No motions were made, and no approvals, denials, or tablings were recorded.

Mon Sep 8, 2025

Athens Cultural Affairs Commission

✓ Decided: Commission approved August minutes and set October meeting for Oct 20

The Cultural Affairs Commission unanimously approved the August meeting minutes. The October commission meeting was moved to October 20. The Costa Building public art selection was approved by the mayor and the commission. The Poetry for the People event was rescheduled to October 5, 3‑5 pm at Dudley Park.

Thu Sep 4, 2025

Planning Commission

✓ Decided: Commission approved rezoning of 780 Macon Highway to RM-1

The Planning Commission approved a rezoning request for 780 Macon Highway from RS-5 to RM-1 with a unanimous 6‑0 vote. It also approved a special‑use permit for 600 Oglethorpe Avenue with conditions (5‑0) and approved both future land‑use and zoning changes for 135 & 150 McClung Road (6‑0 each). The commission denied the future land‑use and zoning requests for Old Elberton Road (6‑0 each) and tabled the 2415 Jefferson Road application for up to three months (6‑0).

Thu Sep 4, 2025

Mayor & Commission Meetings

Legislative Review Committee to discuss noise ordinance updates

The Legislative Review Committee is meeting to review the existing noise ordinance. The body will discuss prospective updates regarding non-agricultural sounds in the Agricultural Residential zone and amplified noise in the Commercial Downtown district.

noise-ordinancezoningpublic-safetylegislative-review
✓ Decided: LRC voted to adopt 1‑mile and 0.5‑mile noise limits for the Fairgrounds

The Legislative Review Committee approved the August 7, 2025 minutes unanimously. The committee unanimously adopted a draft amendment setting a 1‑mile distance for item a and a 0.5‑mile distance for item b in the noise ordinance and will forward the recommendation to the full Mayor and Commission. The meeting was adjourned by unanimous vote.

Wed Sep 3, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

KACCB Board approves $500 for DDP event supplies and marketing

The Keep Athens-Clarke County Beautiful Board met to review financial reports and director updates. The board unanimously approved the treasurer's report and a specific funding allocation for event materials.

beautificationbudgetcommunity-events
✓ Decided: Board approved $500 for Dirty Dance fundraiser expenses

The board unanimously approved the August meeting minutes and the Treasurer’s Report, which showed a net loss of $1,084.64. It also approved a $500 expenditure for the upcoming Dirty Dance event, covering Facebook ads and face‑painting supplies. No other substantive actions were taken; upcoming events were announced.

Tue Sep 2, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved $2.1M grant for W. Broad pedestrian improvements

The commission voted unanimously to approve twelve consent items covering grant funding, ordinance amendments, and project authorizations. Notably, it adopted a $2,115,237 amendment to the TSPLOST 2018 Capital Projects Fund for the W. Broad Area Pedestrian Improvements and a $100,000 amendment for the Morton Theatre proscenium redesign. It also raised the residential trash service fee from $10 to $25 and approved several infrastructure, park, and renewable‑energy projects. All motions passed with unanimous or recorded 9‑yes votes.

Wed Aug 27, 2025

Human Relations Commission

✓ Decided: Human Relations Commission moves housing tour to Jan 2025 and tables menstrual project

The commission accepted the minutes from the prior meeting. A motion to shift the housing tour to January 2025 was carried. The committee also voted to table the menstrual project pilot until January 2025. No other substantive actions were taken.

Tue Aug 26, 2025

Athens in Motion Commission

Athens in Motion Commission to review capital projects and safety updates

The commission will discuss updates on the Safe Streets for All plan and Vision Zero dashboard. Members will review several capital projects and a July crash report detailing 306 total crashes.

transportationpublic-safetyinfrastructurezoningpedestrian-safety
✓ Decided: Athens in Motion Commission approved agenda unanimously

The commission unanimously approved the meeting agenda and the July meeting minutes. The Education and Communication committee tabled the UGA Watch for Dawgs event. The meeting was then adjourned.

Tue Aug 26, 2025

Airport Authority

✓ Decided: July meeting minutes approved unanimously

The board approved the corrected July meeting minutes with a unanimous vote. Mr. Sanders was designated to lead the September meeting, with Mr. Alexander as backup. The meeting was adjourned at 3:30 pm by unanimous consent. The next meeting was scheduled for Tuesday, September 23, 2025.

Thu Aug 21, 2025

TAD Advisory Committee - East Downtown Area

✓ Decided: Committee unanimously approved agenda and minutes, then adjourned

The East Downtown TAD Advisory Committee unanimously approved the meeting agenda and the prior meeting minutes. No funding requests or project updates were reported. The committee discussed potential consolidation of TAD advisory committees but took no formal action. The meeting was then adjourned.

Wed Aug 20, 2025

Arena District Steering Committee

Committee reviews submittals for Arena District Development Facilitator

The Arena District Steering Committee will meet to review and discuss submittals for a Request for Qualifications (RFQ) for a Development Facilitator. The committee will also approve the agenda and previous meeting minutes.

arena-districtdevelopmentrfq
✓ Decided: Committee selected four firms for Arena District interviews and set dates

The committee unanimously approved the meeting agenda and the June 10 minutes. It narrowed the RFQ submissions to four firms—CBRE, Seven Oaks, Accenture, and Brailsford & Dunlavey—and decided to invite them for presentations. Interview sessions were scheduled for October 15 (morning) and October 16 (afternoon). Members will email their interview questions by Friday and staff will compile the final list and confirm firm availability.

