The Boring PartsFederalLocal · USLocal · Canada
Columbia, MO

Columbia public meetings in 2025

472 substantive meetings from 2025, with official agendas or minutes and plain-English summaries.

Thu Dec 18, 2025 · 5:30 PM

Planning and Zoning Commission

Planning and Zoning Commission to discuss small lot integration text amendments

The Planning and Zoning Commission will hold a work session to review staff reports on Small Lot Integration Text Amendments and related regulatory observations. The meeting will also include the approval of minutes from previous sessions and updates from community development and legal counsel.

planningzoningsmall-lottext-amendmentswork-sessioncolumbia-mo
Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-32050 — Approved a Motion
8 yea · 1 abstain
Anthony Stanton abstain · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-32051 — Approved a Motion
8 yea · 1 abstain
Anthony Stanton abstain · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Wed Dec 17, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to discuss pedestrian safety ordinance and state active transportation plan

The Bicycle and Pedestrian Commission will discuss the Missouri Active Transportation Plan draft executive summary and consider a letter of support. Old business includes updates on the Improve I-70 Phase 4 MoDOT meeting and a proposed pedestrian safety ordinance. Staff reports cover Vision Zero, Parks & Recreation, and planning updates.

bicyclespedestrianstransportationsafetyplanningvision-zeroi-70active-transportation
Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Dec 17, 2025 · 4:00 PM

Building Construction Codes Commission

Columbia building codes commission to hold public forum on proposed changes

The Building Construction Codes Commission will convene at City Hall to discuss proposed code changes. The meeting includes an open forum where code professionals will answer questions from the public. No formal decisions are scheduled.

building-codespublic-hearingcolumbiacity-hallcode-changes
Columbia City Hall Council Chambers 701 E Broadway
Wed Dec 17, 2025 · 4:15 PM

Food Council

Columbia Food Council to review OFBC findings and work plan

The Food Council will meet to discuss the OFBC findings overview and the associated schedule and work plan. The body will also review current events and relevant food policy updates.

food-policypublic-healthcolumbia-mo
Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed Dec 17, 2025 · 8:00 AM

Railroad Advisory Board

Railroad Advisory Board to review financial and traffic reports

The Railroad Advisory Board will meet to approve meeting minutes and financial statements, review traffic reports for the Columbia Terminal, and consider a request for expressions of interest. The meeting will also include a report on safety achievement awards.

railroadtrafficfinancesafetycolumbia-terminal
701 E Broadway Columbia, MO Conference Room 4A
Wed Dec 17, 2025 · 12:00 PM

Substance Use Prevention Advisory Commission

Commission to discuss opioid settlement funds and World Cup liquor statute

The Substance Use Prevention Advisory Commission will discuss the allocation of opioid settlement funds and a state statute allowing liquor sales during the 2026 FIFA World Cup. Reports from the University of Missouri and Columbia Public Schools are also scheduled. The meeting includes public comment and next meeting set for February 11, 2026.

substance-use-preventionopioid-settlementworld-cupliquor-regulationschoolsuniversitypublic-health
Columbia/Boone County Public Health & Human Services Training Room 1 1005 W. Worley St Columbia, MO.
Wed Dec 17, 2025 · 5:00 PM

Tree Board

Tree Board to discuss council letter and outreach

The Columbia Tree Board will meet to discuss a letter to the City Council, review an annual report from the Missouri Conservation Corps, and plan outreach and educational opportunities.

tree-boardcolumbiaoutreacheducationarboristpublic-comment
City Hall Conference Room 1B 701 E. Broadway Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 1 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
6 yea · 1 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Tue Dec 16, 2025 · 1:00 PM

Water and Light Advisory Board

Board will discuss financial targets and rate plans for water and light services

The Water and Light Advisory Board will review its core financial requirements and determine the revenue needed to meet those needs. Members will set key financial targets related to the cost of service and discuss long‑term rate plans for water and light customers. The meeting includes a Q&A and evaluation session.

financeutilitiesratesbudgetingwater-light
701 E Broadway Columbia, MO Conference Room 1A/1B
Tue Dec 16, 2025 · 6:00 PM

Climate and Environment Commission

Climate commission to get update on Climate Action & Adaptation Plan

The Climate and Environment Commission will discuss an update on the Climate Action and Adaptation Plan and review its 2025 priorities. The commission will also consider a memo to the City Council regarding the Bird City application. Public comments are accepted.

climateenvironmentclimate-action-planadaptationbird-cityprioritiespublic-comment
City Hall Conference Room 1B 701 E. Broadway Columbia, MO
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
TMP-31987 — Approved a Motion
11 yea · 3 present · 1 absent
Leanne Tippett Mosby yea · Abra Spisso yea · Emily Gustafson present · Richard Shanker yea · Eric Kvam present · Andrew Sell yea · Kira Smith present · Abby Dickinson yea · Nathan Elwood yea · Cherylyn Kelley yea · Morgan Wozniak absent · Eileen Avery yea · Alec Brown yea · Shelby Darland yea · James Loveless yea
TMP-31988 — Approved a Motion
11 yea · 3 present · 1 absent
Leanne Tippett Mosby yea · Abra Spisso yea · Emily Gustafson present · Richard Shanker yea · Eric Kvam present · Andrew Sell yea · Kira Smith present · Abby Dickinson yea · Nathan Elwood yea · Cherylyn Kelley yea · Morgan Wozniak absent · Eileen Avery yea · Alec Brown yea · Shelby Darland yea · James Loveless yea
TMP-31991 — Approved a Motion
10 yea · 3 present · 1 abstain · 1 absent
Leanne Tippett Mosby yea · Abra Spisso yea · Emily Gustafson present · Richard Shanker abstain · Eric Kvam present · Andrew Sell yea · Kira Smith present · Abby Dickinson yea · Nathan Elwood yea · Cherylyn Kelley yea · Morgan Wozniak absent · Eileen Avery yea · Alec Brown yea · Shelby Darland yea · James Loveless yea
APPROVAL OF AGENDA — Approved a Motion
11 yea · 3 present · 1 absent
Leanne Tippett Mosby yea · Abra Spisso yea · Emily Gustafson present · Richard Shanker yea · Eric Kvam present · Andrew Sell yea · Kira Smith present · Abby Dickinson yea · Nathan Elwood yea · Cherylyn Kelley yea · Morgan Wozniak absent · Eileen Avery yea · Alec Brown yea · Shelby Darland yea · James Loveless yea
Tue Dec 16, 2025 · 5:30 PM

Public Transit Advisory Commission

Commission to discuss pedestrian safety ordinance letter and Tiger Line

The Public Transit Advisory Commission will consider a draft letter regarding the Pedestrian Safety Ordinance (B265-25) and discuss the Tiger Line route. They will also review an annual report and November ridership data. The meeting includes updates from City Council and other commissions.

public-transitpedestrian-safetyordinancetiger-lineridershipannual-reportcolumbia-mo
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Dec 15, 2025 · 10:00 AM

Office of Violence Prevention Advisory Committee

Office of Violence Prevention Advisory Committee meets December 15

The committee will discuss community forum activation and various partnerships. Reports include a recap of the Mayor's Task Force on Community Violence and a gun violence landscape analysis.

public-safetycommunity-partnershipsviolence-preventioncolumbia
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO 65205
Mon Dec 15, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Columbia committee to discuss budget, pension, and financial reports

The Finance Advisory and Audit Committee will review the status of the city's budget categories, public safety pension discussions, and investment accounts. The meeting also includes the release of the Annual Comprehensive Financial Report and a status update on the Humane Society Building Project.

financebudgetauditpensioninvestmenthumane-societyreport
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Dec 15, 2025 · 5:00 PM

City Council

Council to discuss Board of Health edits to Chapter 5

The City Council will discuss proposed edits to Chapter 5 recommended by the Board of Health. No formal votes are scheduled; this is a discussion item only.

city-councilboard-of-healthchapter-5code-amendmentshealth
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Dec 15, 2025 · 7:00 PM

City Council

Council to vote on rezoning Green Valley and Moon Valley for multifamily

The City Council will hold final votes on a rezoning for multifamily housing at Green Valley Drive and Moon Valley Road, multiple short-term rental permits, an annexation agreement, and a $5.8 million first-quarter budget appropriation. They will also consider a $99,840 contract for community navigation services and hear public comments on disaster assistance and a recreation area. Several consent agenda items cover airport grants, arts funding, social services, and utility agreements.

zoninghousingbudgetshort-term-rentalsannexationcommunity-developmentpublic-safety
City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B308-25 — Passed
4 nay · 3 yea
Barbara Buffaloe yea · Nick Foster nay · Don Waterman yea · Betsy Peters nay · Valerie Carroll nay · Jacquelyn Sample nay · Vera Elwood yea
The other 26 items passed by unanimous or near-unanimous consent.
Fri Dec 12, 2025 · 4:30 PM

City Council

City Council to discuss 2026 legislative priorities

The City Council will meet to discuss and potentially adopt the 2026 Legislative Priorities. The meeting is scheduled for 4:30 PM on Friday, December 12, 2025, at City Hall.

city-councillegislativeagendapublic-meeting
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Fri Dec 12, 2025 · 9:30 AM

Police Retirement Board

Police Retirement Board meeting scheduled for December 12, 2025

The Police Retirement Board will meet to review previous meeting minutes and financial reports. The agenda includes the FY25 Year End Statement of Net Position and a Retire Register dated November 30, 2025.

policefinanceretirementgovernment-operations
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Fri Dec 12, 2025 · 8:00 AM

Firefighters' Retirement Board

Firefighters' Retirement Board to review financial reports

The Firefighters' Retirement Board will meet to approve minutes, review financial reports including a year-end statement and a DROP account status, and address old and new business.

firefightersretirementfinanceboardcolumbia-mo
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Fri Dec 12, 2025 · 8:30 AM

Investment Committee

Investment Committee will discuss quarterly economic and investment report

The Investment Committee will review the Quarterly Economic and Investment Report and discuss private equity investing. Presentations on KKR and the UBS Police & Fire Pension will also be considered. The committee will approve the agenda and the September 12, 2025 draft minutes. No other decisions are listed on the agenda.

investmenteconomic-reportprivate-equitypensioncity-government
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Thu Dec 11, 2025 · 3:00 PM

Disabilities Commission

Commission to hear update on proposed pedestrian safety ordinance

The Disabilities Commission will receive presentations from CoMo to Zero (Vision Zero) consultants and from a graphic artist on the DawnZ Award. Old business includes an update on the proposed pedestrian safety ordinance. New business involves a training with the Missouri Commission on Human Rights and planning the 2026 speaker schedule.

disabilitiespedestrian-safetyvision-zerotransportationhuman-rightsawardscity-planning
City Hall Council Chambers 701 East Broadway Columbia, Missouri
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
12 yea · 2 present
Hazel Fields yea · Rene Powell present · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
TMP-32005 — Approved a Motion
12 yea · 2 present
Hazel Fields yea · Rene Powell present · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
ADJOURNMENT — Approved a Motion
12 yea · 2 present
Hazel Fields yea · Rene Powell present · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
Wed Dec 10, 2025 · 9:00 AM

City Council

Columbia council to discuss 2024 housing study with Boone County

The Columbia City Council and Boone County Commission will hold a joint work session to review the 2024 Housing Study Executive Summary and its recommendations. The meeting is scheduled for 9:00 AM on December 10, 2025, at the Boone County Government Center.

housingplanningcouncilcommissionmeeting
✓ Decided: Joint work session discussed housing study updates, no decisions made

The City Council and Boone County Commission held a joint work session to review the 2024 Housing Study and its 24 recommendations. Staff provided updates on topics such as the new permit tracking system, small‑lot standards, housing trust fund, linkage and inclusionary fees, code enforcement, home‑efficiency programs, and sustainability. The group discussed scheduling future joint sessions and potential quarterly meetings. No formal actions, approvals, or votes were recorded.

Boone County Government Center 801 E. Walnut Columbia, MO
Wed Dec 10, 2025 · 6:00 PM

Citizens Police Review Board

CPRB to discuss staff responsibilities and closed session

The Citizens Police Review Board will approve minutes from November 12, 2025, and discuss the transfer of responsibilities among its staff. The board will also receive a report from the Human Rights Commission and move into a closed session to discuss records protected by law.

cprbpoliceminutesstaffhuman-rightsclosed-session
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Dec 10, 2025 · 8:00 AM

Water and Light Advisory Board

Water and Light Advisory Board to review FY 2026 budgets and water ordinance

The Water and Light Advisory Board will review the Final FY 2026 Electric and Water O&M and CIP budgets, along with a review of the Water Irrigation Ordinance and the Annual Water Tier Report.

waterelectricbudgetcolumbiamisorenewable-energypublic-hearing
✓ Decided: Board unanimously approves FY 2026 goals, agenda and minutes

The Water and Light Advisory Board approved the meeting agenda and the November 12, 2025 minutes, each by unanimous vote. It then approved the drafted FY 2026 goals after making several wording changes, also unanimously. The meeting was adjourned by a unanimous motion. No other substantive actions were recorded.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Dec 10, 2025 · 3:00 PM

Parking Advisory Commission

Parking commission reviews garage updates and revenue

The Parking Advisory Commission will review updates on several city parking garages and discuss revenue. The meeting will also include general public comments.

parkingcity-hallcolumbia-mopublic-meetingtransportation
Room 1A/1B City Hall 701 E. Broadway Columbia MO 65201
Tue Dec 9, 2025 · 5:30 PM

Personnel Advisory Board

Personnel Advisory Board holds annual meeting to discuss labor negotiations and fiscal changes.

The Personnel Advisory Board will convene for its annual meeting at the Columbia Training Center to approve minutes and address labor negotiations and fiscal year changes. The next meeting is scheduled for October 29, 2026.

personnellaborbudgetmeetingcolumbia-training-center
Columbia Training Center 500 E. Walnut St. Ste. 108 Columbia, MO 65201
Tue Dec 9, 2025 · 7:00 PM

Board of Adjustment

Board to consider 5-foot rear setback variance for ADU at 602 Florence Ave

The Board of Adjustment will hold a public hearing on a variance request from Scott and Angela Claybrook to allow a 5-foot reduction from the required 25-foot rear setback in the R-2 zoning district, enabling an attached accessory dwelling unit (ADU) at 602 Florence Avenue. The board will also elect officers and adopt the 2026 application and meeting calendar.

board-of-adjustmentzoningvarianceaccessory-dwelling-unitsetbackspublic-hearingcolumbia-mo
Columbia City Hall Council Chambers 701 E Broadway
Tue Dec 9, 2025 · 6:00 PM

Youth Advisory Council

Youth Council to discuss violence prevention and planning for future events

The Youth Advisory Council will meet to approve minutes from November and hear a presentation from the Office of Violence Prevention. The group will also discuss planning for a Youth Summit and review a meeting with the CPS Superintendent.

youthcouncilviolence-preventionplanningpublic-meetingcolumbia-mo
✓ Decided: Youth Advisory Council approved creation of a social media subcommittee

The council approved its agenda and minutes for the meeting. A motion to create a social media subcommittee was made by Emily Crumbliss, seconded by Harvey Munter, and carried. Members interested in the subcommittee include Harvey, Eleanor, Ellie, Emily, Grace, and Mira, with the first meeting scheduled for January after the regular meeting.

701 E. Broadway Columbia, MO. 65201 Conference Room 1A/1B
Mon Dec 8, 2025 · 4:15 PM

Commission on Cultural Affairs

Cultural Affairs commission meets to discuss public art and funding

The Commission on Cultural Affairs will meet to approve minutes from November 2025 and review reports on the Columbia Arts Fund, the Artist Laureate Program, and FY25/FY26 funding status. The agenda includes a 'Small Request Application' and updates on the Poetry Out Loud competition.

cultural-affairsartspublic-artfundingpoetrycolumbia-mo
City Hall Council Chambers 701 E. Broadway Columbia, MO
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
9 yea · 3 present
Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson present · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea · Symonne Sparks yea
APPROVAL OF MINUTES — Approved a Motion
9 yea · 3 present
Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson present · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea · Symonne Sparks yea
TMP-31921 — Approved a Motion
8 yea · 3 present · 1 abstain
Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson present · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Jennifer Jennings abstain · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea · Symonne Sparks yea
ADJOURNMENT — Approved a Motion
9 yea · 3 present
Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson present · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea · Symonne Sparks yea
Mon Dec 8, 2025 · 9:00 AM

City Council

Columbia City Council holds a retreat to discuss governance and neighborhood policing.

The Columbia City Council is convening a retreat to discuss the council-manager form of government and neighborhood policing. The meeting is scheduled for Monday, December 8, 2025, at 9:00 AM in the Community Room at 1204 International Dr.

city-councilretreatgovernancepoliceneighborhood-policingmeeting
✓ Decided: Council adopted regular off‑week work sessions on the second Monday each month

The council approved beginning regularly scheduled off‑week work sessions on the second Monday of each month, to be held as needed. Communication norms were revised and clarified, and staff promoted use of the Council Inquiry email system. Procedures for special meetings, media requests, and agenda additions were also clarified.