Tue Aug 19, 2025

Mayor & Commission Meetings

Mayor and Commission to consider $2.75M roundabout funding and ARPA fund recapture

The Unified Government is setting its September 2 agenda, including transit grants and infrastructure projects. The body will also discuss recapturing unspent ARPA funds from eight local agency partners and the sale of property to the Northeast Georgia Regional Commission for $10.00.

transitzoninginfrastructurebudgetarpapublic-safety
✓ Decided: Commission approves multiple development, infrastructure and grant projects

The Athens‑Clarke County Mayor and Commission approved a series of funding applications, intergovernmental agreements, and project concepts. They denied a master‑planned multi‑family development on Macon Highway and approved a commercial planned‑development amendment on Vine Street. An intersection safety improvement at Thomas and Washington Streets was also approved.

Mon Aug 18, 2025

SPLOST Oversight Committee

SPLOST Oversight Committee to review Fire Station #8 and Dudley Park projects

The committee will take action on two SPLOST 2020 projects and review monthly project and expenditure reports. The meeting includes updates on the 2005, 2011, and 2020 SPLOST programs.

splostinfrastructurefire-stationparksbudget-oversight
Mon Aug 18, 2025

TAD Advisory Committee - Newton Bridge Area

✓ Decided: Committee approved agenda, minutes and scheduled next meeting

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the prior meeting minutes. The committee assigned Daniel Young to resend ACCGov email instructions and Take Aim information. The next meeting was set for September 15, 2025, and the meeting was adjourned.

Wed Aug 13, 2025

Deferred Compensation Board

✓ Decided: Board extended elected member terms to three years with a two-term limit

The Deferred Compensation Board approved the minutes from the May 28, 2025 meeting. It modified the 457(b) plan to allow cash‑outs for terminated participants with balances of $7,000 or less and later expanded that rule to apply to the aggregate value of all employee plans. The board also amended the ordinance to extend elected member terms from two to three years with a two‑term limit, and approved a $15,000 FY27 budget for fiduciary training and travel.

Tue Aug 12, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved motion to adjourn the meeting

The commission approved the motion to adjourn the meeting. No substantive decisions or votes on agenda items were taken.

Thu Aug 7, 2025

Audit Committee

✓ Decided: Audit Committee unanimously cancels September meeting

The committee unanimously approved the minutes from the June 5, 2025 meeting. It also voted unanimously to cancel the scheduled September meeting. The meeting was adjourned by unanimous motion. The next audit committee meeting is set for October 2, 2025.

Thu Aug 7, 2025

Planning Commission

✓ Decided: Planning Commission approved Future Land Use Map update and several project requests

The commission denied the Macon Highway Village master‑planned development (7‑0). It approved the 585 Vine Street planned‑development amendment (7‑0) and the alternative‑compliance request for 530 N. Hull Street with conditions (7‑0). It also tabled the 480 S. Milledge Avenue special‑use permit for up to three months (7‑0) and approved the Future Land Use Map update and related documents (7‑0). All votes were unanimous.

Thu Aug 7, 2025

Mayor & Commission Meetings

✓ Decided: Committee directs staff to draft noise ordinance amendment and related studies

The Legislative Review Committee approved the May 1, 2025 minutes and unanimously voted to adjourn the meeting. It then asked staff to develop a draft text amendment to the noise ordinance and to provide several reports, including penalty overviews, citation guidance, top complaint locations, and single‑family noise complaint data. The committee also noted that public comment on the amendment will be required at future agenda‑setting and voting sessions.

Wed Aug 6, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

✓ Decided: Board unanimously approves treasurer's report and $237.50 ad

The board approved the Treasurer's financial report with a unanimous vote. It also approved a $237.50 flag‑pole advertisement at the discounted nonprofit rate, again unanimously. The meeting was then adjourned by unanimous consent.

Wed Aug 6, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

✓ Decided: JDA authorized opening of ARPA Workforce Development grant applications

The board unanimously approved the meeting agenda and the minutes from the May 28 special meeting. Directors voted to authorize Myung Cogan to open and advertise the ARPA Workforce Development Small Business Grant program. Chairman Cascio signed the agreement for the required annual audit of JDA records. The meeting was adjourned unanimously.

Wed Aug 6, 2025

Pension Board

✓ Decided: Board unanimously approved FY26 pension budget and changed May meeting date

The pension board approved the FY26 Pension Fund Budget with a unanimous vote. It also elected Jason Pierce as Vice Chair and changed the 2026 staff appreciation meeting date from May 6 to May 20, also unanimously. The board approved the prior meeting minutes, authorized an election for the retiree representative, and adjourned the meeting.

Tue Aug 5, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved $480,000 for water‑treatment plant sludge basin rebuild

The Athens‑Clarke County Commission approved the minutes from prior meetings and, by a consent motion, adopted eleven budget and policy items. Actions included accepting a potential $150,000 GEFA energy grant, creating a residential parking permit zone on O’Farrell Street, funding university traffic‑control reimbursements, setting the associate probate judge salary at 90% of the judge’s salary, adding a full‑time juvenile court staff attorney with $112,919 in funding, and authorizing major water‑treatment projects and a biosolids contract. The consent motion passed with nine affirmative votes.

Tue Jul 22, 2025

Athens in Motion Commission

✓ Decided: Commission approved agenda, minutes and adjourned the meeting

The Athens in Motion Commission unanimously approved the meeting agenda and the June meeting minutes. No public comments were received. The commission then voted to adjourn the session. The next meeting is scheduled for August 26 at 4:00 pm.

Tue Jul 22, 2025

Airport Authority

✓ Decided: Authority approves interim committee assignments and minutes

The Airport Authority approved the meeting minutes with one correction after a motion by Elizabeth Higgins and a second by Keith Sanders. The Authority also approved interim committee assignments for Business/Finance, Operating, and Air Service Development committees by unanimous vote. The meeting was then adjourned by unanimous vote.

Tue Jul 15, 2025

TAD Advisory Committee - Newton Bridge Area

✓ Decided: Committee approved agenda and minutes, postponed by‑laws, set future meeting dates

The advisory committee unanimously approved the meeting agenda and the prior meeting minutes. By‑laws and agenda format were postponed pending attorney review. The committee set the monthly meeting schedule for August through December on the third Monday of each month. The meeting was then adjourned.

Tue Jul 15, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved a budget amendment to cover FY 25 General Fund deficits

The Athens‑Clarke County Commission approved a series of items, including a budget amendment to address FY 25 General Fund deficits, a contract for the Sandy Creek Nature Center exhibit, and several rezoning and special‑use requests. All approvals were adopted without a recorded vote. The meeting was adjourned after the motion was approved.

Tue Jul 15, 2025

Mayor & Commission Meetings

✓ Decided: Commission voted unanimously to enter executive session and adjourn

Commissioner Fisher moved to enter executive session and adjourn, and Commissioner Taylor seconded the motion. The motion passed by a unanimous vote. The meeting then adjourned at 5:08 p.m.

Tue Jul 15, 2025

Mayor & Commission Meetings

✓ Decided: Commission approves $15.36 M sewer project and appoints new city manager

The commission unanimously approved the Sanford Stadium Sanitary Sewer Interceptor Improvement Project Phase II and allocated $15,360,000 from the Water & Sewer Enterprise Fund. It also approved the ACCPD School Resource Officer contract for 2025‑2026 and appointed three temporary Acting Clerks. A roll‑call vote confirmed Robert S. Cowell, Jr. as Manager (8‑1‑1). All other motions passed unanimously.

Tue Jul 15, 2025

TAD Advisory Committee - East Downtown Area

✓ Decided: Committee appoints new Chair, Vice Chair, and Secretary

The East Downtown TAD Advisory Committee unanimously approved its agenda and the minutes from prior meetings. Members voted to appoint Rashe Malcolm as Chair, Taylor Pass as Vice Chair, and Fred Smith as Secretary. The committee also set its meeting schedule for the remainder of 2025. The meeting was then adjourned.

Mon Jul 14, 2025

Athens Cultural Affairs Commission

✓ Decided: Commission unanimously approved March minutes

The Athens Cultural Affairs Commission voted to approve the March meeting minutes, with all members in favor. The meeting was then adjourned by a unanimous vote.

Thu Jul 3, 2025

Planning Commission

✓ Decided: Planning Commission approved rezoning of 180 & 190 Pinecrest Drive to RM‑2

The commission voted 6‑1 to recommend approval of the rezoning from RM‑1 to RM‑2 for 180 & 190 Pinecrest Drive. It also approved the rezoning of 231 Collins Industrial Boulevard to industrial use with conditions (5‑2), the Planned Development amendment for 355 OneTA Street (unanimous), and the rezoning of 360 Hawthorne Extension to RM‑2 (unanimous). The minutes and staff reports were adopted unanimously. No vote was taken on the Old Elberton Road rezoning or the special‑use permit for 159 Marlin Street.

Tue Jun 24, 2025

TAD Advisory Committee - Mall Area

✓ Decided: Mall Area and Newton Bridge Road TAD committees elected new chairs and vice chairs

Both TAD advisory committees unanimously approved their leadership appointments. Susan Bogardus was named Chair and Caitlin May Vice Chair of the Mall Area committee, while Daniel Epting became Chair and Mike Leggett Vice Chair of the Newton Bridge Road committee. Both committees also agreed to defer Secretary duties to staff member Daniel Young.

Tue Jun 24, 2025

Athens in Motion Commission

✓ Decided: Commission unanimously approved agenda and minutes, then adjourned

The Athens in Motion Commission approved the meeting agenda, the March minutes and the May minutes, each by unanimous vote. A motion to adjourn was moved, seconded, and approved, ending the meeting at 5:40 pm. No other actions were taken.

Tue Jun 24, 2025

TAD Advisory Committee - Newton Bridge Area

✓ Decided: Both TAD committees unanimously elected new chairs and vice chairs

The Mall Area TAD Committee elected Susan Bogardus as chair and Caitlin May as vice chair. The Newton Bridge Road TAD Committee elected Daniel Epting as chair and Mike Leggett as vice chair. Both committees also deferred secretary duties to staff and approved the meeting agenda and prior minutes unanimously.

Tue Jun 24, 2025

Airport Authority

✓ Decided: May 2025 meeting minutes approved unanimously

The Authority voted to approve the May 2025 meeting minutes with a unanimous vote. No other formal actions were taken during the session.

Wed Jun 18, 2025

Historic Preservation Commission

✓ Decided: Commission approved new townhome construction at 997 S. Milledge Ave with conditions

The commission approved the new construction of townhomes at 997 S. Milledge Ave with conditions, passing 4‑1. It unanimously adopted staff report introductions, agenda order changes, and several minutes. Officers were elected, naming Worth VanLinden as Chair and Bobbie Epting as Vice Chair. The conceptual design review for 480 S. Milledge Ave was allowed to proceed with comments only, passing 4‑0.