Molly Thomas Bowden Neighborhood Policing Center Community Room 1204 International Dr. Columbia, MO
Thu Dec 4, 2025 · 2:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO to adopt MoDOT safety targets and hold public hearings on TIP and transit plan

The Columbia Area Transportation Study Organization will adopt MoDOT's proposed statewide safety targets and hold public hearings on amendments to the FY 2026-2029 Transportation Improvement Program and the Coordinated Public Transit-Human Services Transportation Plan.

transportationsafetypublic-hearingtransitplanningcouncil
City Council Chamber City Hall 701 E. Broadway Columbia, Missouri
Thu Dec 4, 2025 · 5:30 PM

Planning and Zoning Commission

Planning and Zoning Commission discusses 2026 deadlines and small lot amendments

The commission will review the 2026 application deadlines and meeting calendar. The agenda also includes a discussion regarding Small Lot Integration Text Amendments for Article 5 and Appendix A.

zoninggovernment-scheduleland-use
✓ Decided: Commission unanimously adopts agenda and approves prior minutes

The Planning and Zoning Commission adopted the meeting agenda unanimously. The November 20, 2025 work session minutes were approved, with Commissioner Wilson abstaining. The work session was extended to end at 7:30 pm.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31857 — Approved a Motion
7 yea · 1 present · 1 abstain
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson abstain · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Dec 4, 2025 · 7:00 PM

Planning and Zoning Commission

Public hearing on conditional use permit for accessory dwelling unit at 105 S Glenwood Ave

The Planning and Zoning Commission will hold a public hearing on a conditional use permit for an accessory dwelling unit at 105 South Glenwood Avenue. A separate rezoning request for a 6.57-acre parcel near East Gans Road and South Gans Creek Road has been withdrawn by the applicant and will not be considered.

planningzoningpublic-hearingconditional-use-permitaccessory-dwelling-unitwithdrawn-itemcolumbia-mo
✓ Decided: Commission unanimously approved agenda; minutes approved 7‑1 vote

The Planning and Zoning Commission approved the meeting agenda by unanimous vote. The November 20, 2025 meeting minutes were approved with seven votes in favor and one abstention. A withdrawn R‑1 zoning request required no action. No decision was recorded on the Conditional Use Permit for an accessory dwelling unit at 105 South Glenwood Avenue.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 1 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31858 — Approved a Motion
8 yea · 1 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31862 — Approved a Motion
8 yea · 1 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Dec 4, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council to discuss Winter Well Being Expo and awards

The Mayor's Council on Physical Fitness and Health will review and discuss routine administrative items including approval of minutes, a treasurer's report, old business on the Winter Well Being Expo and Mayor's Council awards, and rescheduling the January meeting. The meeting is largely procedural with no major decisions or financial actions on the agenda.

healthfitnesscommunity-eventsmayors-councilcolumbia-mo
ARC Meeting Room 1701 W. Ash
Wed Dec 3, 2025 · 3:00 PM

Airport Advisory Board

Airport Advisory Board canceled due to lack of quorum

The Columbia Airport Advisory Board canceled its regular meeting on December 3, 2025, due to a lack of quorum. The agenda included proposals to apply for Federal Aviation Administration (FAA) funds for a jet bridge and to discuss transportation options for non-rental car users.

airportfaacanceledtransportationboard
Airport Administration Building, 11400 S Airport Drive, Columbia, MO
Wed Dec 3, 2025 · 6:30 PM

Community Land Trust Organization Board

Board to vote on 2026 budget, elect officers, discuss real estate in closed session

The Community Land Trust Organization Board will hold a regular meeting to approve minutes, handle old business, and consider new business including onboarding new members, electing officers, approving the draft 2026 budget and calendar, and renewing domain and membership services. A closed session is scheduled to discuss leasing, purchase, or sale of real estate. The meeting includes public comment and sets the next meeting for January 7, 2026.

community-land-trustbudgetofficersreal-estateadministrationcolumbia-mo
✓ Decided: Board approved FY 2026 budget of $48,130

The board elected its 2026 executive officers, naming Anthony Stanton President, Linda Head Vice President, Jaye Trotter Treasurer, and Doug Hunt Secretary. It approved the FY 2026 budget totaling $48,130 and adopted the 2026 meeting calendar. Additional actions included authorizing a resident email survey about mailbox locations and setting a $1,000 fund for minor repairs at 115 Lynn.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (11 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 2 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31883 — Approved a Motion
8 yea · 1 present · 1 abstain
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron abstain
TMP-31886 — Approved a Motion
33 yea · 4 present · 3 abstain
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter abstain · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head abstain · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt abstain · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31887 — Approved a Motion
9 yea · 1 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31888 — Approved a Motion
9 yea · 1 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31889 — Approved a Motion
9 yea · 1 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31890 — Approved a Motion
9 yea · 1 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31891 — Approved a Motion
9 yea · 1 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
TMP-31894 — Approved a Motion
17 yea · 3 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Diamond Tabron yea
GENERAL COMMENTS BY PUBLIC, MEMBERS AND STAFF — Approved a Motion
8 yea · 2 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present · Diamond Tabron yea
ADJOURNMENT — Approved a Motion
8 yea · 2 present
Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present · Diamond Tabron yea
Tue Dec 2, 2025 · 5:30 PM

Commission on Human Rights

Commission on Human Rights discusses pedestrian safety and outreach strategy

The Commission will discuss public sanitation facilities and strategies for HREP outreach. Members will also review feedback regarding a Pedestrian Safety Ordinance intended for City Council.

public-safetyordinancesoutreachsanitation
✓ Decided: Commission approves $500 library outreach grant and $150 diversity event tickets

The commission unanimously approved the meeting agenda and the prior meeting minutes. It approved a $500 outreach request from the Daniel Boone Regional Library by majority vote. It also unanimously approved $150 to purchase two tickets for the Columbia Values Diversity Breakfast and related advertising. The commission will develop a letter on the Pedestrian Safety Ordinance for the City Council by February 2026.

Conference Room 1A 701 E Broadway Columbia, MO
Tue Dec 2, 2025 · 5:30 PM

Historic Preservation Commission

Historic Preservation Commission to review demolition permits for two properties

The commission will consider demolition permit applications for 804 N. Ann Street and 206 Alexander Avenue. It will also discuss selecting a consultant for the Benton-Stephens Survey Phase I and receive a report on a preservation plan for the city council. Staff reports on Parks & Rec projects and a Most Notable Plaques order are also on the agenda.

historic-preservationdemolition-permitsbenton-stephens-surveyconsultant-selectionpreservation-plancolumbia-mo
✓ Decided: Commission approved demolition permits for two historic properties

The Historic Preservation Commission unanimously approved the meeting agenda and minutes. It closed review of demolition permit applications for 804 N. Ann Street and 206 Alexander Avenue, effectively approving those permits. Commissioners also unanimously authorized staff to prepare postcards and mailing lists for past plaque recipients and designated Bybee, Gartner, and Parshall as the selection committee for the Benton‑Stephens Survey Phase I consultant process.

Conference Room 1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
APPROVAL OF AGENDA — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
APPROVAL OF MINUTES — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
TMP-31871 — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
Mon Dec 1, 2025 · 5:00 PM

City Council

Columbia City Council meeting scheduled for December 1, 2025

The agenda consists of a call to order and a motion to enter closed session. No specific legislative items or public business are listed for discussion.

government-procedureclosed-session
✓ Decided: Council approved motion to go into closed session

Mayor Buffaloe moved to place the council in closed session to discuss legal matters, sealed bids, real‑estate transactions, and personnel records. Council Member Waterman seconded the motion. The council entered closed session at 5:02 p.m. and adjourned the closed meeting at 6:58 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-31822 — Approved a Motion
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
Mon Dec 1, 2025 · 7:00 PM

City Council

City Council to approve FY 2026 pay plans and multiple STR permits

The Columbia City Council will consider adopting the FY 2026 Classification and Pay Plans, granting several short-term rental permits, and approving various contracts and grants. The meeting also includes public hearings on a sidewalk project and a pre-engineered metal building.

city-councilbudgethousingzoningpublic-safetyinfrastructurecontractsparks
✓ Decided: Council approved short‑term rental permit for 2609 Wee Wynd by 4‑3 vote

The council voted 4‑3 to enact B299‑25, granting a conditional use permit for a short‑term rental at 2609 Wee Wynd. Earlier, the council unanimously authorized the Mills Drive sidewalk improvement and the construction of a pre‑engineered metal building at the Material Recovery Facility. The council also removed R164‑25 from the agenda, moved B299‑25 to old business, and adopted the entire consent agenda with a unanimous vote; no new business was taken.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B299-25 — Passed
4 yea · 3 nay
Barbara Buffaloe nay · Nick Foster nay · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood nay
The other 15 items passed by unanimous or near-unanimous consent.
Wed Nov 26, 2025 · 11:00 AM

Convention and Visitors Advisory Board

CVB to discuss sports development application and closed session

The Convention and Visitors Advisory Board will approve minutes from a previous meeting and discuss a 2026 Missouri Middle School Basketball Championship application. The board is also scheduled to enter a closed session to review sealed bids and contract documents.

cvbsportsbasketballclosed-sessionminutesstaff-reportcolumbia
✓ Decided: Board approved $12,500 funding for 2026 Missouri Middle School Basketball Championship

The board approved the meeting agenda and the October 2025 minutes. It entered a brief closed session and then returned to open session. The board voted to support the Columbia Sports Commission’s recommendation to fund the 2026 Missouri Middle School Basketball Championship with $12,500. The next meeting was scheduled for Monday, January 26, 2026.

300 S. Providence Road - Thomas G. Walton Bldg.
Mon Nov 24, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Airport update and middle school basketball bid on CVAB agenda

The Convention and Visitors Advisory Board will hear an update on Columbia Regional Airport from Airport Manager Mike Parks and consider a sports development application for the 2026 Missouri Middle School State Basketball Championships. The board also plans to enter closed session to discuss sealed bids and related contracts. Reports from CVB staff, The District, and the Boone County Commission are scheduled.

tourismsports-developmentairportconvention-and-visitorscolumbia-moclosed-sessionreports
300 S. Providence Road - Thomas G. Walton Building
Mon Nov 24, 2025 · 4:30 PM

Building Construction Codes Commission

Commission discusses 2024 Code Cycle impacts on Columbia development

The Building Construction Codes Commission will hold a regular meeting with discussions on state-level legislative actions, building code adoption and public comments, the public hearing process and commission involvement, and the potential impacts of the 2024 Code Cycle on development in Columbia. No votes or concrete actions are scheduled; the agenda is largely informational and procedural.

building-codesconstructiondevelopmentpublic-hearingstate-legislation
City Hall Council Chambers 701 E Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
20 present
Kas Carlson present · Brian Connell present · Jay Creasy present · Robert Jackson present · Richard Shanker present · David Weber present · Matthew Young present · John Neyens present · Jonathan Trunk present · Christopher Howe present · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy present · Dan Shifley present · Paul Prevo present · John Page present · Fred Malicoat present · Kyle Saunders present · Jamie Kroll present
Thu Nov 20, 2025 · 5:30 PM

Planning and Zoning Commission

Commission will consider Small Lot Integration text amendments (Article 5 & Appendix A)

The Planning and Zoning Commission will discuss the Small Lot Integration Text Amendments, specifically Article 5 and Appendix A, as old business. The meeting also includes routine items such as calling the session to order, introductions, and approval of the agenda and the November 6, 2025 work session minutes. The commission will set the next meeting date for December 4, 2025.

zoningplanningland-usemeetingagenda
✓ Decided: Commission scheduled next meeting for Dec 4, 2025

The agenda was adopted unanimously. The November 6 work session minutes were approved with Commissioners Gray and Stockton abstaining. The commission set a tentative date for the next meeting on December 4, 2025 at 5:30 pm. The meeting was adjourned at 6:55 pm.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31780 — Approved a Motion
6 yea · 2 abstain · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray abstain · Kate Stockton abstain · Cody Darr yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Nov 20, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to consider rezoning 0.43 acres for business use at 202 N. Old Hwy 63

The Planning and Zoning Commission will hold three public hearings: a final plat for a water district property, a rezoning request for a home to become office space, and a short-term rental application. Each item includes conditions or adjustments. The commission may vote on these items after public comment.

planning-and-zoningzoningrezoningpublic-hearingsubdivisionshort-term-rentalcolumbia-mo
✓ Decided: Commission approves one‑lot final plat for Consolidated Water at 1500 N. Seventh St.

The Planning and Zoning Commission unanimously approved a design adjustment that waives the sidewalk requirement on the North Seventh Street frontage of 1500 North Seventh Street, provided a $23,653.17 fee‑in‑lieu is paid before recording. The commission also unanimously approved the one‑lot final plat titled “Consolidated Water, Plat No. 1,” subject to technical corrections. Both motions received an 8‑0 vote.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-31785 — Approved a Motion
4 nay · 4 yea · 1 present
Anthony Stanton nay · Sharon Geuea Jones nay · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray nay · Kate Stockton nay · Cody Darr yea
The other 4 items passed by unanimous or near-unanimous consent.
Wed Nov 19, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to discuss pedestrian safety ordinance and traffic calming projects

The Bicycle and Pedestrian Commission will review staff reports and public hearing notices for traffic calming projects on Old Plank Road and Whitegate Drive. The body will also discuss an ordinance regarding pedestrians in medians and the CoMo to Zero safety plan.

pedestrian-safetytraffic-calmingpublic-hearingsordinancesidewalksco-mo-to-zero
✓ Decided: Commission voted to draft a letter opposing pedestrian median ordinance B265-25

The commission approved its agenda and minutes. It voted to draft a letter opposing Ordinance B265-25 concerning pedestrians in medians. It also approved a letter to MoDOT urging adherence to the 30% progress milestone for the I‑70 expansion, and tabled the proposal to formalize a sidewalk master‑plan procedure. The meeting was adjourned at 8:33 p.m.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Nov 19, 2025 · 4:15 PM

Food Council

Food Council to review updates on allergens and OFBC

The Columbia Food Council will meet to approve draft minutes from October 2025 and discuss updates regarding the OFBC and food allergens. The meeting will also cover current food policy events.

foodhealthcouncilallergenspolicypublic-health
✓ Decided: Food Council approved agenda, minutes and adjourned the meeting

The council unanimously approved the meeting agenda and the October 15, 2025 meeting minutes. The council then adjourned the session at 5:28 p.m. No substantive policy actions were taken.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed Nov 19, 2025 · 5:00 PM

Tree Board

Tree Board meeting canceled for November 19, 2025

The Columbia Tree Board meeting scheduled for November 19, 2025, has been canceled. The agenda included discussions on the City Tree Fund, the FY26 budget, and public outreach messaging.

tree-boardcanceledcity-tree-fundbudgetpublic-outreach
Tue Nov 18, 2025 · 5:30 PM

Public Transit Advisory Commission

Pedestrian Safety Ordinance B265-25 to be discussed

The Public Transit Advisory Commission will discuss the Pedestrian Safety Ordinance (B265-25), along with ongoing discussions on fares and the Tiger Line. The commission will also receive updates on Vision Zero, disability, bike/ped, and CATSO, and review October ridership data.

public-transitpedestrian-safetyordinancefarestiger-lineridershipvision-zero
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Tue Nov 18, 2025 · 7:00 PM

Board of Adjustment

Board to consider converting a stealth tower to a non‑stealth tower at 1205 W Broadway

The Board of Adjustment will hold public hearings on four land‑use requests. One request (Case 336‑2025) seeks to amend the 2012 conditional use permit for the communication tower at 1205 W Broadway to change it from a stealth to a non‑stealth tower. The other three requests are variances: a driveway setback at 210 Edgewood Avenue (Case 339‑2025), a rear‑yard setback for a new lot at 211 Boone Drive (Case 01‑2026), and a deck setback at 5700 Camden Circle (Case 02‑2026). The board will also approve the agenda, minutes, and set the next meeting date.

zoningdevelopmentcommunicationshousingroads
Columbia City Hall Council Chambers 701 E Broadway
Mon Nov 17, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Columbia committee to select audit firm and investment broker

The Finance Advisory and Audit Committee will review the scope of the FY25 audit and select a broker for pooled cash investments. The meeting also includes approval of minutes and a public discussion on revenue.

financeauditinvestmentbudgetpublic-commentcolumbia
✓ Decided: Finance Advisory Committee approved agenda, minutes and adjourned

The Finance Advisory and Audit Committee approved its meeting agenda and the October 20, 2025 draft minutes. No formal actions were taken on the FY25 audit scope or the pooled cash investment broker selection; those items were discussed only. The meeting was then adjourned.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Nov 17, 2025 · 7:00 PM

City Council

Council to vote on pedestrian safety ordinance, Hinkson Creek rezoning

The Columbia City Council will hold second-read votes on several items, including amendments to motorist and pedestrian rules on major corridor roadways, a rezoning of 3815 Hinkson Creek Road from Agriculture to Industrial, and multiple short-term rental conditional use permits. They will also conduct first readings on new items such as amended FY 2026 pay plans, additional short-term rental permits, and intergovernmental agreements. Scheduled public comments cover topics including unhoused neighbors, Vidwest Studios funding, and bike trails at Gans Creek Recreation Area.

city-councilpedestrian-safetyzoningshort-term-rentalsbudgetpublic-hearingpay-plans
✓ Decided: Council appoints members to multiple boards and commissions

The City Council approved appointments to several boards and commissions, naming each appointee and their term expiration dates. The agenda item R 160-25 was removed from the meeting agenda by unanimous voice vote. No other substantive actions were decided at this meeting.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B281-25 — Passed
3 yea · 3 nay · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters absent · Valerie Carroll nay · Jacquelyn Sample nay · Vera Elwood nay
The other 17 items passed by unanimous or near-unanimous consent.
Mon Nov 17, 2025 · 5:00 PM

City Council

Council to discuss energy codes and snow/ice operations

This pre-council session includes informational presentations on energy codes and snow/ice removal operations. No formal votes or ordinances are scheduled; the agenda is limited to discussion and staff briefings.

energy-codessnow-removalpublic-safetypresentationpre-council
✓ Decided: Council held informational presentations on energy codes and snow removal

The council heard a presentation on adopting new building energy codes and a briefing on winter road‑maintenance operations. No votes or formal actions were recorded; the items were discussed for public awareness only.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Thu Nov 13, 2025 · 1:00 PM

Office of Violence Prevention Advisory Committee

Committee reviews DOJ funding notice and community safety initiatives

The Office of Violence Prevention Advisory Committee will discuss updates on the Community Navigation Liaison RFP and Young Men United. It will receive a notice of a funding opportunity from the U.S. Department of Justice and consider the Activate MO Community Safety Initiative. Reports on youth trauma and gun violence, as well as plans for expanding the office, will also be presented.

violence-preventionfundingcommunity-safetyyouthreports
✓ Decided: Committee approves agenda, minutes and tables documentary partnership

The committee approved the meeting agenda and minutes as presented. It decided to table a proposed partnership with a documentary maker on a youth trauma and gun violence inquiry until more information is available. The meeting was then adjourned by committee approval.

The Reentry Opportunity Center (The ROC) Suite G 1621 Towne Dr. Columbia, MO 65202
Thu Nov 13, 2025 · 12:00 PM

Columbia Sports Commission

Sports Commission to consider funding for 2026 middle school basketball championship

The Columbia Sports Commission will consider a Sports Development Fund application for the 2026 Missouri Middle School State Basketball Championship. They also plan to vote on minutes from October 2025, discuss reports on sports sales and tradeshow planning, and may enter closed session to review sealed bids or contract proposals.

sportsfundingdevelopmentbasketballclosed-sessionreports
✓ Decided: Commission approved $12,500 for 2026 Missouri middle school basketball championship

The commission approved $12,500 to fund the 2026 Missouri Middle School State Basketball Championship. A motion to enter a closed session was passed with nine members voting yes. The meeting agenda and October minutes were approved, and the commission adjourned unanimously.