Tue Jun 17, 2025

Mayor & Commission Meetings

✓ Decided: Commission unanimously suspends rules to consider a new business item

Commissioners voted unanimously to suspend the Rules of Commission to consider one new business item. A motion was made to adopt Ordinance #25-06-68 to levy and assess taxes for the Clarke County School District for 2025, but the minutes do not record a vote outcome. The meeting was then adjourned by a unanimous vote at 7:03 p.m.

Tue Jun 17, 2025

Mayor & Commission Meetings

✓ Decided: Commission entered executive session and adjourned unanimously

The commission held a special session to discuss confidential personnel matters and real estate acquisition/disposal. Commissioners Link and Taylor moved to enter executive session and adjourn, and the motion passed unanimously. No other decisions were made.

Mon Jun 16, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee added five projects to final list and removed three low‑vote projects

The committee unanimously approved the June 9, 2025 minutes. It moved four projects with nine votes and one project with eight votes forward to the final recommended list. A motion to conduct Round Five voting live failed in a 5‑5 vote. A later motion to remove projects with two votes and Project 26 passed 8‑2, eliminating three projects from consideration.

Thu Jun 12, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved entering executive session unanimously

The commission voted to enter an executive session to discuss confidential personnel matters. Commissioner Fisher moved, and Commissioner Taylor seconded the motion. The motion passed by a unanimous vote. The meeting adjourned shortly after.

Tue Jun 10, 2025

Arena District Steering Committee

✓ Decided: Arena District Steering Committee unanimously approves revised RFQ

The committee unanimously approved the meeting agenda and the prior meeting minutes. It then approved the revised Request for Qualifications (RFQ) with all amendments, including removal of language allowing the facilitator to serve as master developer. The members also unanimously agreed that the full committee will review and score RFQ submissions and voted to strike two job‑description bullet points and a sentence about serving as master developer. The meeting was adjourned by unanimous vote.

Tue Jun 10, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved rezoning of 120.5 acres on Newton Bridge Road

The Athens‑Clarke County Commission adopted an ordinance changing the future land‑use designation of about 120.5 acres at 610‑760 Newton Bridge Road from “Employment Center & Rural” to “Mixed‑Density Residential.” The commission also approved the appointment of Judd T. Drake as the authorized representative for the Classic Center Arena Series 2021‑2023 bonds, accepted the resignation of Clerk Gloria Jean Spratlin, and confirmed Stephanie Thompson as Municipal Court Judge and Administrative Hearing Officer.

Mon Jun 9, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee added seven projects to final list and approved remote voting

The TSAC approved the revised minutes from the June 9 meeting unanimously. It moved three projects with 12‑11‑10 votes, two projects with nine votes, and two projects with eight votes onto the final recommended Potential Projects list. The committee also approved completing the next voting round with the current list and agreed to adjourn and vote from home the following week.

Thu Jun 5, 2025

Audit Committee

✓ Decided: Commission unanimously approved FY26 audit workplan

The committee approved the minutes from the April 3, 2025 meeting unanimously. A motion was made to approve the Transit Department periodic audit and place it on the August Mayor & Commission agenda, though the vote outcome was not recorded. The committee noted that the City Commission had previously approved the FY26 audit workplan, which includes an investigative audit of organizational structure and a follow‑up audit of the Public Utilities Water Business Office. The meeting was adjourned unanimously.

Thu Jun 5, 2025

Planning Commission

✓ Decided: Commission recommends approving Rockwood Blvd rezoning with conditions (5-1)

The Planning Commission voted 5-1 to recommend approval of the Rockwood Boulevard rezoning request with specific development conditions. A text amendment to the demolition review procedures was also recommended for approval unanimously. The commission unanimously approved the meeting minutes and the introductory staff reports.

Thu Jun 5, 2025

Mayor & Commission Meetings

✓ Decided: Commissioners moved to adjourn the special session

The special called session held a public hearing #2 on the FY26 budget as required by the Taxpayer Bill of Rights. Four members of the public gave comments supporting various budget items. Commissioners Link and Taylor moved to adjourn the session; the minutes do not record a vote or adoption. The session ended at 6:17 p.m.

Wed Jun 4, 2025

Arena District Steering Committee

✓ Decided: Committee unanimously accepted FY26 Pro Forma and set reporting requirements

The steering committee approved its agenda and the draft minutes from April 30, 2025 without dissent. Commissioners Wright and Culpepper moved to accept the FY26 pro forma and require future pro formas to include current and prior fiscal year actuals each quarter, which passed unanimously. The committee also approved a subcommittee of three members to represent the full committee in scoring development‑facilitator proposals, and then adjourned the meeting unanimously.

Tue Jun 3, 2025

TAD Advisory Committee- West Broad/Hawthorne Area

✓ Decided: Committee approved the meeting agenda unanimously

The advisory committee unanimously approved the meeting agenda. The May 7, 2025 minutes were approved with a modification to section 6.E., receiving four votes in favor and one abstention. The next meeting was scheduled for September 2, 2025, and the meeting was adjourned unanimously.

Tue Jun 3, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved $134M water and sewer bond issuance

The commission suspended rules for all new‑business items and reordered the agenda to address appointments and the water/sewer bond. It adopted a supplemental bond ordinance authorizing $134,060,000 in water and sewer revenue refunding bonds and authorized the mayor and staff to execute the necessary documents. The commission also approved nominations for County Attorney, Internal Auditor, Personnel Hearing Officer, and acting charter officers.

Tue Jun 3, 2025

Mayor & Commission Meetings

✓ Decided: Historic Preservation appeal upheld, commission modifies determination

The commission voted 5‑3 to find the Historic Preservation Commission did not abuse its discretion and to approve and modify its determination for 120 West Cloverhurst Avenue. Commissioners Hamby, Wright, Fisher, Culpepper, and Thornton voted YES; Link, Taylor, and Myers voted NO. A separate motion to adjourn was approved unanimously. The meeting adjourned at 5:46 p.m.

Tue Jun 3, 2025

Mayor & Commission Meetings

✓ Decided: Commission entered and adjourned executive session unanimously

The commission held a special session to discuss real estate matters. A motion to enter executive session was made and passed unanimously. A motion to adjourn the executive session was then made and also passed unanimously. No other substantive actions were taken.

Mon Jun 2, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee advanced Projects #23, #46, and #67 to the final recommended list.

The TSLOST Advisory Committee approved the May 19, 2025 minutes unanimously. It removed projects that received low vote totals and advanced three high‑vote projects to the final recommended list. The committee also approved voting from home for the next week.

Wed May 28, 2025

Human Relations Commission

✓ Decided: Commission approved outreach apparel purchases and shifted chair update

The Human Relations Commission accepted the minutes from the previous meeting. It voted to move the chairperson’s update to after old business. The commission approved purchasing outreach banners, t‑shirts and polos for future events. No other substantive actions were decided.

Wed May 28, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

✓ Decided: JDA unanimously approved the ARPA Small Business Grant Program with added COVID‑19 language

The Joint Development Authority approved its draft agenda and the minutes from the May 7 regular meeting, both unanimously. It also approved the ARPA Small Business Grant Program, adding a requirement that applicants attest to COVID‑19 impact, and directed the program to the city manager for review. The Authority authorized staff to send a letter to the city manager about a funding delay and then adjourned the meeting.

Tue May 27, 2025

Athens in Motion Commission

✓ Decided: Commission unanimously approved the meeting agenda

The agenda for the May 27, 2025 Athens in Motion Commission meeting was approved unanimously after a motion and second. No public comments were received. The meeting was then adjourned following a motion to adjourn. No other substantive actions or votes were recorded.

Tue May 27, 2025

Airport Authority

✓ Decided: Airport Authority approves April minutes and appoints new members

The Authority unanimously approved the April meeting minutes. New members William Felt and Elizabeth Higgins were appointed to begin service on July 1, 2025, and Sonny Wilson was confirmed to fill the remainder of Jeff Benjamin's term. The meeting was adjourned by a unanimous motion.

Thu May 22, 2025

Mayor & Commission Meetings

✓ Decided: No decisions made; meeting discussed FY26 budget

The commission met to discuss the FY26 mayoral budget proposal and gave closing remarks. No votes were taken and no actions were approved, denied, or tabled.

Wed May 21, 2025

Historic Preservation Commission

✓ Decided: Historic Preservation Commission approves five property modifications, all unanimously

The Athens-Clarke County Historic Preservation Commission approved five Certificate of Appropriateness requests, each with conditions, and each vote was 5-0. The approved projects were at 1130 Boulevard, 1233 Boulevard, 317 Franklin Street, 232 Satula Avenue, and 360 North Church Street. All procedural motions, including adoption of minutes and staff reports, also passed unanimously.

Wed May 21, 2025

Pension Board

✓ Decided: Board adds Pomona Capital XI private‑equity fund to pension portfolio

The board unanimously approved adding Pomona Capital XI as a private‑equity allocation to the pension fund’s investment portfolio. It also approved the FY26 meeting calendar and the FY26 work plan, which includes an amendment to schedule the annual election of the vice chair on August 6, 2025. Earlier items such as the prior meeting minutes and the addition of the private‑equity fund were approved unanimously. The meeting was adjourned at 10:49 a.m.

Tue May 20, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved motion to adjourn; no decisions were made

The meeting concluded with a motion to adjourn that was approved by the commission. No votes were taken on any agenda items, and no substantive decisions, approvals, or denials were recorded.

Tue May 20, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved entering executive session and adjourned unanimously

The commission entered executive session to discuss confidential personnel matters. A motion to enter executive session and adjourn was made, seconded, and passed by a unanimous vote. The meeting adjourned at 5:40 p.m.

Tue May 20, 2025

Mayor & Commission Meetings

✓ Decided: Commission voted unanimously to adjourn the special session

The commission held a public hearing on the proposed FY26 budget but took no budget actions. Commissioner Wright moved to adjourn, Thornton seconded, and the motion passed unanimously. The meeting adjourned at 7:24 p.m.

Mon May 19, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee advances Milledge Makeover project and removes low‑vote projects

The committee unanimously approved the May 5, 2025 meeting minutes. It voted 8‑1 to remove projects that received only 0 or 1 votes. A motion to remove projects with 2 votes failed 4‑5. The Milledge Makeover project (project 34) was moved forward to the final recommended list unanimously. A motion to advance all 9‑vote projects except project 19 was rejected 4‑6.

Mon May 19, 2025

TAD Advisory Committee - Newton Bridge Area

✓ Decided: Committee unanimously approved agenda, minutes and adjourned

The Newton Bridge Road TAD Advisory Committee unanimously approved the meeting agenda and the minutes from the January 13, 2025 meeting. No substantive policy or funding decisions were made. The committee then adjourned unanimously.

Wed May 14, 2025

Hearings Board

✓ Decided: Board approves 170 International Drive lot‑increase variance, tables 359 Hancock signs

The Hearings Board approved variances for 475 First Street, 170 International Drive, 1125 Newton Bridge Road, and 6425 Jefferson Road. It denied the sign variance at 359 West Hancock Avenue and voted to table both sign variances there until the July meeting. All other items were procedural.