Columbia Sports Fieldhouse - Meeting Room 4251 Philips Farm Rd. Columbia, MO.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Pursuant to section 610.021.1 (12) RSMo, sealed bids and related documents, until the bids are opened; and sealed proposals or related documents or any documents related to a negotiated contract…
9 yea · 5 present
James Arnold present · Amy Schneider present · Susan Hart yea · Jared Klarfeld yea · David Egan yea · Gabe Huffington present · Kristopher Kunz yea · Ethan Cobb yea · Beau Baehman yea · Richard Walls present · Elizabeth Kelly yea · Stephanie Priesmeyer yea · Neal Wilkinson yea · Carter Marcks present
Thu Nov 13, 2025 · 5:30 PM

Board of Health

Board of Health to discuss animal limits and pre-council meeting

The Board of Health will introduce a new member, approve draft minutes, and discuss criteria for limiting the number of dogs and cats. The board will also prepare for a pre-council meeting on December 1.

board-of-healthanimalspublic-meetingcouncil-prepagendaminutes
✓ Decided: Board approved revised animal ordinance adding multiple‑pet permit requirements

The Board of Health approved changes to Section 5‑60 of the animal ordinance, adding a multiple‑pet permit with new criteria, by a 9‑0 vote. The board also approved revisions to the presentation for the December 1 pre‑council meeting by the same vote count. Members decided to keep the December Board of Health meeting on the calendar pending the pre‑council outcomes. The meeting was adjourned at 6:29 PM.

Columbia/Boone County Public Health & Human Services Training Room 1 1005 W. Worley St Columbia, MO.
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-31642 — Approved a Motion
9 yea · 2 present
Harry Feirman yea · Jonathan Heidt yea · Rosann Geiser present · Sonita Simelus yea · Ella Miller yea · Ashton Day yea · Joseline Hernandez Arroyo yea · Tom Rose yea · Samantha Joiner yea · Bridget Kraus present · Jennifer Carter Dochler yea
TMP-31643 — Approved a Motion
9 yea · 2 present
Harry Feirman yea · Jonathan Heidt yea · Rosann Geiser present · Sonita Simelus yea · Ella Miller yea · Ashton Day yea · Joseline Hernandez Arroyo yea · Tom Rose yea · Samantha Joiner yea · Bridget Kraus present · Jennifer Carter Dochler yea
Thu Nov 13, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission to discuss pedestrian safety ordinance, sidewalk closures

The Disabilities Commission will discuss the city's proposed pedestrian safety ordinance as it relates to accessibility. They will also hear updates on temporarily closed sidewalks for construction and street snow removal projects. Old business includes an update on the DawnZ Award for business accessibility.

disabilitiesaccessibilitypedestrian-safetysidewalksconstructionsnow-removalawardscolumbia-mo
✓ Decided: Commission approved report to Council on pedestrian safety ordinance concerns

The Disabilities Commission approved its agenda and the October 9, 2025 minutes. Members discussed the city’s proposed pedestrian safety ordinance and raised accessibility concerns. The commission approved a motion to write a report to City Council outlining those concerns. The meeting was then adjourned.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
14 yea
Hazel Fields yea · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
TMP-31733 — Approved a Motion
14 yea
Hazel Fields yea · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
TMP-31737 — Approved a Motion
14 yea
Hazel Fields yea · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
ADJOURNMENT — Approved a Motion
14 yea
Hazel Fields yea · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
Wed Nov 12, 2025 · 12:00 PM

Substance Use Prevention Advisory Commission

Commission to discuss liquor sales during 2026 FIFA World Cup

The Substance Use Prevention Advisory Commission will meet to approve past meeting minutes and receive a presentation regarding state statutes concerning liquor sales during the 2026 FIFA World Cup.

substance-usepublic-healthliquorfifa-world-cupcommissioncolumbia-mo
✓ Decided: Commission approved recommendation to opt out of World Cup liquor law

The Substance Use Prevention Advisory Commission unanimously approved its agenda and the minutes from the August 12, 2025 meeting. The commission then approved a motion to recommend that the city opt out of the state law allowing 24‑hour liquor sales during the 2026 FIFA World Cup, with a 5‑2 vote. The recommendation will be forwarded to City Council for consideration.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-31659 — Approved a Motion
5 yea · 2 present
Molly Lindner yea · Vinita Khanna present · James Bayless yea · Paul Leykamp yea · Jennifer Maddox present · Beth Morrison yea · Megan Jones yea
Approved a Motion
5 yea · 2 present
Molly Lindner yea · Vinita Khanna present · James Bayless yea · Paul Leykamp yea · Jennifer Maddox present · Beth Morrison yea · Megan Jones yea
Wed Nov 12, 2025 · 6:00 PM

Citizens Police Review Board

Annual report and CPOA request on police review board agenda

The Citizens Police Review Board will consider an annual report from Earl Kraus, discuss the Missouri Roundtable on Community and Law Enforcement, and address a request from the Columbia Police Officers Association. The board will also receive reports from the Human Rights Commission and the NACOLE conference, and may go into closed session to discuss records protected from disclosure by law.

citizens-police-review-boardpolice-oversightcommunity-law-enforcementcolumbia-missouriannual-reportclosed-sessioncpoa
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Nov 12, 2025 · 8:00 AM

Water and Light Advisory Board

Water and Light Advisory Board to review irrigation ordinance and utility reports

The Water and Light Advisory Board will meet to approve minutes, review a draft irrigation ordinance, and discuss transmission line costs and power agreements. The agenda includes updates on the 2018 Water Ballot Project, quarterly reports, and a report to the City Council.

waterelectricirrigationbudgetcouncilutilityreport
✓ Decided: Board approved agenda, minutes and adjourned the meeting

The Water and Light Advisory Board unanimously approved the meeting agenda as presented. It also unanimously approved the October 8 and October 29, 2025 meeting minutes. The board then unanimously adjourned the meeting at 10:39 a.m. Several reports were deferred to the next meeting due to time constraints.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Nov 12, 2025 · 3:00 PM

Parking Advisory Commission

The November 12 Parking Advisory Commission meeting is cancelled

The scheduled meeting for the Parking Advisory Commission on November 12, 2025, has been cancelled. No specific business items were listed for this session.

cancelled
Wed Nov 12, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council meets to plan summit and discuss service projects

The Youth Advisory Council will approve minutes from a prior meeting and discuss planning for a Youth Summit and service projects. The group will also review a draft newsletter and hold a social media workshop.

youthcouncilplanningnewsletterworkshopservice-projects
✓ Decided: YAC approved agenda and minutes; city limits its own social media account

The council approved the meeting agenda and the October 2025 minutes, both motions carried. The meeting was adjourned at 7:20 p.m. after a motion carried. City staff announced that YAC may not create or run its own social‑media account and will receive a workshop, with a possible subcommittee to produce content through the city’s account.

701 E. Broadway Columbia, MO. 65201 Conference Room 1A/1B
Mon Nov 10, 2025 · 4:15 PM

Commission on Cultural Affairs

Cultural Affairs commission to elect officers and review funding

The Commission on Cultural Affairs will meet to approve minutes from September 2025 and elect officers for Chair, Vice-Chair, and Secretary. The agenda includes updates on the Columbia Arts Fund, the Artist Laureate Program, and FY25 and FY26 funding status.

cultural-affairsartscouncilfundingpublic-artnomineesminutes
✓ Decided: Commission reappointed officers and appointed new public‑art and funding committee members

The commission voted to keep the current officers—Chair Diana Moxon, Vice‑Chair Stacey Thompson, and Secretary Molly Froidl—for another one‑year term. It also appointed Sarah Howard and Spencer Thompson to the Funding Process Sub‑Committee, and Stacey Thompson and Molly Froidl (as Chair) to the Standing Committee on Public Art. All motions carried.

City Hall Council Chambers 701 E. Broadway Columbia, MO
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
9 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea
APPROVAL OF MINUTES — Approved a Motion
9 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea
TMP-31689 — Approved a Motion
9 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea
TMP-31691 — Approved a Motion
9 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea
ADJOURNMENT — Approved a Motion
9 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Greg Aker yea · Sarah Howard yea
Mon Nov 10, 2025 · 9:00 AM

City Council

Council to receive Tax Increment Financing presentation

The City Council will hold a work session to receive a presentation on Tax Increment Financing (TIF). No other substantive items are on the agenda; the meeting is primarily informational.

tiftax-increment-financingpresentationeconomic-developmentcity-council
✓ Decided: Council discussed TIF and downtown safety, no formal actions taken

The council held a work session to hear a presentation on Tax Increment Financing (TIF) and its potential uses. Members asked questions about the TIF district, funding, and related projects, but no motions were voted on. Additional topics included public‑safety meeting transparency and the possibility of future work sessions, with no decisions recorded.

City Hall Council Chamber 701 E. Broadway Columbia, MO
Thu Nov 6, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to hold training on open records laws

This is a procedural work session with no public hearings or votes on rezonings or ordinances. The main agenda item is a commissioner training session on the Missouri Freedom of Information Act and open records requirements.

trainingplanningzoninggovernmentopen-records
✓ Decided: Commission approved agenda and prior meeting minutes

The Planning and Zoning Commission adopted the November 6 agenda unanimously. It also approved the October 23 work‑session minutes as submitted. No other substantive actions were taken.

Columbia City Hall Conference Rm 1C 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
7 yea · 2 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray present · Kate Stockton present · Cody Darr yea
TMP-31608 — Approved a Motion
7 yea · 2 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray present · Kate Stockton present · Cody Darr yea
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray present · Kate Stockton present · Cody Darr yea
Thu Nov 6, 2025 · 7:00 PM

Planning and Zoning Commission

Columbia commission to hear short-term rental applications

The Planning and Zoning Commission will consider five requests for short-term rental licenses and one rezoning request at its November 6 meeting.

columbiaplanningzoninghousingshort-term-rentalpublic-hearing
✓ Decided: Planning and Zoning Commission approved agenda and meeting minutes

The commission unanimously approved the November 6 agenda. The October 23 minutes were approved with six votes in favor and one abstention. No other actions were recorded in this meeting.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-31612 — Approved a Motion
4 nay · 3 yea · 2 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters nay · McKenzie Ortiz nay · David Brodsky nay · Les Gray present · Kate Stockton present · Cody Darr nay
The other 6 items passed by unanimous or near-unanimous consent.
Thu Nov 6, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council to review mini-grants, discuss Winter Well-Being Expo date change

The Mayor's Council on Physical Fitness and Health will consider mini-grant applications and discuss a date change for the Winter Well-Being Expo. The meeting also includes a report on the expo, council awards, treasurer's report, and approval of previous minutes.

physical-fitnesshealthgrantswellness-expocolumbia-mo
ARC Meeting Room 1701 W. Ash Columbia, MO
Wed Nov 5, 2025 · 1:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO to review FY 2026-2029 TIP amendment

The CATSO Technical Committee will discuss a proposed amendment to the FY 2026-2029 Transportation Improvement Program (TIP) and review MoDOT's statewide safety targets. The committee will also consider an updated Coordinated Public Transit Human Services Transportation Plan. Previous meeting minutes are up for approval, and public comment is permitted.

transportationplanningsafetytransittipmissouricolumbia
Conference Room 1C City Hall 701 E. Broadway Columbia, Missouri
Wed Nov 5, 2025 · 5:30 PM

Historic Preservation Commission

Commission to select consultant for Benton‑Stephens Phase I historic survey

The Historic Preservation Commission will review demolition permit applications for three properties: 3501 Sierra Madre, 1004 W. Broadway, and 1102 Coats St. Staff will report on ongoing preservation plan work items and discuss next steps for the preservation plan and replacement of historic property plaques. New business includes selecting a consultant for the Phase I survey of the Benton‑Stephens area.

historic-preservationdemolitionsurveyplaqueconsultant-selection
✓ Decided: Commission voted to request best‑and‑final offers for historic survey consultant

The Historic Preservation Commission approved its agenda and minutes by unanimous voice vote. It closed review of demolition permit applications for 1004 W. Broadway and 1102 Coats Street. The commission unanimously voted to request best‑and‑final offers from all respondents for the Benton‑Stephens Phase I Survey consultant selection. The meeting was adjourned at 7:15 PM.

Conference Room 1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 1 absent
Melissa Hagen absent · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
APPROVAL OF MINUTES — Approved a Motion
5 present · 1 absent
Melissa Hagen absent · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
5 present · 1 absent
Melissa Hagen absent · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
TMP-31635 — Approved a Motion
5 present · 1 absent
Melissa Hagen absent · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present · Trey Cook present
Wed Nov 5, 2025 · 6:30 PM

Community Land Trust Organization Board

CCLT board to discuss administrative services agreement and homebuyer policy

The Community Land Trust Organization Board will review the minutes from the September 10, 2025 meeting, receive financial statements for September and October 2025, and discuss an Administrative Services Agreement for 2026. The board will also consider suggested amendments to the Homebuyer Selection Policy.

columbiacommunity-land-trusthousingboard-meetingfinancialspolicyagenda
✓ Decided: Board approved 2026 Administrative Services Agreement with higher fee

The board approved its meeting agenda and the September 10, 2025 minutes. It accepted the treasurer’s September and October financial reports. The 2026 Administrative Services Agreement was approved, raising the fee from $15,000 to $20,000. The meeting was then adjourned.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-31668 — Approved a Motion
6 yea · 3 present · 1 nay
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter present · Tracey Bush-Cook yea · Douglas Hunt nay · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
The other 2 items passed by unanimous or near-unanimous consent.
Tue Nov 4, 2025 · 5:30 PM

Commission on Human Rights

Commission will vote on moving part of the meeting into closed session

The Columbia Commission on Human Rights will consider several items, including a review of proposed changes to Chapter 12-57 of the Code of Ordinances on public sanitary facilities and planning for a Missouri Human Rights Commission outreach event in March 2026. New business includes developing an outreach strategy and updating literature. A motion will be made to enter closed session to discuss pending legal cases.

human-rightsordinanceoutreachclosed-sessionpublic-sanitary-facilities
✓ Decided: Commission approved agenda, minutes and adjourned meeting unanimously

The Commission on Human Rights unanimously approved the meeting agenda and the draft minutes from the October 7, 2025 meeting. The body also unanimously voted to adjourn the session at 6:38 p.m. No other formal actions were taken.

Conference Room 1A 701 E Broadway Columbia, MO
Mon Nov 3, 2025 · 7:00 PM

City Council

Council to vote on rezoning 3815 Hinkson Creek Road from Agriculture to Industrial

The Columbia City Council will consider a rezoning of property on Hinkson Creek Road from Agriculture to Industrial, and will vote on several conditional use permits for short-term rentals. The consent agenda includes amendments to affordable housing agreements, a police equipment grant, and a contract for short-term rental monitoring services.

zoningshort-term-rentalsaffordable-housingpolicebudgetingpublic-safetyhousing
✓ Decided: Council approved consultant contract to monitor short‑term rentals

The council moved B279-25 to old business and then approved it, authorizing a consultant agreement with Avenu Insights & Analytics for short‑term rental monitoring and FY 2026 budget funds. It also approved a conditional use permit for a short‑term rental at 1506 Windsor Street (B267-25). All consent‑agenda items were adopted unanimously. No new business was taken up.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (26 roll-call votes)
Named votes as recorded in the official record.
B272-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B271-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B273-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B275-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B276-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B268-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B267-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B269-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B274-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B266-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B270-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B278-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B277-25 — Passed
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R152-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R149-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R153-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R148-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R150-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R154-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R158-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
Mon Nov 3, 2025 · 5:00 PM

City Council

City Council to review Columbia Police Department dashboard

The City Council will receive a presentation on the Columbia Police Department (CPD) Dashboard. The body will also consider a motion to enter closed session to discuss legal communications and public safety response plans.

policepublic-safetycity-council
✓ Decided: Council approved motion to enter closed session for confidential matters

The council voted to enter a closed session to discuss confidential and privileged matters. The motion was made by Mayor Pro Tem Nick Foster, seconded by Don Waterman, and approved unanimously by the six members present. The closed session lasted from approximately 6:05 p.m. to 6:55 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-31617 — Approved a Motion
6 yea · 1 absent
Barbara Buffaloe absent · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
Thu Oct 30, 2025 · 5:30 PM

Personnel Advisory Board

Personnel Advisory Board to discuss labor negotiations and fiscal year changes

The board will discuss labor negotiations and fiscal year changes under new business. They will also approve minutes from December 4, 2024. No public hearings or other substantive items are listed.

personnellabor-negotiationsfiscal-yearcity-of-columbiaboard-meeting
Columbia Training Center 500 E. Walnut St. Ste. 108 Columbia, MO 65201
Wed Oct 29, 2025 · 6:00 PM

Water and Light Advisory Board

Water and electric rate increases and community solar discussed

The Water and Light Advisory Board will meet to discuss utility customer service survey results, an update on PayCoMo, community solar and energy efficiency programs, a water revenue increase, and an electric rate increase. The board is not expected to vote, but these items are presented for discussion and public input.

waterelectric-ratescommunity-solarpaycomoadvisory-boardcolumbia-mo
✓ Decided: Board adjourned without any formal policy decisions

The Water and Light Advisory Board held a public input meeting, presented survey results, PayCoMo updates, and program information. No substantive policy actions or approvals were taken; the meeting concluded with a unanimous motion to adjourn.

701 E Broadway City Council Chambers
Tue Oct 28, 2025 · 6:00 PM

Climate and Environment Commission

Climate commission to discuss action plan update and Bird City application

The Climate and Environment Commission will review draft minutes from July and September, discuss old business including a representative for the Climate Action and Adaptation Plan Update and the commission's 2025 priorities, and consider a memo to City Council regarding a Bird City application. Public comment periods are available for general and special items.

climateenvironmentclimate-actionadaptationbird-citycommission-priorities
City Hall 701 E Broadway Conference Room 1A Columbia Missouri
Tue Oct 28, 2025 · 3:00 PM

Mayor's Task Force on the U.S.S. Columbia

Task Force discusses rescheduled U.S.S. Columbia crew visit, reception

This regular meeting of the Mayor's Task Force on the U.S.S. Columbia includes approval of minutes, old and new business, and reports. New business covers a rescheduled crew visit from Nov. 4-9, a city reception on Nov. 6, meetings with officials, and press/publicity. The agenda is largely procedural with updates on the submarine project.

uss-columbianavycity-eventstask-forcepublicity
✓ Decided: Task Force approved agenda, minutes and then adjourned

The board approved the meeting agenda and the September 3, 2025 minutes, both by motion carried. The meeting was then adjourned by a motion carried.