Tue May 13, 2025

Mayor & Commission Meetings

✓ Decided: No decisions made at the May 13 budget meeting

The commission met on May 13, 2025 to discuss budget requests from elected officials and the FY26 mayor’s proposed budget. No votes were taken and no actions were approved, denied, or tabled.

Tue May 13, 2025

Mayor & Commission Meetings

✓ Decided: Commission entered executive session and adjourned by unanimous vote

The commission voted unanimously to enter executive session to discuss confidential personnel matters. They then voted unanimously to adjourn the meeting.

Tue May 13, 2025

Mayor & Commission Meetings

✓ Decided: Commission work session held; no decisions were made

The May 13, 2025 work session of the Athens-Clarke County Mayor and Commission discussed several items for future consideration, including the County Data Alliance, Prince Avenue Jefferson Road Corridor, TSPLOST Project 14, Leisure Services Master Plan, youth and community enrichment facility partnerships, the Center for Racial Justice & Black Futures, and North Avenue next steps. No actions were approved, denied, or tabled, and no votes were recorded. The meeting adjourned at 2:52 p.m.

Thu May 8, 2025

Mayor & Commission Meetings

✓ Decided: Commission discussed budget items, but made no decisions

The May 8, 2025 meeting of the Athens-Clarke County Mayor and Commission was held at the Planning Auditorium. Commissioners reviewed the remaining budget public and TBOR hearing calendar and allowed time for questions and comments. No votes were taken and no actions were approved, denied, or tabled.

Thu May 8, 2025

TAD Advisory Committee - East Downtown Area

✓ Decided: No official decisions made; quorum absent

The East Downtown TAD Advisory Committee meeting on May 8, 2025 did not have a quorum, so no official business was conducted. The Finance Department reported a projected TAD fund balance of $865,129.39 as of 12/31/24, with $605,590.57 designated for the east side of the North Oconee River and $259,538.82 for the west side. Guest speakers provided updates on public utilities, transportation projects, and historic preservation, but no actions were approved or denied.

Wed May 7, 2025

TAD Advisory Committee- West Broad/Hawthorne Area

✓ Decided: Committee approved community priority list for TAD fund allocation

The West Broad/Hawthorne Area TAD Advisory Committee unanimously approved its agenda and the minutes from the March 4, 2025 meeting. New member Heidi Davison was welcomed. The committee also unanimously adopted the Community‑Identified Priority List, allocating 50% to public infrastructure, 25% to economic development, 15% to housing, and 10% to youth development. No other substantive actions were taken.

Wed May 7, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

✓ Decided: Board approved next year’s officer slate, naming Chico Rozier as treasurer

The board approved the March meeting minutes and the Treasurer’s financial report. A $150 request for popsicles for a litter‑pickup event was approved. The “Tired of Trash Tracker” recycling event was approved. The board also approved the upcoming officers, appointing LaDarius Thomas as Chair, Ezra Schley as Vice‑Chair, Catie Floyd as Secretary, and Chico Rozier as Treasurer.

Wed May 7, 2025

Joint Development Authority of the Athens-Clarke County Unified Government & the City of Winterville

✓ Decided: Board tables ARPA grant program discussion and schedules special meeting

The directors unanimously approved the agenda and the minutes from the February 5, 2025 meeting. New director Amanda Mooney and new counsel Emily Escoe were introduced. The discussion of the ARPA Workforce Development Small Business Grant Program was tabled and a special meeting was set for May 28, 2025 to finalize it. The board also moved to close the meeting for an executive‑session property‑acquisition discussion and then adjourned.

Tue May 6, 2025

TAD Advisory Committee - Lexington Road

✓ Decided: Committee approves 100% of TAD funds for public infrastructure

The advisory committee voted to allocate all TAD funds to public infrastructure improvements (4‑0‑1 abstain). It also unanimously opposed consolidating the TAD advisory committees. The agenda, minutes, and adjournment were approved unanimously.

Tue May 6, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved multiple funding ordinances, including a $1.987 M airport taxiway project

The commission unanimously consented to twelve items covering transit, greenway, police, and housing initiatives. It adopted ordinances to add $153,310 from Georgia Power for an Oconee Rivers underpass, up to $400,000 FHWA grant for a greenway trail, and a $1.654 M GDOT grant for airport taxiway rehabilitation, among other actions. It also approved several grant applications and plans, including the FY26 CDBG and HOME action plans and a HUD EDI grant request of up to $721,000. All actions were authorized for the mayor and staff to execute.

Mon May 5, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee unanimously approved April 21 minutes

The TSAC approved the minutes from the April 21, 2025 meeting with a unanimous vote. No other actions or votes were taken at this meeting. The committee will conduct its first official round of voting within the next two weeks and will discuss the results at the May 19 meeting.

Thu May 1, 2025

Planning Commission

✓ Decided: Planning Commission approves rezoning of Newton Bridge Road and several special uses

The commission approved the rezoning of parcels on Newton Bridge Road to Mixed Density Residential with conditions, passing both the future land use and zoning motions unanimously. It also approved special‑use permits for 581 S. Harris Street (5‑1), 284 Bailey Street (unanimously) and 1580 Barnett Shoals Road (unanimously). The commission adopted a recommendation to improve short‑term‑rental enforcement, passing 4‑3. All other items were noted as comment‑only.