Walton Building Board Room 300 S. Providence Rd. Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 1 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
APPROVAL OF MINUTES — Approved a Motion
8 yea · 1 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
Mon Oct 27, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Mayor's Council to plan Winter Wellness Expo

The Mayor's Council on Physical Fitness and Health will meet to plan the logistics and promotion for the Winter Wellness Expo scheduled for February 28.

wellnessfitnessexpoplanningcouncil
ARC Conference Room 1701 W. Ash Columbia, MO 65201
Mon Oct 27, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Board to vote on FY2026 chair, consider tourism grant for jazz series

The Convention and Visitors Advisory Board will vote on a chair and vice chair for FY2026 and consider a Tourism Development Signature Series application from the We Always Swing Jazz Series. The board will also review quarterly reports on communications, sales, and destination data. Old business is none.

tourismjazz-seriesboard-chairquarterly-reportsadvisory-boardcolumbia
✓ Decided: Board approved $15,000 to fund the We Always Swing Jazz Series

The Convention and Visitors Advisory Board approved a $15,000 grant for the We Always Swing Jazz Series, amending the motion to include a one‑time $2,500 addition. The board also elected Rusty Strodtman as Chair and Don Laid as Vice‑Chair for FY2026. The agenda and minutes were approved as written, and the meeting was adjourned at 1:09 p.m.

300 S. Providence Road - Thomas G. Walton Building
Thu Oct 23, 2025 · 5:30 PM

Planning and Zoning Commission

Commission reviews revisions for accessory dwelling units and small lot standards

The Planning and Zoning Commission is meeting to discuss proposed Unified Development Code (UDC) revisions. The session focuses on standards for small lot development and accessory dwelling units.

zoninghousingudc-revisionssmall-lotsadus
✓ Decided: Commission adopts agenda, approves minutes, and schedules ADU review

The Planning and Zoning Commission adopted the amended agenda unanimously and approved the October 9 work‑session minutes. Commissioners agreed to consider the proposed accessory‑dwelling‑unit UDC revisions after the small‑lot standards and family‑definition updates are completed. The next meeting was set for November 6, 2025 and the commission adjourned.

Conference Rm 1A/1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31511 — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Oct 23, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to hold public hearings on three short-term rental requests

The Planning and Zoning Commission will hold public hearings on three applications for short-term rentals at 318 Anderson Avenue, 1409 Wilkes Boulevard Apt 103, and 2609 Wee Wynd. Additionally, a request to table a final major plat for Consolidated Water Plat No. 1 at 1500 Seventh Street will be considered.

planningzoningshort-term-rentalpublic-hearingsubdivisionsidewalk-adjustment
✓ Decided: Commissioners unanimously approve agenda, minutes and table water‑district plat

The commission unanimously approved the meeting agenda. They also unanimously approved the October 9, 2025 meeting minutes. The commission voted 8‑0 to table Case 284‑2025 (1500 North Seventh Street) until the November 20, 2025 planning commission meeting.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31507 — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31508 — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31509 — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31512 — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31541 — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Wed Oct 22, 2025 · 3:00 PM

Airport Advisory Board

Airport Advisory Board to receive Moberly Area Community College update

The Airport Advisory Board will meet to approve previous minutes and receive an update from Ed Longoria regarding Moberly Area Community College. The meeting also includes a report from Mike Parks.

airporteducationcommunity-college
Columbia Regional Airport Conference Room 11350 S Airport Drive Columbia MO
Tue Oct 21, 2025 · 1:00 PM

Office of Violence Prevention Advisory Committee

Committee to discuss RFP for Community Navigation Liaison

The Office of Violence Prevention Advisory Committee will hear updates on the BlkHandSide Collective and Community Mental Health for Practical Application, and discuss a new Request for Proposals for a Community Navigation Liaison. Members will also review a landscape analysis from the National Institute for Criminal Justice Reform and receive reports on the Bullet Related Injury Clinic and Young Men United.

violence-preventioncommunity-healthrfpcriminal-justiceyouth-programsadvisory-committee
✓ Decided: Committee approved agenda and minutes, then adjourned the meeting

The Office of Violence Prevention Advisory Committee approved the meeting agenda and the prior meeting minutes as presented. No other substantive actions or votes were recorded. The meeting was then adjourned at 2:35 PM.

City Hall Conference Room 1C 701 E. Broadway Columbia, MO 65201
Tue Oct 21, 2025 · 4:00 PM

City Council

Council to review 2025 transit study update

The City Council will hold a work session to receive a presentation and discuss the 2025 update of the Comprehensive Transit Study. No votes or decisions are scheduled; the session is for discussion only.

transittransportationstudypresentationcity-council
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Tue Oct 21, 2025 · 6:00 PM

Public Transit Advisory Commission

PTAC to discuss bus stop evaluation and fares

The Public Transit Advisory Commission will discuss an updated Bus Stop Evaluation Matrix and hold a discussion on fares. Commissioners will also hear updates from the City Council and other commissions, review September ridership data, and approve minutes from the September meeting. No formal votes are scheduled; all items are for discussion or information.

transitfaresbus-stopsridershipcity-council-updatescolumbia-mo
City Hall Conference Room 1/C 701 E. Broadway Columbia, MO.
Mon Oct 20, 2025 · 10:00 AM

Loan and Grant Committee

Committee reviews grant guidelines and moves to closed session on welfare cases

The Loan and Grant Committee will approve its agenda and the minutes from the June 18, 2025 meeting. It will review updates to the Community Development Block Grant (CDBG) and HOME program administrative guidelines. The committee will consider a motion to go into closed session under RSMo 610.021(8) concerning welfare cases of identifiable individuals.

loan-and-grantcdbghomeclosed-sessionwelfaremeeting-procedures
✓ Decided: Committee approves $20,000 program limit increase and other actions

The Loan and Grant Committee approved new administrative guidelines that raise the program limit from $15,000 to $20,000. The committee also approved the meeting agenda, the June 18, 2025 minutes, entered and exited a closed session, and adjourned the meeting. All motions passed with recorded vote tallies ranging from 3‑0 to 4‑0.

🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 yea · 2 present
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo present · Matthew Meyer present
TMP-31538 — Approved a Motion
3 yea · 2 present
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo present · Matthew Meyer present
TMP-31539 — Approved a Motion
3 yea · 2 present
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo present · Matthew Meyer present
TMP-31540 — Approved a Motion
7 yea · 3 present
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo present · Matthew Meyer present · Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer present
ADJOURNMENT — Approved a Motion
4 yea · 1 present
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer present
Mon Oct 20, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Columbia committee reviews budget and finance updates

The Finance Advisory and Audit Committee will discuss the annual budget document, legislation edits, and local tax collections. The meeting includes a review of quarterly cash balances and a public comment session.

financebudgetaudittaxescolumbia-mocity-hall
✓ Decided: FAAC approved agenda change, minutes, and adjourned the meeting

The Finance Advisory and Audit Committee voted to approve the revised agenda that removed the Local Sales, Use and AMJ Tax Collections item. The committee also approved the September 15, 2025 draft minutes. A motion to adjourn the meeting was then carried.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Oct 20, 2025 · 5:00 PM

City Council

Council reviews police review board applicant interviews and public hearing rules

The council will interview applicants for the Citizens Police Review Board. It will also review and update rules for public hearings and scheduled comments, as well as policies governing appointments to boards and commissions. No other items are on the agenda.

police-review-boardpublic-hearingscouncil-proceduresappointmentsgovernance
✓ Decided: Council agreed to remove smoking and ash‑tray sections from ordinances

The council voted to delete the smoking and ash‑tray provisions from the city ordinances. Members approved removing the fax number from the scheduled public‑comment form. They agreed to consider eliminating the rule that lets a council member add five minutes to a speaker’s time. The city manager will issue text alerts for emergency communications.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Oct 20, 2025 · 7:00 PM

City Council

Council to vote on final plat for Meadow Lane Plat 1 subdivision

The City Council will hold second-read votes on two items related to the Meadow Lane Plat 1 subdivision: a design adjustment to waive right-of-way dedication and sidewalk construction, and approval of the final plat. The consent agenda includes several short-term rental conditional use permits, a $50,000 budget amendment for parking structure painting, and agreements for the 2025 NCAA cross country championship and affordable housing. New business includes a temporary alcohol and amplified sound waiver for a Halloween event. Several ordinances are introduced for first reading, including one on pedestrian safety on major corridors and one for short-term rental monitoring services.

zoninghousingtransportationbudgetpedestrian-safetyshort-term-rentalsaffordable-housing
✓ Decided: Council approves Meadow Lane plat adjustments and short‑term rental permits

The City Council voted 4‑3 to adopt B256‑25, granting a design adjustment and right‑of‑way waiver for Meadow Lane, and B257‑25, approving the final plat for Meadow Lane. The consent agenda approved conditional use permits for short‑term rentals at 11 S. Heather Lane, 1501 Paris Road, and 103 Parkview Drive. The council also appointed new members to several boards and commissions.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
B256-25 — Passed
4 yea · 3 nay
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll nay · Jacquelyn Sample nay · Vera Elwood nay
B257-25 — Passed
4 yea · 3 nay
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll nay · Jacquelyn Sample nay · Vera Elwood nay
The other 14 items passed by unanimous or near-unanimous consent.
Fri Oct 17, 2025 · 8:00 AM

City Council

Columbia council meets with schools, chamber, and university

The Columbia City Council will convene with the Columbia Public Schools, Chamber of Commerce, Boone County, and the University of Missouri for joint updates. The meeting is scheduled for Friday, October 17, 2025, at 8:00 AM.

councilpublic-safetyeducationbusinessjoint-meeting
✓ Decided: Council meeting provided updates only, no formal actions taken

The council heard updates from Columbia Public Schools, the Chamber of Commerce, the Fire and Police Departments, Boone County, and the University of Missouri. No motions, approvals, or votes were recorded. The meeting adjourned at approximately 10:00 a.m.

Aslin Administration Building 1818 W. Worley St. Columbia, MO 65203
Thu Oct 16, 2025 · 6:30 PM

Parks and Recreation Commission

Public hearing on Rothwell Park improvements

The Parks and Recreation Commission will approve the agenda, minutes, and September monthly report. A staff presentation will be given, followed by a public hearing on Rothwell Park improvements. The commission will also receive reports on the Albert-Oakland Family Aquatic Center improvements, bicycle and pedestrian issues, capital projects, and recreation services.

parksrecreationpublic-hearingpark-improvementsaquatic-centerbicycle-pedestriancapital-projects
ARC Meeting Room 1701 W. Ash Columbia, MO 65201
Wed Oct 15, 2025 · 5:00 PM

Tree Board

Columbia Tree Board to discuss council letter and outreach

The Columbia Tree Board will meet to discuss a letter to the City Council, review recent and upcoming outreach opportunities, and receive an update from the city arborist. The meeting will also include public comments and the approval of agenda items for a future session.

tree-boardcolumbiaoutreacharboristpublic-commentscity-council
✓ Decided: Tree Board approved agenda and minutes, then adjourned

The board approved the meeting agenda and the minutes from the previous meeting. No substantive actions or policies were adopted. The meeting was then adjourned.

City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 2 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee yea · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
Wed Oct 15, 2025 · 4:15 PM

Food Council

Food Council to discuss training injector and vision statements

The Columbia Food Council will review updates from the OFBC and county representation, consider a training injector, and adopt new vision, mission, and goal statements. The council will also receive current events and food policy updates. Public comments are invited before adjourning.

foodcouncilpolicytrainingpublic-health
✓ Decided: Food Council unanimously approved the agenda, minutes and adjourned the meeting

The council approved the meeting agenda and the September 17 minutes, each by unanimous vote. Discussion of the vision, mission and goal statements was tabled until the next meeting. The meeting was then adjourned unanimously.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed Oct 15, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to discuss sidewalk master plan and pedestrian safety

The Bicycle and Pedestrian Commission will review reports on Vision Zero and pedestrian accidents. Members will discuss formalizing the Sidewalk Master Plan procedure and the Pedestrian Level of Comfort Map.

pedestrian-safetysidewalksvision-zeroinfrastructureroad-safety
✓ Decided: Commission approved agenda, minutes and adjourned the meeting

The Bicycle and Pedestrian Commission approved the meeting agenda. The commission also approved the minutes from the September 17, 2025 meeting. The meeting was then adjourned.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Tue Oct 14, 2025 · 6:00 PM

Youth Advisory Council

Youth Council to plan summit and discuss mission

The Youth Advisory Council will discuss planning alternatives for a Youth Summit and form work groups around three focus areas. They will also consider adopting a new mission statement for the council. Additionally, they will review the October newsletter and decide on the next meeting date, as the regular second Tuesday falls on Veterans Day.

youthcouncilmissionsummitplanningnewslettermeeting-date
✓ Decided: Youth Advisory Council approved its mission statement and adjourned

The council approved the meeting agenda and the prior meeting minutes. A motion to keep the Youth Advisory Council mission statement was carried. The meeting was then adjourned. The next meeting is scheduled for November 12, 2025.

701 E. Broadway Columbia, MO. 65201 Conference Room 1A/1B
Tue Oct 14, 2025 · 6:00 PM

Human Services Commission

Commission will move to closed session to discuss FY2026 Social Services RFP

The Human Services Commission will approve its agenda and the minutes from the August 12, 2025 meeting. It will receive a report from the Housing and Community Development Commission representative. The commission will consider a motion to enter closed session to review sealed bids and proposals for the FY2026 Social Services RFP. The meeting also includes standard public comments and scheduling of the next meeting.

human-servicesrfpclosed-sessionpublic-hearingsreports
Training Room 1 Columbia/Boone County Department of Public Health and Human Services 1005 W. Worley St.
Mon Oct 13, 2025 · 4:15 PM

Commission on Cultural Affairs

Commission on Cultural Affairs meeting canceled

The Commission on Cultural Affairs meeting scheduled for October 13, 2025, at City Hall has been canceled. The agenda included items such as the approval of minutes from September 8, 2025, and nominations for Chair, Vice-Chair, and Secretary.

cultural-affairscanceledcolumbia-mocolumbia-arts-fundpublic-artnominees
City Hall Council Chambers 701 E. Broadway Columbia, MO
Thu Oct 9, 2025 · 12:00 PM

Columbia Sports Commission

Columbia Sports Commission to discuss travel exchange and sales activities

This is a regular meeting of the Columbia Sports Commission. The agenda includes approval of previous minutes, a report on the October Sports Commission activities, and planning for the Missouri Sports Travel Exchange tradeshow. Also listed are sports sales activities. No major policy decisions or votes are scheduled.

sports-commissiontourismeventsmeetingprocedural
✓ Decided: Commission approved agenda and minutes, then adjourned the meeting

The Columbia Sports Commission approved the meeting agenda and the August 2025 meeting minutes. All members voted to adjourn the meeting at 12:30 PM. No other business was discussed.

Columbia Sports Fieldhouse Meeting Room 4251 4251 Philips Farm Rd. Columbia, MO.
Thu Oct 9, 2025 · 5:30 PM

Board of Health

Board of Health to discuss meeting frequency and pre-council prep

The Board of Health will discuss preparations for a pre-Council meeting on November 3, 2025, and consider changing the board's meeting frequency. The director will give a routine report. No votes or financial items are on the agenda.

board-of-healthpublic-healthmeeting-frequencycouncil-preparation
✓ Decided: Board moves pre‑council meeting to Dec 1 and tables meeting‑frequency discussion

The Board of Health unanimously approved the agenda and the meeting minutes. It voted to change the pre‑council meeting date to December 1, 2025. The board tabled further discussion on meeting frequency and postponed a meeting with the legal department to a later date. The meeting was adjourned at 6:01 p.m.

Columbia/Boone County Public Health & Human Services Training Room 1 1005 W. Worley St Columbia, MO.
Thu Oct 9, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission discusses transit, ADA grievance form, and accessibility awards

The Disabilities Commission will discuss public transit and paratransit services, the Office of Neighborhood Services, and an update on the DawnZ Award. The body will also review a revised ADA grievance complaint form.

disabilitiestransitadapublic-safetyaccessibilitycolumbia-mo
✓ Decided: Commission tables revised ADA grievance complaint form for next meeting

The commission approved the meeting agenda and the amended September 11, 2025 minutes, each with unanimous support. Two items— the revised ADA grievance complaint form and the DawnZ Award update— were tabled for discussion at the next meeting. The meeting was adjourned by unanimous vote.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
13 yea · 1 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
TMP-31463 — Approved a Motion
13 yea · 1 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
ADJOURNMENT — Approved a Motion
13 yea · 1 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea · Ken Rice yea · Koda Inman-Ahlstrom yea
Thu Oct 9, 2025 · 5:30 PM

Planning and Zoning Commission

Commission will hold elections for Planning Commission officers.

The Planning and Zoning Commission will conduct elections for its officers. It will also review and discuss proposed revisions to the Small Lots Article 5 subdivision regulations and Appendix A. The agenda and prior meeting minutes will be approved, and the next meeting date set.

electionszoningsubdivisionsplanningmeeting
✓ Decided: Commission elected new officers and tasked staff with drafting small‑lot revisions

The agenda and the September 18 minutes were approved by the commission. Commissioners elected Geuea Jones as Chairman and Stanton as Vice‑Chairman unanimously, and Brodsky as Secretary by a 6‑3 vote. The commission directed staff to prepare draft revisions to Article 5 and Appendix A to create standards for small‑lot development, including front‑yard encroachment and alley width options.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31419 — Approved a Motion
7 present · 2 abstain
Anthony Stanton present · Sharon Geuea Jones present · Shannon Wilson present · Robert Walters abstain · McKenzie Ortiz abstain · David Brodsky present · Les Gray present · Kate Stockton present · Cody Darr present
ADJOURNMENT — Approved a Motion
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Oct 9, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to decide on 63-acre industrial rezoning and 6 short-term rental permits

The Planning and Zoning Commission will hold public hearings on a request to rezone 63.11 acres from Agriculture (A) to Industrial (IG) at 3815 Hinkson Creek Road, northeast of the Highway 63 and Paris Road interchange. They will also consider six short-term rental conditional use permits for properties on South West Boulevard, St. Michael Drive, East Ash Street, North Ninth Street, Forum Boulevard, and a withdrawn item for 1201 S. Old Highway 63. The meeting also includes approval of minutes and public comments.

planningzoningshort-term-rentalsrezoningagricultureindustrialpublic-hearingscolumbia
✓ Decided: Commission unanimously approves agenda and adopts prior meeting minutes

The Planning and Zoning Commission approved the meeting agenda by unanimous thumb‑up vote. The September 18, 2025 minutes were adopted with six votes in favor and three abstentions. A short‑term rental request (Case #308‑2025) was recorded as withdrawn, and a new short‑term rental application (Case #295‑2025) was heard, but no vote on it was taken.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
TMP-31427 — Approved a Motion
8 yea · 1 nay
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz nay · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31424 — Approved a Motion
7 yea · 2 nay
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson nay · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton nay · Cody Darr yea
The other 6 items passed by unanimous or near-unanimous consent.
Wed Oct 8, 2025 · 3:00 PM

Parking Advisory Commission

Parking Commission to review project updates and public comments

The Parking Advisory Commission will meet to approve the agenda and minutes, review staff updates on four parking projects, and hear general public comments. The meeting is scheduled for 3:00 PM at City Hall.

parkingcity-hallpublic-commentsproject-updatesagenda
City Hall 701 E. Broadway Room 1A/1B
Wed Oct 8, 2025 · 6:00 PM

Citizens Police Review Board

Office of Violence Prevention annual report for 2025 presented

The board will hear the 2025 annual report from the Office of Violence Prevention Administrator and a report on human rights. They will also consider approving previous meeting minutes and the agenda. A motion to enter closed session to discuss protected records is scheduled.

citizens-police-review-boardcolumbia-mopolice-oversightviolence-preventionhuman-rightsclosed-session
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Oct 8, 2025 · 8:00 AM

Water and Light Advisory Board

Board to review draft Water Irrigation Ordinance

The Water and Light Advisory Board will review financial reports for August 2025, hear a director's report introducing a draft Water Irrigation Ordinance, and discuss a monthly Power Cost Adjustment report. The board will also consider its annual report to council and set goals for 2025/2026.

waterelectricirrigation-ordinancepower-cost-adjustmentadvisory-boardcolumbia-missouri
✓ Decided: Board unanimously approved the meeting agenda and prior minutes

The Water and Light Advisory Board approved the agenda as submitted with a unanimous vote. The September 10, 2025 meeting minutes were also approved unanimously. The board then adjourned the meeting by unanimous consent.