Thu May 1, 2025

Mayor & Commission Meetings

✓ Decided: Committee approved March minutes and postponed downtown noise discussion

The Legislative Review Committee unanimously approved the March 6, 2025 minutes and then adjourned the meeting. Members agreed to defer further discussion of downtown noise concerns to a future meeting. Staff were asked to return with possible revisions to the special‑event permit and to consider noise impacts in agricultural zones. The next meeting is set for June 5, 2025.

Thu May 1, 2025

Mayor & Commission Meetings

✓ Decided: Commission voted unanimously to enter executive session

The commission unanimously approved entering executive session to discuss confidential personnel matters. Afterward, they unanimously approved adjourning the meeting. No other actions were taken.

Wed Apr 30, 2025

Arena District Steering Committee

✓ Decided: Committee approves revised Development Facilitator job description with added qualifications

The steering committee amended the agenda to add Item D for pro forma clarification and approved the April 4, 2025 meeting minutes, both unanimously. It approved the revised Development Facilitator job description with naming and qualification amendments. The committee adopted the August 2024 detailed pro forma format for future quarterly updates and set the next meeting for June 4, 2025 at 10 a.m. The meeting was then adjourned unanimously.

Thu Apr 24, 2025

Airport Authority

✓ Decided: Authority members unanimously confirmed Mr. Sanders as Vice Chair

The board unanimously approved the March meeting minutes. Members voted unanimously to confirm Mr. Sanders as Vice Chair through the end of the year. The board approved the list of options for distributing the airport Fact Sheet and chose an inexpensive two‑sided version for large‑scale distribution. The meeting was adjourned by unanimous vote.

Mon Apr 21, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee unanimously approved the April 14, 2025 meeting minutes

The TSPLOST Advisory Committee voted to approve the minutes from the April 14, 2025 meeting. The motion was made by Stephen Wright, seconded by Carl Blount, and passed unanimously. No other TSAC actions or votes were taken at this meeting.

Wed Apr 16, 2025

Historic Preservation Commission

✓ Decided: Commission approved five historic‑preservation projects, all by unanimous vote

The Athens‑Clarke County Historic Preservation Commission approved five project applications, each passing with a 4‑0 vote. Approvals included demolition and new construction at 541 Nantahala Ave, modifications at 317 S. Milledge Ave and 180 Woodlawn Ave, a side‑porch enclosure at 147 Hall St, and rear‑wall and front‑entry changes at 290 W. Clayton St. No other substantive actions were taken.

Wed Apr 16, 2025

Human Relations Commission

✓ Decided: Committee approved moving forward with the Menstrual & Diaper Project

The Human Relations Commission accepted the minutes from the previous meeting. It voted to move forward with the Menstrual & Diaper Project proposal. It also voted to amend the agenda to review the commission bylaws. No other substantive decisions were recorded.

Tue Apr 15, 2025

Mayor & Commission Meetings

✓ Decided: Mayor extends Acting Manager contract through June 3, 2025

The Commission unanimously suspended its rules to consider a new business item. It then unanimously approved Mayor Girtz's recommendation to extend Acting Manager Bradley A. Griffin's contract through June 3, 2025 and to execute the first amendment to his employment agreement. Mayor Girtz announced new members for several Tax Allocation District committees. The meeting was adjourned unanimously.

Tue Apr 15, 2025

Mayor & Commission Meetings

✓ Decided: Commission adjourned; no votes taken on agenda items

The Mayor and Commission meeting was adjourned at 8:51 p.m. after a motion by Commissioner Fisher was seconded by Commissioner Link and approved. No votes were taken on any of the agenda items discussed.

Tue Apr 15, 2025

Mayor & Commission Meetings

✓ Decided: Commission voted unanimously to enter executive session and adjourn

Commissioners Davenport and Wright moved, and the commission unanimously approved, a motion to enter executive session to discuss real estate matters and then adjourn the meeting. No other actions were taken.

Mon Apr 14, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee unanimously approved April 7 meeting minutes

The advisory committee voted to approve the minutes from the April 7, 2025 meeting. The motion was made by Carey Rivers, seconded by Bryan Gomez, and passed unanimously. No other actions or votes were taken on the presented projects.

Tue Apr 8, 2025

Mayor & Commission Meetings

✓ Decided: Commission unanimously approved eminent‑domain acquisition for SR 10 @ CR 993/W. Hancock Ave project

The Commission adopted a resolution that authorizes condemnation of the required right‑of‑way and easements for the SR 10 @ CR 993/W. Hancock Ave intersection improvements. The resolution also empowers the Mayor, Manager, County Attorney and Special Counsel to prepare and sign all necessary acquisition documents. The motion to adopt the resolution and the motion to adjourn both passed unanimously.

Tue Apr 8, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved motion to adjourn the meeting

The Mayor & Commission Work Session met on April 8, 2025 at 120 W. Dougherty Street. Commissioners discussed five agenda items but no votes were taken on them. A motion to adjourn, moved by Commissioner Thornton and seconded by Commissioner Davenport, was approved.

Mon Apr 7, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee unanimously approved March 31, 2025 minutes

The TSPLOST Advisory Committee approved the minutes from the March 31, 2025 meeting with a unanimous vote. No other actions or votes were taken at this session. The next committee meeting is scheduled for April 14, 2025 at 5:30 p.m.

Fri Apr 4, 2025

Arena District Steering Committee

✓ Decided: Committee approved quarterly updates and set April 30 meeting

The steering committee unanimously approved a motion for quarterly updates on performance relative to the pro forma. They scheduled the next meeting for April 30, 2025 at 10 a.m. The meeting was then adjourned by unanimous vote.