701 E Broadway Columbia, MO Conference Room 1A/1B
Tue Oct 7, 2025 · 5:30 PM

Commission on Human Rights

Commission to review proposed code changes and budget

The Commission on Human Rights will review proposed changes to Chapter 12-57 of the Code of Ordinances and receive a budget update. The meeting will also include a review of HREP proposals and a Missouri Human Rights Commission outreach event scheduled for March 2026.

human-rightsbudgetcode-ordinancespublic-hearingoutreachclosed-session
✓ Decided: FY26 budget approved by commission recommendation

The commission approved the FY26 budget based on its recommendation. Several funding requests were approved, including $100 for National History Day and $500 for Hickman High's Tibetan Culture program. The commission also reappointed Stephanie Yoakum as liaison for 2025‑2026 and approved both draft and closed meeting minutes from September 2, 2025.

Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-31364 — Approved a Motion
5 yea · 2 abstain
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum abstain · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird abstain
Tue Oct 7, 2025 · 5:30 PM

Historic Preservation Commission

Commission to review demolition permit for 1017 E. Brown School Road

The Historic Preservation Commission will consider a demolition permit application and conduct officer elections. The body will also review the Columbia Preservation Plan and updates regarding the Benton-Stephens Phase I Survey RFP.

historic-preservationdemolitionplanningcity-government
✓ Decided: Historic Preservation Commission approved new officers and closed a demolition permit

The commission unanimously approved the slate of officers (Chair Stephen Bybee, Vice‑Chair Carrie Gartner, Secretary Josh Parshall). The meeting agenda and the September meeting minutes were also approved by unanimous voice vote. Commissioners voted to close review of the demolition permit application for 1017 E. Brown School Road. The meeting was then adjourned.

Conference Room 1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall absent · Jennifer Luchau present
APPROVAL OF MINUTES — Approved a Motion
4 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall absent · Jennifer Luchau present
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
4 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall absent · Jennifer Luchau present
OFFICER ELECTIONS — Approved a Motion
4 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall absent · Jennifer Luchau present
Mon Oct 6, 2025 · 5:00 PM

City Council

Council votes on closed session to discuss pending litigation

The City Council will discuss the draft strategic plan, including a request for proposals and a process chart. It will consider a motion to enter a closed session to review legal actions and privileged communications under Missouri law. The agenda also provides a public notice of upcoming meeting dates.

strategic-planlitigationclosed-sessioncouncilmeetings
✓ Decided: Council approved closed‑session meeting to discuss legal matters

Mayor Buffaloe moved, and Council Member Peters seconded, a motion for the City Council to go into closed session to discuss legal actions and privileged communications. The council entered closed session at 5:53 p.m. The council also confirmed upcoming work‑session dates: October 13, 4 pm‑6 pm for TIF work and November 10, 9 am‑11 am for the Transit Study.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Oct 6, 2025 · 7:00 PM

City Council

Council will consider building the Albert-Oakland Family Aquatic Center.

The Columbia City Council will discuss a range of items including the swearing‑in of new department directors, several public hearings on sidewalk and aquatic center projects, and multiple annexations and conditional‑use permits. The agenda also contains budget amendments, contract authorizations for employee benefits, and approvals for various infrastructure improvements. All items will be voted on or moved forward as indicated in the agenda.

infrastructurebudgetpublic-hearingcontractszoninghousingrecreation
✓ Decided: Council approves sidewalk improvement on West Broadway

The City Council approved the construction of a sidewalk improvement project along the south side of West Broadway between Maplewood Drive and West Boulevard. The council also approved the Albert‑Oakland Family Aquatic Center improvement project and amended the 2026 legislative priorities to require reporting lost or stolen guns within 72 hours. Swearing‑in ceremonies were held for the new Director of Community Development and the Director of Housing and Neighborhood Services.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B243-25 — Passed
4 yea · 2 nay · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman absent · Betsy Peters yea · Valerie Carroll nay · Jacquelyn Sample yea · Vera Elwood nay
The other 19 items passed by unanimous or near-unanimous consent.
Thu Oct 2, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council discusses mini-grants, awards, and Winter Well-Being Expo planning

The Mayor's Council on Physical Fitness and Health will discuss promoting mini-grants, planning the Mayor’s Council awards set for April 15, 2026, and organizing the Winter Well-Being Expo on February 21, 2026. The meeting also includes approval of previous minutes, a treasurer's report, and public comments.

physical-fitnesshealthmini-grantseventscommunity-wellness
ARC Meeting Room 1701 W. Ash
Mon Sep 29, 2025 · 4:00 PM

City Council

Council votes to enter closed session to discuss personnel matters

The City Council will consider a motion to move into a closed session. The closed session would be used to discuss hiring, firing, disciplining, promoting, and individually identifiable personnel records of employees or applicants, as referenced in RSMo sections 610.021(3) and 610.021(13). The motion is listed as an open item for public comment before the session is closed.

personnelemploymentprivacyclosed-sessioncity-council
✓ Decided: Council voted unanimously to enter closed session

Mayor Barbara Buffaloe moved that the council go into a closed session to discuss personnel matters under RSMo §§610.021(3) and (13). The motion was seconded by Council Member Don Waterman and approved unanimously by all seven members. The council then entered closed session in Conference Room 1A/1B, which adjourned at 6:09 p.m.

City Hall Conference Room 1C 701 E. Broadway Columbia, MO
Mon Sep 29, 2025 · 12:00 PM

Convention and Visitors Advisory Board

CVAB receives staff and commission reports, no new business

The Convention and Visitors Advisory Board meeting is primarily procedural: approval of minutes and receipt of updates from staff, The District, and the Boone County Commission. No old or new business is on the agenda.

tourismconventionvisitorsreportsadvisory-boardminutes
✓ Decided: Board approved agenda and minutes at September 29 meeting

The Convention and Visitors Advisory Board approved the meeting agenda and the prior meeting minutes, each by motion and second with the motions passing. No other business was acted upon. The next board meeting was scheduled for November 24, 2025.

300 S. Providence Road - Thomas G. Walton Building
Tue Sep 23, 2025 · 6:00 PM

Climate and Environment Commission

Columbia commission discusses bird program and trail proposal

The Climate and Environment Commission will review the Missouri Bird City Program and a proposal for the Gans Creek Trail. The body will also discuss its 2025 priorities and the status of Bird City certification.

environmentclimatetrailbirdscommissioncity-hall
City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
TMP-31323 — Approved a Motion
12 yea · 3 present
Linda Godwin yea · Leanne Tippett Mosby present · Abra Spisso yea · Emily Gustafson yea · David Huhman present · Alexis Hall yea · Richard Shanker yea · Eric Kvam yea · Andrew Sell yea · Kira Smith yea · Abby Dickinson yea · Nathan Elwood present · Cherylyn Kelley yea · Morgan Wozniak yea · Eileen Avery yea
APPROVAL OF AGENDA — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
APPROVAL OF MINUTES — Approved a Motion
12 yea · 3 present
Linda Godwin yea · Leanne Tippett Mosby present · Abra Spisso yea · Emily Gustafson yea · David Huhman present · Alexis Hall yea · Richard Shanker yea · Eric Kvam yea · Andrew Sell yea · Kira Smith yea · Abby Dickinson yea · Nathan Elwood present · Cherylyn Kelley yea · Morgan Wozniak yea · Eileen Avery yea
ADJOURNMENT — Approved a Motion
12 yea · 3 present
Linda Godwin yea · Leanne Tippett Mosby present · Abra Spisso yea · Emily Gustafson yea · David Huhman present · Alexis Hall yea · Richard Shanker yea · Eric Kvam yea · Andrew Sell yea · Kira Smith yea · Abby Dickinson yea · Nathan Elwood present · Cherylyn Kelley yea · Morgan Wozniak yea · Eileen Avery yea
Mon Sep 22, 2025 · 1:00 PM

Office of Violence Prevention Advisory Committee

Committee to discuss BlkHandSide proposition, GIS stressor maps, and violence data

The Office of Violence Prevention Advisory Committee will consider responses to The BlkHandSide Collective proposition, discuss the NACo Fall 2025 Youth Justice Peer Exchange, and review Community Mental Health trainings. New business includes a presentation on GIS and stressor maps for community locators and a report on the Near East Neighborhood Opportunity & Community Accountability (NOCAP). Reports on the Office of Violence Prevention Dashboard and the Bullet Related Injury Clinic (BRIC) will also be presented.

violence-preventioncommunity-safetyyouth-justicemental-healthgisdata-dashboardpublic-health
✓ Decided: Committee approved the meeting agenda

The committee approved the agenda as presented and approved the August meeting minutes. No other substantive actions were taken. The meeting was adjourned at 2:31 pm.

City Hall 2nd Floor Conference Room 2A 701 E. Broadway Columbia, MO 65201
Thu Sep 18, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss small lot subdivision regulations

The Planning and Zoning Commission will hold a work session to discuss revisions to Article 5 (Subdivisions) and Appendix A regarding small lots. No other substantive business is on the agenda.

planningzoningsubdivisionssmall-lotscode-revisions
✓ Decided: Commission discussed small‑lot Appendix A revisions, no decisions made

The commission approved the agenda and the September 4 minutes unanimously. The meeting focused on discussing possible revisions to Appendix A for small‑lot subdivisions, including reduced right‑of‑way, utility easement relocation, and consistency issues. No formal actions, approvals, or denials were taken on any proposal.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
6 yea · 3 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31307 — Approved a Motion
5 yea · 3 present · 1 abstain
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky abstain · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
6 yea · 3 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Sep 18, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to hold hearings on drive-up facility and short-term rental

The Planning and Zoning Commission will hold public hearings on three items: a final plat for an industrial property with a sidewalk design adjustment, a conditional use permit for a drive-up facility at 310 Nifong Boulevard, and a conditional use permit for a short-term rental at 1506 Windsor Street. The commission will also consider approval of previous meeting minutes.

planningzoningpublic-hearingconditional-use-permitshort-term-rentaldrive-up-facilityindustrial-platsidewalk-waiver
✓ Decided: Commission approved a banking center drive‑through conditional use permit

The Planning and Zoning Commission unanimously approved its agenda and the September 4 minutes. It voted 6‑0 to table the 1500 North Seventh Street final plat until October 23, 2025. It also voted 6‑0 to approve the conditional use permit for a banking center drive‑through at 310 West Nifong Boulevard in the M‑N zoning district.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
6 yea · 3 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31308 — Approved a Motion
5 yea · 3 present · 1 abstain
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky abstain · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31311 — Approved a Motion
6 yea · 3 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31312 — Approved a Motion
6 yea · 3 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31313 — Approved a Motion
6 yea · 3 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
9 present
Anthony Stanton present · Sharon Geuea Jones present · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky present · Les Gray present · Kate Stockton present · Cody Darr present
Thu Sep 18, 2025 · 6:30 PM

Parks and Recreation Commission

Parks Commission meets to approve minutes and reports

The Parks and Recreation Commission will convene to approve the August 2025 minutes, a monthly report, and agenda items. The meeting includes updates on the CoMoGives campaign and reports from the Bicycle and Pedestrian and Capital Project commissions.

parksrecreationminutesreportsco-mo-givesbicyclecapital-projects
ARC Meeting Room 1701 W. Ash
Wed Sep 17, 2025 · 5:00 PM

Tree Board

Tree Board to discuss FY25 purchases and council letter

The Tree Board will discuss purchases for the end of fiscal year 2025 and a letter to the City Council. The board will also review upcoming outreach and educational opportunities.

tree-boardbudgetcouncilarboristpublic-comment
✓ Decided: Board approved training, membership, gift card purchases and set a Sep 28 work day

The Tree Board approved using budget funds to register Wright and Kyd for professional development training, to grant Bybee a professional membership with the Urban and Community Forestry Society, and to buy a Pizza Tree gift card. The board also approved holding a work day on September 28 from 9 a.m. to noon. All motions passed unanimously.

City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 1 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
5 yea · 1 present · 1 abstain
Michael Kyd present · Jacob McMains yea · Samuel Wright abstain · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
TREE BOARD BUDGET — Approved a Motion
21 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea · Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea · Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
WORK CALENDAR — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed Sep 17, 2025 · 4:15 PM

Food Council

Food Council to discuss vision, mission, goals and CHIP involvement

The Food Council will consider updates to its vision, mission, and goal statements, as well as a statement on CHIP involvement. Old business includes updates on the OFBC and county representation. The meeting also includes public comments and discussion of current food policy events.

food-policypublic-healthcouncilcolumbia-missouricity-government
✓ Decided: Food Council unanimously approved agenda, minutes and then adjourned

The council approved the meeting agenda with a unanimous vote. It also approved the August 20 meeting minutes unanimously. The meeting was then adjourned by unanimous consent. No substantive policy decisions were made.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed Sep 17, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to discuss Pedestrian Level of Comfort Map and Sidewalk Master Plan

The Bicycle and Pedestrian Commission will review updates to the Pedestrian Level of Comfort Map and its associated procedures. The body will also discuss formalizing the procedure for the Sidewalk Master Plan.

pedestrian-safetysidewalksurban-planningvision-zero
✓ Decided: Commission approved agenda and minutes, and assigned updates to the Sidewalk Master Plan

The commission voted to approve the meeting agenda. It also approved the prior meeting minutes. The committee agreed that Carol Elliott will revise the Sidewalk Master Plan narrative and Chris Halsey will update its flowchart. The meeting was adjourned after a motion to adjourn passed.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Tue Sep 16, 2025 · 5:30 PM

Public Transit Advisory Commission

Public Transit Advisory Commission meets to review ridership and transit study

The Public Transit Advisory Commission will meet to approve previous meeting minutes, review ridership data, and receive a presentation on the Go COMO Comprehensive Transit Study.

transitpublic-transportcolumbiaadvisory-commissionridershipvision-zero
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Sep 15, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Committee to discuss FY26 budget and risk management

The Finance Advisory and Audit Committee will review the FY26 budget, discuss edits to its establishing legislation, and review risk management and purchasing ordinance updates.

financebudgetauditrisk-managementlegislation
✓ Decided: FAAC approved agenda, minutes and sent mission statement to Council

The Finance Advisory and Audit Committee approved its meeting agenda and the August 18, 2025 minutes. Members also approved a motion to forward the revised mission statement to the City Council. The meeting was then adjourned.

City Hall Council Chambers 701 E. Broadway Columbia, MO.
Mon Sep 15, 2025 · 6:15 PM

City Council

City Council to hold pre-council meeting and closed session

The City Council is meeting for a pre-council session. The agenda includes a motion to enter a closed session to discuss sealed bids and proposals.

city-councilclosed-sessionprocurement
✓ Decided: Council entered closed session to discuss sealed bids and proposals

Mayor Buffaloe moved to place the council in closed session to review sealed bids and related contract documents, and Council Member Foster seconded the motion. The council complied and entered a closed meeting in Conference Room 1A/1B, as authorized by RSMo Section 610.021(12). No other actions were taken.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-31269 — Approved a Motion
7 present
Barbara Buffaloe present · Nick Foster present · Don Waterman present · Betsy Peters present · Valerie Carroll present · Jacquelyn Sample present · Vera Elwood present
Mon Sep 15, 2025 · 7:00 PM

City Council

Council to adopt FY2026 budget, vote on parking meter rates, and two annexations

The City Council will vote on the FY2026 budget, continued from the September 2 meeting, and consider amendments to parking meter rates. Public hearings will be held on two voluntary annexations: one at 7098 I-70 Drive SE and one at the northwest corner of Clark Lane and Lakewood Drive. The consent agenda includes approvals for short-term rental permits, sidewalk projects, and a collective bargaining agreement with the police officers' union.

budgetannexationparkingshort-term-rentalpublic-safetyparks
✓ Decided: City Council adopted FY 2026 budget and passed several key ordinances

The council approved the FY 2026 city budget after correcting amendment numbers, and enacted amendments to parking meter rates, closed records, and a $21,000 contract for trauma‑informed mental‑health training. Council members also appointed fifteen individuals to various boards and commissions. All listed actions were approved unanimously with votes from Peters, Buffaloe, Carroll, Elwood, Sample, Foster, and Waterman.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (19 roll-call votes)
Named votes as recorded in the official record.
B237-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B232-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B231-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B233-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B238-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B241-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B235-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B234-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B239-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B236-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B240-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R133-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster absent · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R131-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R130-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R129-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B205-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B218-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
R132-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B183-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
Fri Sep 12, 2025 · 9:30 AM

Police Retirement Board

Police Retirement Board to review financial reports and minutes

The Police Retirement Board will meet to approve minutes from previous meetings and review financial reports including the Retire Register and DROP accounts. No specific policy changes or contracts are scheduled for discussion.

policeretirementfinanceboard-meeting
Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Fri Sep 12, 2025 · 8:30 AM

Investment Committee

Investment Committee to hear Ares, KKR presentations and discuss asset reallocation

The Investment Committee will hear presentations from investment firms Ares and KKR, review the quarterly economic and investment report, and discuss potential asset reallocation and a short fixed manager search. No votes are scheduled; the meeting is informational.

financeinvestmentspensioncity-fundsasset-management
✓ Decided: Committee approves Ares, KKR portfolio additions and fund reallocations

The Investment Committee unanimously approved adding both Ares and KKR to the city's investment portfolio. It also approved trimming and reallocating funds for the Short Fixed Manager Search and terminating the MetLife contract in favor of Sage. All motions passed without dissent.

Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Fri Sep 12, 2025 · 8:00 AM

Firefighters' Retirement Board

Firefighters' Retirement Board to review pension fund financial reports

The Firefighters' Retirement Board will meet to approve minutes from previous meetings and review routine financial reports, including the retire register, DROP summary, and revenue/expenses. No old business is scheduled, and public comments are invited. The meeting is largely procedural.

firefightersretirementpensionfinancecity-governmentcolumbia
✓ Decided: Board unanimously approved agenda and prior meeting minutes

The Firefighters' Retirement Board approved the meeting agenda by a unanimous vote. The board also approved the draft minutes from December 13, 2024, and June 13, 2025, again unanimously. No other actions were taken.

Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Thu Sep 11, 2025 · 5:30 PM

Board of Health

Board to review accepted changes to Chapter 5 (Animals and Fowl)

The Board of Health will review accepted changes to Chapter 5 of the city code, covering animals and fowl. They will also hear the Director's Report from Rebecca Roesslet. The meeting includes approval of the agenda and minutes from August 14, 2025, and public comment.

board-of-healthanimalspublic-healthcode-changes
✓ Decided: Board approved language changes to Chapter 5 animals ordinance unanimously

The Board of Health unanimously approved all suggested language changes to Chapter 5 of the Animals and Fowl ordinance. The board also decided there will be no Board of Health meeting in November and will meet with legal in October to discuss public statements. Agenda and minutes were each approved unanimously.

Columbia/Boone County Public Health & Human Services Training Room 1 1005 W. Worley St Columbia, MO.
Thu Sep 11, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission to hear mobility updates and ADA role discussion

The Disabilities Commission will hear presentations from Local Motion CEO Mike Burden on mobility status and advocacy, and Assistant City Counselor Adam Kruse on the ADA Coordinator's role and duties. They will also discuss a revised ADA grievance complaint and receive reports from working groups. The meeting is largely informational and discussion-based with no formal decisions scheduled.

disabilitiesmobilityadacity-governmentpublic-meeting
✓ Decided: Commission approved sending a support letter to Parks Dept for youth wheelchair basketball

The Disabilities Commission approved its agenda and the August 14 and June 12, 2025 meeting minutes, each by unanimous consent. Members discussed a revised ADA grievance form but took no action. The commission voted to send a letter to the Parks and Recreation Department supporting a youth wheelchair basketball program.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
10 yea · 2 present
Hazel Fields yea · Rene Powell yea · Ann Marie Gortmaker present · John Bowders present · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea
TMP-31285 — Approved a Motion
10 yea · 2 present
Hazel Fields yea · Rene Powell yea · Ann Marie Gortmaker present · John Bowders present · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins yea · Marlee Walz yea
Wed Sep 10, 2025 · 8:30 AM

Airport Advisory Board

Airport board to discuss sealed bids in closed session

The Airport Advisory Board meeting consists largely of procedural items with no new business or minutes to approve. The only substantive action is a motion to enter closed session to discuss sealed bids and contract proposals, as permitted by state law.

airportboardclosed-sessionbidsproposals
Columbia Regional Airport Conference Room 11350 S Airport Drive Columbia MO
Wed Sep 10, 2025 · 6:00 PM

Citizens Police Review Board

Board to follow up on 'Wrong House' case, discuss history and legal limits

The Citizens Police Review Board will hear updates on the 'Wrong House' follow-up and a report to the City Council. New business includes a discussion of the board's history, purpose, and legal considerations under state law and city code. The board also plans to move into closed session to discuss records exempt from disclosure.

citizens-police-review-boardpolice-oversightclosed-sessioncolumbia-mowrong-house-case
✓ Decided: Board unanimously approved agenda and minutes, set Oct 8 meeting

The Citizens Police Review Board approved the meeting agenda and the draft minutes from the August 13, 2025 session, each by unanimous vote. The board scheduled its next meeting for October 8, 2025. The meeting was adjourned at 7:18 p.m. after a unanimous motion.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Sep 10, 2025 · 8:00 AM

Water and Light Advisory Board

Water and Light Board to discuss Integrated Resource Plan scope

The Water and Light Advisory Board will review the Integrated Resource Plan (IRP) scope of services under Task Order 5, along with monthly financial reports, power cost adjustment reports, and council updates. The board will also discuss public input meetings, annual goals, and an advisory board report to council.

waterelectricutilityadvisory-boardintegrated-resource-planpower-cost-adjustmentpublic-input
✓ Decided: Board unanimously endorsed Task Order 5 and added a storage recommendation

The board approved the meeting agenda and the August 13, 2025 minutes, both unanimously. It endorsed Task Force Order 5 for the Integrated Resource Plan and added a recommendation that the Energy Authority examine storage options, also unanimously. The board set the public input meeting for October 29, 2025, and scheduled the next advisory board meeting for October 8, 2025. All motions passed unanimously.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Sep 10, 2025 · 3:00 PM

Parking Advisory Commission

Parking Advisory Commission continues budget discussion and revenue review

The commission will review revenue matters from old business and continue discussion of the city’s parking budget. Standard agenda items such as call to order, introductions, approval of agenda and minutes, and a public comments period are also scheduled. The next meeting is set for October 8, 2025 at 3:00 pm.

budgetfinancepublic-commentsmeetingsparking
Room 1A/1B City Hall 701 E. Broadway
Wed Sep 10, 2025 · 6:30 PM

Community Land Trust Organization Board

CCLT Board to discuss strategic plan and legal matters

The Community Land Trust Organization Board will approve past meeting minutes and financial statements, discuss a strategic plan, and consider entering a closed session for legal and real estate matters.

columbiacommunity-land-trustboard-meetingfinancestrategic-planlegalpublic-meeting
✓ Decided: Board entered closed session to discuss legal actions and real-estate matters

The board approved its agenda and the August 6, 2025 minutes unanimously. It accepted the treasurer’s report, which showed a balance of $87,500. The board voted to go into a closed session to discuss legal actions, privileged communications, and real‑estate transactions, then voted to return to open session. The meeting was adjourned after these procedural votes.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 5 yea
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea
TMP-31262 — Approved a Motion
5 present · 5 yea
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea
TMP-31263 — Approved a Motion
5 present · 5 yea
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea
TMP-31270 — Approved a Motion
6 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea
ADJOURNMENT — Approved a Motion
5 present · 5 yea
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
Tue Sep 9, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council reviews summit recap and elects officers

The council will approve the meeting agenda and the minutes from the May 13, 2025 meeting. It will discuss a recap of the recent Youth Summit and the council’s annual report. New business includes a presentation on the Sunshine Law, election of officers, and setting three focus areas for the year.

youth-advisorycouncilsunshine-lawelectionsmeetings
✓ Decided: Youth Advisory Council elects new officers and adopts focus areas

The council approved its agenda and the May 13, 2025 minutes. Members elected Grace Harris as Chair, Ahlam Alamin as Vice Chair, and Aanya Shetty as Secretary. The council unanimously approved three focus areas: Sustainability, Wellness, and Youth Safety/Security. The meeting was then adjourned.

701 E. Broadway Columbia, MO. 65201 Conference Room 1A/1B
Mon Sep 8, 2025 · 4:15 PM

Commission on Cultural Affairs

Cultural Affairs Commission to review funding and public art

The Commission on Cultural Affairs will approve minutes from July 14, 2025, and review applications for small requests. The agenda includes updates on the Columbia Arts Fund, the Celebration of the Arts, and the status of FY25 and FY26 funding.

cultural-affairsartsfundingpublic-artcolumbia-mo
✓ Decided: Commission approved three $500 small requests for arts projects

The Commission on Cultural Affairs approved three $500 small requests: North Village Arts District, Columbia Gadget Works, and Columbia Art League. The vacancy on the Commission will be advertised in late September with applications due Oct. 3 and appointments on Oct. 20. All motions were carried without recorded vote counts.

City Hall Council Chambers 701 E. Broadway Columbia, MO
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 3 present
Kristin Gadsden yea · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea
TMP-31217 — Approved a Motion
22 yea · 9 present · 2 abstain
Kristin Gadsden yea · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Kristin Gadsden yea · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea · Kristin Gadsden yea · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson abstain · Kathleen Murphy present · Kate Nolte abstain · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea
TMP-31225 — Approved a Motion
8 yea · 3 present
Kristin Gadsden yea · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea
ADJOURNMENT — Approved a Motion
8 yea · 3 present
Kristin Gadsden yea · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart yea · Jennifer Jennings yea · Spencer Thompson yea
Thu Sep 4, 2025 · 7:00 PM

Planning and Zoning Commission

Commission will consider rezoning Ashford Place for 77 new homes

The Planning and Zoning Commission will hold public hearings on four items. They will review a site‑specific Planned District (PD) plan for the 24.13‑acre Ashford Place development, which proposes 77 single‑family attached units. They will also consider three short‑term rental (STR) applications for properties at 11 S. Heather Lane, 1501 Paris Road, and 103 Parkview Drive, each requesting up to 210 nights per year. The commission will discuss these proposals and take any necessary actions.

zoningdevelopmentshort-term-rentalshousingplanning
✓ Decided: Commission unanimously approves agenda and minutes

The Planning and Zoning Commission approved the meeting agenda by unanimous thumb vote. The August 7 and August 21 regular‑meeting minutes were each approved with a 7‑1 vote, one commissioner abstaining on each. No other substantive actions were decided during the session.

Council Chambers Columbia City Hall 701 E. Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-31182 — Approved a Motion
7 yea · 1 nay · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson nay · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present · Les Gray yea · Kate Stockton yea · Cody Darr yea
The other 6 items passed by unanimous or near-unanimous consent.
Thu Sep 4, 2025 · 5:30 PM

Planning and Zoning Commission

Commission reviews short‑term rental amendments and small‑lot subdivision changes

The Planning and Zoning Commission will review a staff report on 2025 short‑term rental (STR) amendment follow‑up. It will also discuss proposed revisions to the Small Lots subdivision provisions in Article 5. No other items are on the agenda.

zoninghousingplanningdevelopment
✓ Decided: Commission asked staff to draft shared‑access amendment for small‑lot subdivisions

The work session agenda was adopted unanimously and the August 21 minutes were approved with one abstention. Commissioners approved a revised correspondence letter to be submitted to the City Council. They directed staff to prepare language allowing shared driveway access for redevelopment/infill small lots and to revise the design‑adjustment criteria wording so both the Commission and Council must consider it. Staff will also seek fire‑code clarification for street standards and continue the small‑lot revisions at the next meeting.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31188 — Approved a Motion
7 yea · 1 abstain · 1 present
Anthony Stanton yea · Sharon Geuea Jones abstain · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Sep 4, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council reviews budget, mini-grants and event calendar

The Mayor's Council on Physical Fitness and Health will receive the treasurer's report on the remaining budget. Members will review pending mini‑grant applications and discuss the upcoming event calendar and marketing plans. The meeting will also include public comments and set the next meeting date for October 2, 2025.

budgetgrantseventspublic-commentsmeetings
ARC Meeting Room 1701 W. Ash
Wed Sep 3, 2025 · 3:00 PM

Mayor's Task Force on the U.S.S. Columbia

Discussion of Mayor's Reception and crew visit events.

The Mayor's Task Force will follow standard meeting procedures, approve the agenda and the minutes from July 29, 2025, and address old and new business. New business includes a Mayor's Reception and other crew visit events. The board will receive a report with updates on the U.S.S. Columbia submarine. No specific decisions are indicated in the agenda.

meetingadministrationeventsreportspublic-engagement
✓ Decided: Task Force approved agenda, minutes and adjourned the meeting

The task force voted to approve its meeting agenda and the minutes from the July 29, 2025 session. Both motions carried. The meeting was then adjourned at 3:15 p.m.

Walton Building Board Room 300 S. Providence Rd. Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 3 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross present · Becky Wischmeyer present · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
APPROVAL OF MINUTES — Approved a Motion
6 yea · 3 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross present · Becky Wischmeyer present · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
ADJOURNMENT — Approved a Motion
6 yea · 3 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross present · Becky Wischmeyer present · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
Wed Sep 3, 2025 · 5:30 PM

Historic Preservation Commission

Decision on demolition permit for 2000 Allen Lane

The Historic Preservation Commission will consider a demolition permit application for the property at 2000 Allen Lane. Staff will provide updates on FY 24 and FY 25 grant funding. The commission will review a proposed amendment to the Preservation Plan grant. A work session will be held to discuss the draft Preservation Plan.

historic-preservationdemolitiongrantsplan-review
✓ Decided: Commission approved $4,000 grant budget amendment for preservation plan

The Historic Preservation Commission unanimously approved the meeting agenda and the July meeting minutes. It closed the review of the demolition permit application for 2000 Allen Lane. The commission also unanimously approved an amendment to the preservation‑plan grant budget, allowing an additional $4,000 reimbursement for staff time. The next meeting is scheduled for October 7, 2025.

Conference Room 1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present
APPROVAL OF MINUTES — Approved a Motion
5 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
5 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present
TMP-31197 — Approved a Motion
5 present
Melissa Hagen present · Stephen Bybee present · Carrie Gartner present · Josh Parshall present · Jennifer Luchau present
Tue Sep 2, 2025 · 5:30 PM

Commission on Human Rights

Commission on Human Rights to discuss source of income protections and city code

The Commission on Human Rights will discuss recommended changes to Chapter 12 of the Code of Ordinances and updates to source of income protections due to HB 595. The body will also review public sanitary facilities and HREP proposals. A closed session is scheduled to discuss five pending cases.

human-rightscity-codehousing-protectionspublic-facilitieslegal-actions
✓ Decided: Commission unanimously approved a $200 request for the MidMo Pridefest HREP proposal

The Commission approved its agenda and the minutes from the August 5 meeting. It also approved the closed‑meeting minutes from that date and a $200 request for the MidMo Pridefest HREP proposal. The body decided not to pursue a letter to the Attorney General about DEI policies and entered a closed session before adjourning.

Conference Room 1C 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-31156 — Approved a Motion
4 yea · 3 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum yea · Paige Lubbering present · Penny Kuhns-Knarr yea · Liz Townsend Bird present
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
6 yea · 1 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird present
Tue Sep 2, 2025 · 6:00 PM

City Council

Council considers closed session to prep for employee‑group negotiations

The council will hear a presentation from the Columbia Police Lieutenants' Association. Council members will consider a motion to move into a closed session to discuss preparation for negotiations with employee groups as authorized by Section 610.021(9) of the Missouri Revised Statutes. If approved, the closed meeting will be held in Conference Room 1A/1B.

councilclosed-sessionlabor-relationspublic-presentationnegotiations
✓ Decided: Council voted to enter closed session to discuss employee‑group negotiations

Mayor Buffaloe moved to place the council in a closed meeting to discuss preparation for negotiations with employee groups, and Council Member Foster seconded the motion. The council entered a closed session in Conference Room 1A/1B at about 6:29 p.m. The closed meeting concluded at approximately 6:58 p.m. No vote tally was recorded in the minutes.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-31148 — Approved a Motion
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
Tue Sep 2, 2025 · 7:00 PM

City Council

Council continues FY 2026 budget hearing; electric rates, parking meters also up for vote

The council will continue the public hearing on the FY 2026 annual budget (continued from August 18) and consider a budget ordinance. Old business includes votes on electric utility rate changes, parking meter rate increases, and a one-year suspension of GoCOMO transit fares. The consent agenda features multiple zoning items, a police records management system contract with Tyler Technologies, and various agreements.

budgetutilitiestransportationpolicezoningpublic-hearingparkingtransit
✓ Decided: City Council unanimously approves electric utility rates amendment (B184-25)

The Council voted unanimously to adopt B184-25, amending Chapter 27 of the City Code on electric utility rates. Several sets of amendments to Exhibit A of the FY 2026 budget (B183-25) were also approved unanimously by voice vote. The full FY 2026 budget will be discussed and voted on at the September 15, 2025 meeting. Minutes from the August 18 meeting were approved unanimously.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (36 roll-call votes)
Named votes as recorded in the official record.
B184-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B227-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B212-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B211-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B210-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B208-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B213-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B214-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B209-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B226-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B225-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B215-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B219-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B220-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B221-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B222-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B223-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B228-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B224-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
B229-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea · Vera Elwood yea
Thu Aug 28, 2025 · 2:30 PM

Columbia Area Transportation Study Organization (CATSO)

Public hearings on FY 2026-2029 transportation plan and work program

The CATSO Coordinating Committee will hold public hearings on the proposed FY 2026-2029 Transportation Improvement Program (TIP) and the proposed FY 2026 Unified Planning Work Program (UPWP). The committee will also consider certification of the metropolitan planning process. These items determine federal transportation funding and planning priorities for the Columbia area.

transportationpublic-hearingplanningfederal-fundingtipupwp
✓ Decided: CATSO Coordinating Committee unanimously approves FY 2026‑29 Transportation Improvement Program

The committee approved the meeting agenda and the May 22 minutes by unanimous voice votes. Staff presented the FY 2026‑29 Transportation Improvement Program, which totals just over $617 million in capital projects and includes about $57 million in federal funding. The committee voted unanimously to adopt the TIP and will forward it for federal review.

Council Chamber City Hall 701 E. Broadway Columbia, Missouri
Wed Aug 27, 2025 · 3:00 PM

Airport Advisory Board

Airport board meets to approve minutes, hear reports

This meeting consists of routine business: approval of draft minutes from May and June 2025, reports from staff and members, and public comments. No new business or old business items are listed.

airportboardminutesprocedural
✓ Decided: Airport Advisory Board unanimously approved the meeting agenda

The board voted to approve the agenda with a unanimous vote. A motion was made to approve the May 28 and June 24, 2025 minutes, but the minutes do not record the outcome. No old or new business was taken up, and the board heard extensive reports on airline service, ongoing construction, parking, and other airport projects. The next meeting is scheduled for October 22, 2025.

Columbia Regional Airport Conference Room 11350 S Airport Drive Columbia MO
Mon Aug 25, 2025 · 10:00 AM

City of Columbia New Century Fund, Inc. Board

Board to consider ordinance and bylaw changes for New Century Fund

The New Century Fund Board will discuss proposed changes to City Ordinance Section 27-27 and amendments to the NCF Bylaws (version 230808). Public comments and general discussion will follow. The meeting is open to the public.

new-century-fundboard-meetingordinancebylawcolumbia-mo
City Hall Conference Room 1C 701 E. Broadway Columbia, MO 65201
Mon Aug 25, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Convention and Visitors Advisory Board to receive FY2026 budget update

The board will meet to discuss updates regarding the FY2026 City Budget. The meeting also includes staff reports from the CVB, The District, and the Boone County Commission.

budgettourismcity-government
✓ Decided: Board approved agenda and minutes

The Convention and Visitors Advisory Board approved the meeting agenda and the minutes from the July 28, 2025 meeting, each by motion and second with the motions passing. No other substantive actions or votes were recorded; the board received a FY2026 budget update and various reports.

Walton Building, 300 S. Providence Road
Thu Aug 21, 2025 · 10:30 AM

Office of Violence Prevention Advisory Committee

Committee to discuss RFQ for Community Navigation Liaison Program

The Office of Violence Prevention Advisory Committee will discuss a Request for Qualifications for the Community Navigation Liaison Program, an update on the National Institute for Criminal Justice Reform scope of work, and a report on the Cost of Gun Violence. New business includes the NACo Fall 2025 Youth Justice Peer Exchange and the Near East Neighborhood Opportunity & Community Accountability Procouncil (NOCAP) Report. The committee will also hear reports on communal collaborative efforts.

violence-preventioncommunity-navigationyouth-justicegun-violenceadvisory-committeecolumbia-mo
✓ Decided: Committee approved agenda and minutes, no substantive actions taken

The Violence Prevention Advisory Committee approved the meeting agenda and the prior meeting’s minutes. No other decisions, approvals, or votes were recorded; the committee discussed program updates, a youth‑justice peer exchange, and community partnership ideas.

The Reentry Opportunity Center (ROC) Community Conference Room 1621 Towne Dr, Suite G Columbia, MO 65202
Thu Aug 21, 2025 · 5:30 PM

Planning and Zoning Commission

Discussion of draft short‑term rental amendment memo and small‑lot subdivision revisions

The Planning and Zoning Commission will review a draft memo proposing revisions to short‑term rental regulations (PZC 2025 STR Revisions Memo, draft). The commission will also discuss proposed changes to the Small Lots subdivision provisions under Article 5. No formal decisions are indicated in the agenda.

short-term-rentalszoningsubdivisionsplanning
✓ Decided: Commission approves agenda, minutes and plans revised STR correspondence

The work‑session agenda was adopted unanimously. The August 7 minutes were approved with Commissioner Ortiz abstaining. Commissioners directed staff to revise the short‑term‑rental correspondence and present an updated draft at the next work session. The small‑lot subdivision revisions were not discussed due to time constraints.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones present · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-31088 — Approved a Motion
7 yea · 1 present · 1 abstain
Anthony Stanton yea · Sharon Geuea Jones present · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz abstain · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones present · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Aug 21, 2025 · 7:00 PM

Planning and Zoning Commission

Commission will consider rezoning and multiple short-term rental permits

The Planning and Zoning Commission will hold public hearings on four short-term rental conditional use permit requests and one rezoning request. The rezoning request (Case #265-2025) seeks to change 0.96 acre from Planned Development to R-1 to allow a single-family dwelling near Forum Boulevard and Old Plank Road. The short-term rental requests (Cases #262, #266, #267) propose allowing 6‑7 transient guests for up to 210 nights per year at 11 Club Court, 2613 Creasy Springs Road, and 3306 Belinda Court, all on R-1-zoned parcels. The agenda also includes standard introductions, approvals, and public comment periods.

zoningshort-term-rentalsrezoninghousingplanning
✓ Decided: Agenda approved unanimously after withdrawing short‑term rental case

The commission unanimously approved the agenda as amended, removing Case 267‑2025. The minutes from the August 7, 2025 meeting were approved with seven votes in favor and one abstention. A public hearing was held on Case 262‑2025 for a short‑term rental conditional use permit, but no decision was recorded in the minutes. No other substantive actions were taken.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-31091 — Approved a Motion
6 yea · 1 present · 1 abstain · 1 nay
Anthony Stanton yea · Sharon Geuea Jones present · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton abstain · Cody Darr nay
The other 5 items passed by unanimous or near-unanimous consent.
Thu Aug 21, 2025 · 6:30 PM

Parks and Recreation Commission

Public hearing on Albert-Oakland Aquatic Center improvements and FY2026 budget

The Parks and Recreation Commission will hold a public hearing on proposed improvements to the Albert-Oakland Family Aquatic Center. The commission will also review the FY2026 budget presentation and receive updates on the Cosmo-Bethel tennis renovations, bicycle and pedestrian projects, capital projects, and recreation services. Routine approvals of minutes and the monthly report are also on the agenda.

parksrecreationpublic-hearingbudgetaquatic-centertenniscapital-projects
ARC Meeting Room 1701 W. Ash
Wed Aug 20, 2025 · 5:00 PM

Tree Board

Board to review final draft of letter to council on City Tree Fund

The Tree Board will review a final draft letter to the city council regarding the City Tree Fund. They will also discuss upcoming outreach and educational opportunities, including scheduling a work day at the Garth Sexton tree preservation area. The city arborist will provide an update on the city's Emerald Ash Borer management plan.

tree-boardemerald-ash-borercity-tree-fundurban-forestryoutreach
✓ Decided: Board approved submitting tree fund letter to City Council for Sept. 15 agenda

The Tree Board approved its agenda and the minutes from the previous meeting. It approved the content of a letter to City Council and voted to submit that letter as a report for the September 15 council agenda. The board set a tentative work‑day date of September 28 at 10 a.m. for the Garth/Sexton tree preservation area and decided not to respond to an op‑ed about the emerald ash borer at this time. The next meeting is scheduled for September 17.

City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 2 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller present · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
CITY TREE FUND — Approved a Motion
12 yea · 2 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea · Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed Aug 20, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to formalize sidewalk master plan procedure

The Bicycle and Pedestrian Commission will consider formalizing the Sidewalk Master Plan Procedure and elect a secretary. Staff reports include updates on Vision Zero, Parks & Recreation, and Planning. No rezonings, contracts, or fee changes are on the agenda.

bicyclepedestriansidewalkmaster-planvision-zerotransportation
✓ Decided: Commission elects new secretary and advances sidewalk master plan

The Bicycle and Pedestrian Commission elected Chris Halsey as its new secretary. A motion passed to create a draft flowchart for the sidewalk master plan procedure. The Business Loop Grant was reinstated after being cancelled. The agenda and minutes for the meeting were also approved.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Aug 20, 2025 · 4:15 PM

Food Council

Columbia Food Council to review mission statements and public health updates

The Columbia Food Council will meet to approve minutes from July 2025 and discuss updates on the Office of Food and Beverage Compliance, county representation, and epinephrine access in schools.

food-councilpublic-healthminutespolicyepinephrineschool-safety
✓ Decided: Food Council approved agenda and minutes unanimously

The council unanimously approved the meeting agenda and the July 16, 2025 minutes. Members discussed updates on focus groups, county representation, epinephrine access, and funding challenges for local food programs, but no formal actions were taken. The next meeting is scheduled for September 17, 2025.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Aug 19, 2025 · 4:00 PM

City of Columbia New Century Fund, Inc. Board

New Century Fund Board to discuss ordinance and bylaw changes

The New Century Fund Board will consider approval of minutes, old business items including the Lang Award and Historic Preservation Donation, and new business involving changes to the city code (Sec. 27-27) and board bylaws. A treasurer's summary will also be presented.

new-century-fundboard-meetingordinance-changesbylawslang-awardhistoric-preservationtreasurer-report
City Hall Conference Room 1A 701 E. Broadway Columbia, MO 65201
Tue Aug 19, 2025 · 5:30 PM

Public Transit Advisory Commission

Public Transit Advisory Commission to review ridership and budget

The commission will discuss the city budget and collaboration with other commissions. Members will also receive updates on the Olsson Study and Google Maps, and review ridership data from July 2025.

public-transitbudgetridershiptransportation
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Aug 18, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Committee to discuss FY26 budget, parking rates, fee study, and purchasing ordinance changes

The Finance Advisory and Audit Committee will discuss the proposed Fiscal Year 2026 budget, including a presentation on budget details. They will also review a community trends manual, a parking rate study, a fee study, and proposed changes to the purchasing ordinance. No final decisions are expected; the committee's role is advisory.

budgetparkingfeespurchasingcommunity-trendsfinance
✓ Decided: FAAC approved agenda and minutes; no substantive decisions made

The Finance Advisory and Audit Committee unanimously approved the meeting agenda and the prior meeting minutes. Old business items such as the FY26 budget presentation and the risk management move were discussed but no actions were taken. New business items including the Community Trends Manual, parking rate analysis, and purchasing ordinance updates were reviewed without any approvals. The next meeting was scheduled for September 15, 2025.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
Mon Aug 18, 2025 · 5:30 PM

City Council

Council to interview police review board applicants, then closed session on personnel

This pre-council meeting has two items: public interviews for Citizens Police Review Board applicants, followed by a motion to enter closed session to discuss hiring, firing, disciplining, and personnel records. No other business is on the agenda. The meeting is largely procedural with no public votes on ordinances or contracts.

city-councilcitizens-police-review-boardpersonnelclosed-sessioncolumbia-mo
✓ Decided: Council approved closed session to discuss personnel matters

Mayor Buffaloe moved, and Council Member Waterman seconded, a motion for the City Council to enter a closed session to discuss hiring, firing, disciplining, or promoting employees and related personnel records. The motion passed with five votes in favor and two members absent. The council entered closed session at 5:51 p.m. and adjourned the closed meeting at 6:38 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-31073 — Approved a Motion
5 yea · 2 absent
Barbara Buffaloe yea · Nick Foster absent · Don Waterman yea · Betsy Peters yea · Valerie Carroll absent · Jacquelyn Sample yea · Vera Elwood yea
Mon Aug 18, 2025 · 7:00 PM

City Council

Council to set 2025 property tax rates for Columbia

The City Council will vote on the 2025 property tax rates (PH25-25) and consider the FY 2026 annual budget (PH26-25). The agenda also includes a rezoning request for 5320 Clark Lane (B122-25) and several conditional‑use permits for short‑term rentals, such as OneFrisco LLC at 1 Fyfer Place (B185-25). An amendment to Chapter 2 of the City Code on conflicts of interest and financial disclosure (B181-25) will also be addressed.

property-taxbudgetrezoningconditional-useethics
✓ Decided: Council approved 2025 property tax rates unanimously

The City Council adopted the 2025 property tax rates (PH25‑25) with a 5‑0 vote and no opposition. Council members also appointed new members to several boards and commissions, including the Board of Health and the Citizens Police Review Board. The Columbia Cosmopolitan Luncheon Club donated $150,000 for an inclusive playground at Rock Quarry Park. The FY 2026 budget was not finalized and will be continued at the next meeting.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 4 divided votes
Named votes as recorded in the official record.
B186-25 — Passed
4 nay · 2 absent · 1 yea
Barbara Buffaloe nay · Nick Foster absent · Don Waterman yea · Betsy Peters nay · Valerie Carroll absent · Jacquelyn Sample nay · Vera Elwood nay
B187-25 — Passed
4 nay · 2 absent · 1 yea
Barbara Buffaloe nay · Nick Foster absent · Don Waterman yea · Betsy Peters nay · Valerie Carroll absent · Jacquelyn Sample nay · Vera Elwood nay
B188-25 — Passed
4 nay · 2 absent · 1 yea
Barbara Buffaloe nay · Nick Foster absent · Don Waterman yea · Betsy Peters nay · Valerie Carroll absent · Jacquelyn Sample nay · Vera Elwood nay
R91-25 — Adopted
4 yea · 2 absent · 1 nay
Barbara Buffaloe nay · Nick Foster absent · Don Waterman yea · Betsy Peters yea · Valerie Carroll absent · Jacquelyn Sample yea · Vera Elwood yea
The other 25 items passed by unanimous or near-unanimous consent.
Thu Aug 14, 2025 · 8:00 AM

City Council

City Council to discuss 2026 legislative priorities

The City Council will hold a work session to discuss and draft the city's legislative priorities for 2026. The meeting is scheduled for 8:00 AM on Thursday, August 14, 2025, at City Hall.

city-councillegislativeprioritieswork-session
✓ Decided: Council discussed 2026 legislative priorities but made no formal decisions

The council held a work session to discuss the city’s 2026 legislative priorities, including affordable housing, police review boards, and a possible lodging tax. No motions were voted on or approved. A scheduled housing meeting with the county was cancelled and may be rescheduled for October or November. The meeting adjourned at 8:56 a.m.

City Hall Conference Rm 1A/1B 701 E. Broadway Columbia, MO
Thu Aug 14, 2025 · 8:00 AM

Railroad Advisory Board

Railroad Advisory Board to discuss rail banking and review traffic reports

The Railroad Advisory Board will meet to approve meeting minutes and financial statements, discuss rail banking at the south end of the railroad, and review traffic reports for the fiscal year ending July 2025.

railroadtrafficfinancepublic-workscolumbia-mo
✓ Decided: Board approved agenda amendment and minutes, and scheduled railbanking discussion

The board unanimously approved the agenda as amended to include a discussion of the July 30 Transload Facility tour. The May 8, 2025 meeting minutes were also approved unanimously. Chairman John Wilke decided to place the railbanking proposal on the agenda for the next meeting and invited Mr. Curtis to return for further discussion. The meeting was adjourned by a unanimous motion.

701 E Broadway Columbia, MO Conference Room 1C
Thu Aug 14, 2025 · 5:30 PM

Board of Health

Board to finalize revisions to animal control ordinance

The Board of Health will conduct a final review of changes to Chapter 5 (Animals and Fowl) and consider revisions to the vaccination schedule. Old business includes revising language to Section 5-6 (8) and removing language to Section 5-11 (b). The board will also hear a director's report.

board-of-healthanimalsvaccinationordinancespublic-healthcolumbia-mo
✓ Decided: Board approves multiple animal ordinance amendments, including raising rabies vaccine age

The Board of Health unanimously approved a series of amendments to Chapter 5 of the city animal ordinance. Changes include updating licensing language to use “receipt” instead of “certificate,” removing the reptile‑sale information requirement, raising the required age for rabies vaccination from three to four months, and adding new wording for tags, receipts, and feral‑cat care. Additional edits clarified tethering rules during inclement weather and removed outdated phrasing about animals running at large.

Columbia/Boone County Public Health & Human Services Training Room 1 1005 W. Worley St Columbia, MO
Thu Aug 14, 2025 · 12:00 PM

Columbia Sports Commission

Sports Commission will discuss upcoming Missouri Sports Travel Exchange tradeshow

The Columbia Sports Commission will approve the agenda and July 2025 meeting minutes. The commission will consider old and new business and hear staff reports on August Sports Commission activities, sports sales activities, and planning for the Missouri Sports Travel Exchange tradeshow. No specific resolutions or contracts are listed in the agenda.

sportscommissionmeetingplanningtradeshow
✓ Decided: Commission approved agenda, minutes and adjourned the meeting

The Sports Commission approved the meeting agenda as presented. It also approved the July 2025 meeting minutes. The meeting was adjourned at 12:24 PM with all members voting in favor.

Columbia Sports Fieldhouse - Meeting Room 4251 Philips Farm Rd
Thu Aug 14, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission to discuss services, elect officers

The Disabilities Commission will hold discussions with Boone County Family Resources and the Boone County Public Administrator to learn about community services and programs. New business includes elections for Chair, Vice-Chair, and Secretary, as well as discussion on the Senator Chuck Graham Accessibility Ambassador Award. Reports will be given from the Safe Streets for All Working Group and the Airport Steering Committee.

disabilitiesaccessibilitycommunity-serviceselectionspublic-administratorboone-countyawards
✓ Decided: Disabilities Commission elected new Chair, Vice‑Chair and Secretary

The commission approved its agenda and the July 10 minutes with amendments. Members unanimously elected John Bowders as Chair, Ann Marie Gortmaker as Vice‑Chair, and Jonathan Asher as Secretary. The meeting was then adjourned.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
10 yea · 2 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea
TMP-31061 — Approved a Motion
10 yea · 2 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea
TMP-31064 — Approved a Motion
30 yea · 6 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea · Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea · Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea
ADJOURNMENT — Approved a Motion
10 yea · 2 present
Hazel Fields present · Rene Powell yea · Ann Marie Gortmaker yea · John Bowders yea · Jonathan Asher yea · Cathy Dolles yea · Vera Elwood yea · Adam Kruse yea · Alexis Simmerman yea · Joseph Facteau yea · Richard Perkins present · Marlee Walz yea
Wed Aug 13, 2025 · 8:00 AM

Water and Light Advisory Board

Board reviews FY 2026 water and electric operating budgets and capital plans

The Water and Light Advisory Board will examine the City of Columbia’s FY 2026 operating and maintenance budgets for both water and electric services, as well as the FY 2026 Capital Improvement Plan budgets. A presentation on the value of solar under the Integrated Electric Resource & Master Plan Task Force will also be given. The meeting includes routine reports, public comments, and a motion to enter and exit closed session.

budgetwaterelectriccapital-improvementsolarpublic-comments
✓ Decided: Board elected Jennifer Coleman as Chair and Ryan Westwood as Vice Chair

The Water and Light Advisory Board approved the meeting agenda and the July 9, 2025 minutes by unanimous vote. The board also elected Jennifer Coleman as Chair and Ryan Westwood as Vice Chair, each motion passing unanimously.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Aug 13, 2025 · 3:00 PM

Parking Advisory Commission

Walker Cost Report for 5th and the Ramp on agenda for Parking Advisory Commission

The Parking Advisory Commission will discuss revenue from parking operations, review the Walker Cost Report for the 5th and the Ramp parking facility, receive an update on on-street parking, and hold a budget discussion. No final decisions are scheduled; items are for discussion only.

parkingbudgetrevenuedowntown-parkingcity-finance
701 E. Broadway Room 1A/1B City Hall Columbia MO 65201
Wed Aug 13, 2025 · 6:00 PM

Citizens Police Review Board

CPRB to discuss wrong address incidents and closed session records

The Citizens Police Review Board will approve minutes from July 9, 2025, and discuss wrong address incidents. The board will also vote to enter closed session to discuss records protected from disclosure.

cprbpolicepublic-safetyminutesclosed-sessionwrong-address
✓ Decided: Board voted to enter closed session on protected records

The Citizens Police Review Board approved its agenda and both the open‑session and closed‑session minutes from the July 9, 2025 meeting, each by unanimous vote. The board then voted to go into closed session to discuss records protected from disclosure by law, with all six members voting in favor. The board entered closed session at 6:58 PM and adjourned at 8:01 PM.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Tue Aug 12, 2025 · 6:00 PM

Human Services Commission

Foundant training for grant evaluators on agenda

The Human Services Commission will meet to approve April minutes, handle old business, and receive training on the Foundant system for evaluating grant applications. No funding decisions or policy votes are scheduled.

human-servicescommissiontraininggrantscolumbia-mo
✓ Decided: Human Services Commission unanimously approved agenda and adjourned

The commission unanimously approved the meeting agenda. The meeting minutes were approved. The commissioners unanimously voted to adjourn the meeting. The next meeting is scheduled for October 14, 2025 at 6 p.m.