Thu Apr 3, 2025

Audit Committee

✓ Decided: Audit Committee unanimously approves FY26 Option A audit workplan

The committee approved the March 6 meeting minutes. It voted to adopt the FY26 Option A audit workplan for Fire, Emergency Management and Capital Projects. Members also cancelled the May and July meetings and set the next meeting for June 6, 2025.

Thu Apr 3, 2025

Planning Commission

✓ Decided: Planning Commission approved rezoning of 1075 Gaines School Road with a condition

The commission voted unanimously to approve the rezoning of 1075 Gaines School Road from C‑O (PD) to C‑N, adding a condition that no drive‑through uses are permitted. Several other items were decided: the short‑term rental text amendment was tabled 6‑1; 110 W. Hancock Avenue special‑use request was denied unanimously; the 4500 & 4530 Atlanta Highway master‑planned development amendment was denied unanimously; and three additional rezoning and special‑use requests were approved unanimously.

Wed Apr 2, 2025

Keep Athens-Clarke County Beautiful (KACCB) Board

✓ Decided: Board approved the Treasurer’s $5,407.46 report with a unanimous vote

The board unanimously approved the March meeting minutes. It also approved the Treasurer’s report showing $5,407.46 in income and $1,245.20 in expenses. The Executive Director’s report was approved without opposition, and the meeting was adjourned by unanimous consent.

Tue Apr 1, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved $1.37 M funding for an aircraft rescue and fire‑fighting vehicle

The commission adopted a resolution keeping the current Clarke County Board of Elections composition (8‑YES, 2‑NO) and approved several ordinances, including a special‑events fee amendment and funding for an aircraft rescue and fire‑fighting vehicle totaling $1,374,945 (8‑YES, 2‑NO). It also approved $326,150 for the Newton Bridge Tax Allocation District and adopted resolutions recognizing Athens Pride Month and Juneteenth.

Tue Apr 1, 2025

Mayor & Commission Meetings

✓ Decided: Commission approved $1.37M grant‑funded aircraft rescue fire‑fighting vehicle

The Commission adopted a resolution keeping the current composition of the Clarke County Board of Elections (8‑YES, 2‑NO). It also approved several ordinances, including changes to the special‑events code, funding for an aircraft rescue and fire‑fighting vehicle using $1.374 M in FAA and GDOT grants, $326,150 for Newton Bridge Road improvements, and resolutions recognizing Pride Month and Juneteenth. All actions were approved by an 8‑2 vote, except the special‑events ordinance which was part of the same consent motion.

Mon Mar 31, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee approved prior meeting minutes, no new actions taken

The committee unanimously approved the minutes from the March 24, 2025 meeting. No TSAC actions or votes were taken on any of the presented projects.

Tue Mar 25, 2025

Athens in Motion Commission

✓ Decided: Commission unanimously approved the agenda and minutes, then adjourned

The Athens in Motion Commission approved the meeting agenda and the prior meeting minutes without opposition. Commissioners decided to keep the April 22 meeting on the calendar. A motion to adjourn the meeting was moved, seconded, and carried.

Tue Mar 25, 2025

Mayor & Commission Meetings

✓ Decided: Commission reviewed FY26 budget recommendation, no decisions taken

The commission met on March 25, 2025, to review the Acting Manager’s FY26 General Fund Capital budget recommendation. No votes were taken and no actions were approved, denied, or postponed. The meeting adjourned at 4:42 p.m.

Tue Mar 25, 2025

Mayor & Commission Meetings

✓ Decided: Commission appointed Jim Davis as interim municipal court judge

The Commission adopted a resolution keeping Judge Marcy Jolles' resignation effective March 28, 2025 and directing HR to post the vacancy and seek interim attorneys. Mayor Kelly Girtz nominated Jim Davis as interim Municipal Court Judge and Interim Administrative Hearing Officer, and the Commission approved the nomination. All related motions passed unanimously or with seven affirmative votes. The meeting adjourned at 3:38 p.m.

Tue Mar 25, 2025

Airport Authority

✓ Decided: Dr. Napier elected Authority Chair and Mr. Alexander appointed Operating Committee Chair

The board approved the January minutes with one abstention and approved the February minutes unanimously. Members elected Dr. Napier as the Authority Chair and appointed Mr. Alexander as chair of the Operating Committee, both by unanimous vote. The Vice Chair position was not decided and will be addressed at the April meeting.

Mon Mar 24, 2025

TSPLOST 2026 Advisory Committee

✓ Decided: Committee approved prior minutes; no project actions taken

The committee unanimously approved the minutes from the March 17, 2025 meeting. No votes or actions were taken on any of the presented projects. The next meeting is scheduled for March 31, 2025.

Wed Mar 19, 2025

Historic Preservation Commission

✓ Decided: Rear addition modification at 120 W. Cloverhurst Ave denied

The Historic Preservation Commission denied the request to modify a rear addition at 120 W. Cloverhurst Ave (vote 4‑0). It approved a mechanical screening at 183 W. Clayton St with no conditions (vote 3‑1) and approved window replacement at 369 N. Finley St with specific conditions (vote 4‑0). Earlier agenda items, including staff reports and minutes, were adopted unanimously.

Wed Mar 19, 2025

Human Relations Commission

✓ Decided: Human Relations Commission approved engagement banner and added disability duties

The commission accepted the prior meeting minutes and received updates from the People & Belonging Department. It defined three subcommittees—Community Outreach & Engagement, Policy Review, and Housing & Economic Justice. The commission voted to approve a new engagement banner on its website and to integrate the duties of the Commission on People with Disabilities into its workplan. The board also discussed a collaborative housing‑inequity tour with county commissioners and community stakeholders.