Columbia/Boone County Department of Public Health and Human Services, Training Room 1, 1005 W. Worley St., Columbia, MO
Tue Aug 12, 2025 · 12:00 PM

Substance Use Prevention Advisory Commission

Substance Use Prevention Advisory Commission to discuss tobacco briefing

The commission will meet to review reports from the University of Missouri and Columbia Public Schools. The agenda includes a discussion regarding a Public Health Staff Development Day Tobacco Briefing.

public-healthsubstance-usetobacco
✓ Decided: Commission unanimously approved agenda and meeting minutes

The Substance Use Prevention Advisory Commission approved the agenda as amended after a motion by Bayless, seconded by Maddox, with a unanimous vote. The commission also approved the draft meeting minutes after a motion by Khanna, seconded by Jones, which passed unanimously. No other motions or substantive decisions were recorded.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Aug 12, 2025 · 7:00 PM

Board of Adjustment

Board of Adjustment will hear two cottage‑development requests

The Board of Adjustment will hold public hearings on two applications to use the "cottage" optional development standards. One request is from CCV Properties 3, LLC for the 600 Woodlawn Avenue site, a 4,955‑sq‑ft lot. The other request is from Mendez Properties, LLC for the 3310 Oakland Gravel Road site, proposing a 23‑lot subdivision called "Totolmajac Village." Both requests cite Section 29-6.4(j) of the Unified Development Code.

zoningdevelopmentboard-of-adjustmentpublic-hearings
Columbia City Hall Council Chambers 701 E Broadway
Thu Aug 7, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss small-lot subdivision rule revisions

The Planning and Zoning Commission will hold a work session to discuss proposed revisions to Article 5 (Subdivisions) regarding small lots. No votes or decisions are scheduled; the session is for discussion only. The agenda also includes routine approval of minutes and setting the next meeting date.

planningzoningsubdivisionssmall-lotscolumbia
✓ Decided: Commission approved preparation of short‑term rental correspondence

The Planning and Zoning Commission adopted its work‑session agenda unanimously (7‑0). It approved the July 24, 2025 work‑session minutes with a 6‑0‑1 abstention. Commissioners agreed to prepare and revise a short‑term rental correspondence to be distributed at the August 21 work session. They also decided to continue discussion of small‑lot subdivision revisions at the next meeting.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
7 yea · 2 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-30952 — Approved a Motion
6 yea · 2 present · 1 abstain
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton abstain · Cody Darr yea
ADJOURNMENT — Adopted
7 yea · 2 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Aug 7, 2025 · 7:00 PM

Planning and Zoning Commission

Planning commission to consider rezoning and short-term rental requests

The Planning and Zoning Commission will consider three public hearings, including a request to rezone 1.33 acres to allow two-family dwellings and a short-term rental permit for a single-family home.

zoninghousingplanningshort-term-rentaldevelopment
✓ Decided: Commission unanimously recommends R‑2 zoning for 1.33‑acre site at 7098 I‑70 Drive SE

The Planning and Zoning Commission approved its agenda and the July 24, 2025 minutes. It then voted 7‑0 to recommend approval of R‑2 zoning for the 1.33‑acre parcel at 7098 I‑70 Drive SE, forwarding the recommendation to City Council. The commission also discussed tabling case 231‑2025 (Ashford Place) until the September 4, 2025 meeting, but no vote on that motion was recorded.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
7 yea · 2 absent
Anthony Stanton absent · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz absent · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-30955 — Approved a Motion
7 yea · 2 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-30960 — Approved a Motion
7 yea · 2 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Anthony Stanton present · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Aug 7, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Mayor's Council to discuss fitness grants and event planning

The Mayor's Council on Physical Fitness and Health will approve the July 2025 minutes, review the remaining budget, and discuss mini-grant applications and event marketing. The next meeting is scheduled for September 4, 2025.

fitnesshealthbudgetgrantsplanning
ARC Meeting Room 1701 W. Ash
Wed Aug 6, 2025 · 1:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO to review proposed FY2026-2029 Transportation Improvement Program

The CATSO Technical Committee will consider and recommend approval of the proposed FY2026-2029 Transportation Improvement Program (TIP), which lists area transportation projects. The committee will also discuss the proposed FY2026 Unified Planning Work Program (UPWP) and review a Highway Safety Manual analysis of roadway information. A potential sub-area major streets traffic study will be discussed as well.

transportationplanningbudgetsafetytraffic-study
✓ Decided: CATSO committee unanimously forwards FY 2026‑2029 TIP and FY 2026 UPWP to Coordinating Committee

The committee approved the meeting agenda and the May meeting minutes, both unanimously. It voted to forward the proposed FY 2026‑2029 Transportation Improvement Program and the FY 2026 Unified Planning Work Program to the CATSO Coordinating Committee with a recommendation of approval, each unanimously. No formal action was taken on the Highway Safety Manual review or the sub‑area major streets traffic study. The meeting was adjourned unanimously.

Conference Room 1C City Hall 701 E. Broadway Columbia, Missouri
Wed Aug 6, 2025 · 6:30 PM

Community Land Trust Organization Board

CLT board to review homebuyer selection policies, discuss ARPA funds

The Community Land Trust Organization Board will consider updates to its Homebuyer Selection Policy and discuss use of ARPA funds. Reports include June and July financial statements. The board will also receive updates on the Chain of Houses Initiative, an accessory dwelling unit program, and a property at 115 Lynn.

community-land-trusthousinghomebuyer-policiesarpa-fundschain-of-housesadustrategic-plancolumbia-mo
✓ Decided: Board approved realtor search for homes under $270k and Chain of Houses program

The board unanimously approved a motion allowing the CCLT realtor to seek properties in Columbia under $270,000 that are in good condition. It also approved the Chain of Houses Initiative and authorized solicitation of donations for the program. Additional motions approved the use of officer authority to approve deals and escrow payments, and the adoption of updated homebuyer selection guidelines. The meeting was adjourned at 8:17 pm.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 5 yea
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
TMP-30994 — Approved a Motion
5 present · 5 yea
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
TMP-30995 — Approved a Motion
6 yea · 4 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
TMP-30996 — Approved a Motion
12 yea · 8 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present · Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
TMP-30997 — Approved a Motion
6 yea · 4 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
TMP-30999 — Approved a Motion
6 yea · 4 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
ADJOURNMENT — Approved a Motion
6 yea · 4 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell present
Tue Aug 5, 2025 · 5:30 PM

Commission on Human Rights

Commission on Human Rights to discuss ordinance enforcement and budget reallocations

The Commission on Human Rights will review enforcement procedures for Chapter 12-57 of the Code of Ordinances. The body will also discuss budget reallocations for Pride Fest and the creation of an annual report for City Council.

human-rightscity-ordinancesbudgetpublic-reports
✓ Decided: Commission approved agenda, minutes and sent memo to council to amend complaint process

The commission unanimously approved the meeting agenda. It approved the draft minutes from June 3, 2025 by a majority vote (one abstention) and approved the closed‑meeting minutes from the same date unanimously. Commissioners unanimously voted to send a memo to City Council recommending an amendment to the ordinance’s complaint process. Motions to enter and exit a closed session and to adjourn the meeting were also approved.

Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-30881 — Approved a Motion
5 yea · 1 abstain · 1 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum yea · Paige Lubbering abstain · Penny Kuhns-Knarr present · Liz Townsend Bird yea
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
6 yea · 1 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr present · Liz Townsend Bird yea
Tue Aug 5, 2025 · 5:30 PM

Historic Preservation Commission

Commission reviews demolition permit applications for Park Ave and Westwinds Dr

The Historic Preservation Commission will review demolition permit applications for two locations. The body will also receive updates on the city's preservation plan and grant-funded surveys.

historic-preservationdemolitionzoninggrants
✓ Decided: Commission closed review of demolition permit applications

The Historic Preservation Commission approved the meeting agenda and the July meeting minutes by unanimous voice votes. Commissioners then moved to close review of the demolition permit applications submitted by the Columbia Housing Authority, which also passed unanimously. The meeting was adjourned by unanimous voice vote.

Conference Room 1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
TMP-30957 — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
Mon Aug 4, 2025 · 6:00 PM

City Council

City Council to hold closed session for legal discussions

The City Council is meeting to discuss confidential or privileged communications with its attorneys. The agenda consists primarily of procedural items and a closed session.

legalproceduralcity-council
✓ Decided: Council approved closed session and adjourned the meeting

Mayor Buffaloe moved, and Council Member Foster seconded, to go into a closed session to discuss confidential matters. The motion was approved by the listed members, and the council entered closed session at 6:01 p.m. The closed meeting adjourned at approximately 6:34 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
CALL TO ORDER — Approved a Motion
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Mon Aug 4, 2025 · 7:00 PM

City Council

City Council to adopt FY 2026 budget for Columbia

The council will consider the City Manager's proposed FY 2026 budget and adopt the FY 2026 city budget. A public hearing will be held on the Water and Light 2025 Renewable Energy Plan. The agenda also includes approval of the Cosmo‑Bethel Park tennis court resurfacing project and several conditional‑use permits for short‑term rentals.

budgetrenewable-energyparkszoninghousingutilitiespublic-hearingcontracts
✓ Decided: Council unanimously approved the 2025 Renewable Energy Plan

The City Council accepted the 2025 Renewable Energy Plan with a unanimous roll‑call vote. It also approved the Cosmo‑Bethel Park tennis court resurfacing project and an amendment to the City Code on Parks and Recreation fees, each passing unanimously. No other substantive actions were decided at this meeting.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (20 roll-call votes)
Named votes as recorded in the official record.
B171-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B179-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B174-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B177-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B169-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B175-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B176-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B172-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B173-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B178-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B180-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
PR105-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R108-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R109-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R107-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R110-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R106-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R112-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R113-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R111-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Tue Jul 29, 2025 · 3:00 PM

Mayor's Task Force on the U.S.S. Columbia

Task Force will consider the Mayor’s letter to the U.S.S. Columbia

The Mayor's Task Force on the U.S.S. Columbia will review a letter from the Mayor to the boat as old business. The meeting will also include a report providing updates on the submarine. Agenda items include routine approvals of the agenda and minutes from the June 24, 2025 meeting.

task-forcemayorsubmarinepublic-meeting
✓ Decided: Task Force approved agenda, minutes and adjourned the meeting

The task force approved its agenda and the minutes from the June 24, 2025 meeting. Both motions were carried without recorded vote counts. The meeting was then adjourned by a carried motion.

Walton Building Board Room 300 S. Providence Rd. Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
7 yea · 2 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy present
TMP-30905 — Approved a Motion
7 yea · 2 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy present
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy present
Mon Jul 28, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Committee to discuss FY26 budget and monthly economic report

The Finance Advisory and Audit Committee will review and discuss the proposed FY26 budget, along with the monthly economic report and capital improvement updates. The agenda also includes approval of minutes from previous meetings and old business on the mission statement. No final decisions are expected from this advisory committee.

budgetfinanceauditeconomic-reportcapital-improvements
✓ Decided: FAAC unanimously approved agenda and minutes, then adjourned the meeting

The Finance Advisory and Audit Committee approved its agenda unanimously. The committee also approved the April 21 and June 16 meeting minutes unanimously. A motion to adjourn was made, seconded and carried, ending the meeting at about 2:30 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Jul 28, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Board reviews MU Concert Series tourism application

The Convention and Visitors Advisory Board will meet to discuss a Tourism Development Signature Series Application for the MU Concert Series. The board will also review the FY2025 3rd Quarter Staff Report and updates from The District and the Boone County Commission.

tourismarts-and-cultureeconomic-developmentmu-concert-series
✓ Decided: Board approved agenda and minutes, then adjourned the meeting

The Convention and Visitors Advisory Board approved the agenda as written. It also approved the meeting minutes as written. The board adjourned the meeting at 1:11 p.m. All motions passed.

300 S. Providence Road - Thomas G. Walton Building
Thu Jul 24, 2025 · 3:00 PM

Conley Fund Advisory Committee

Committee will decide 2025 distribution of Conley Fund to PHHS

The Conley Fund Advisory Committee will review the 2025 Fund Assets Report and the Conley Fund Statement for April 1‑30, 2025. The committee will make a decision on how the 2025 Conley Fund will be distributed to PHHS. The meeting also includes routine agenda approval and public comment.

fundsbudgetphhsadvisory-committee
City Hall Room 1C 701 East Broadway Columbia, Missouri
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
2 yea · 1 present
Nancy Thompson yea · Matthew Lue present · Rebecca Roesslet yea
ADJOURNMENT — Approved a Motion
2 yea · 1 present
Nancy Thompson yea · Matthew Lue present · Rebecca Roesslet yea
TMP-30676 — Approved a Motion
2 yea · 1 present
Nancy Thompson yea · Matthew Lue present · Rebecca Roesslet yea
TMP-30728 — Approved a Motion
2 yea · 1 present
Nancy Thompson yea · Matthew Lue present · Rebecca Roesslet yea
Thu Jul 24, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss ‘family’ definition and small lot integration

The Planning and Zoning Commission will hold a work session to follow up on proposed revisions to the UDC definition of 'family' and related parking standards. They will also receive a status update on a text change for small lot integration. No votes or final decisions are scheduled; these are discussion items only.

planningzoningudcfamily-definitionsmall-lotparkingwork-session
✓ Decided: Commission adopts agenda, approves minutes, and removes phrase from family definition

The agenda for the July 24 work session was adopted unanimously. The minutes from the July 10 work session were approved unanimously. The commission agreed to delete the phrase “as a single housekeeping unit” from the second part of the revised family definition in the Unified Development Code.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton present · Cody Darr yea
APPROVAL OF MINUTES — Adopted
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton present · Cody Darr yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton present · Cody Darr yea
Thu Jul 24, 2025 · 7:00 PM

Planning and Zoning Commission

Columbia P&Z considers rezoning and development plans for 10 properties

The Planning and Zoning Commission will consider rezoning requests, new development plans, and a conditional use permit for various properties across Columbia. The agenda includes items for single-family housing, commercial expansion, and short-term rentals.

zoninghousingplanningdevelopmentpublic-hearingscolumbia
Columbia City Hall Council Chambers 701 E Broadway
Tue Jul 22, 2025 · 6:00 PM

Climate and Environment Commission

Climate and Environment Commission to hear from Missouri State Climatologist

The Climate and Environment Commission will meet to receive a presentation from Missouri State Climatologist Zack Leasor, PhD. The commission will also discuss priority actions and set the date for the August 2025 meeting.

climateenvironmentstate-climatologist
✓ Decided: Commission cancels August 2025 meeting due to lack of quorum

The commission approved the amended agenda and approved the meeting minutes, each by motion carried. Members voted to cancel the scheduled August 2025 Climate and Environment Commission meeting because there was no quorum and no time‑sensitive items. The next meeting was set for September 23, 2025.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
Mon Jul 21, 2025 · 5:00 PM

City Council

Police/fire pension valuation and energy contract discussion

This pre-council meeting begins with a closed session to discuss sealed bids and proposals. In open session, the council will receive a presentation on the Columbia Police and Fire Retirement Fund actuarial valuation and an information session on energy performance contracting. The agenda also includes time for any other items council members wish to discuss.

policefireretirement-fundenergyutilitiescontractscity-council
✓ Decided: Council moved to consider sealed bids in a closed session

Mayor Buffaloe moved to place the council in a closed session to discuss sealed bids and related contract documents, and Council Member Foster seconded the motion. The minutes do not record a vote tally or final adoption of the motion. The council heard presentations on the police and fire pension fund valuation and on an energy performance‑contracting program for several city facilities. The meeting adjourned at 6:42 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Jul 21, 2025 · 7:00 PM

City Council

Council to authorize Columbia Gorge Parkway sidewalk project and budget amendment

The City Council will vote on authorizing construction of the Columbia Gorge Parkway sidewalk improvement project, calling for bids and amending the FY 2025 Annual Budget to fund it. The council will also consider the FY 2026 Capital Improvement Project Plan (no action required). Additional items include rezoning proposals for Starke Avenue and Grindstone Parkway, and several conditional use permits for short‑term rentals. Several budget and service agreements, such as a water line payment with Hemme Construction, will also be considered.

sidewalkszoningshort-term-rentalsbudgetwaterinfrastructure
✓ Decided: Council approved sidewalk project and annexed mobile home park

The City Council appointed new members to several boards and commissions. It approved the Columbia Gorge Parkway sidewalk improvement project and the voluntary annexation of 3501 New Haven Road with the Woodstock Mobile Home Park development plan. A conditional use permit for a short‑term rental at 3407 Goldenwood Drive was defeated. All consent‑agenda items, including rezoning and various permits, were adopted.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B153-25 — Passed
4 nay · 1 yea · 1 absent
Barbara Buffaloe nay · Nick Foster nay · Don Waterman yea · Betsy Peters absent · Valerie Carroll nay · Jacquelyn Sample nay
The other 25 items passed by unanimous or near-unanimous consent.
Sat Jul 19, 2025 · 9:00 AM

City Council

Council holds final review of proposed FY26 budget

The City Council will conduct a final review of the proposed Fiscal Year 2026 budget during a work session. A budget presentation is scheduled. No other business is listed on the agenda.

budgetcity-councilwork-sessionfiscal-year-2026
✓ Decided: Council approved a 2% water rate increase for FY 26

During the July 19, 2025 budget work session, the City Council voted to move forward with a 2% water rate increase that is part of the proposed FY 26 budget. No other substantive approvals, denials, or tablings were recorded in the minutes.

City Hall Council Chamber 701 E. Broadway Columbia, MO.
Thu Jul 17, 2025 · 6:30 PM

Parks and Recreation Commission

Rezoning near Alspaugh Park and park project agreements on agenda

The Parks and Recreation Commission will consider a rezoning near Alspaugh Park as new business. Staff will present on a McClure engineering agreement for North Village Park, Cosmo-Bethel tennis court renovations, and a fee ordinance. Reports on bicycle/pedestrian, capital projects, and recreation services are also scheduled.

parksrezoningtennisfeesbicyclepedestriancapital-projects
ARC Meeting Room 1701 W. Ash Columbia, MO
Wed Jul 16, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Bicycle and Pedestrian Commission to discuss sidewalk master plan and bike boulevards

This meeting of the Columbia Bicycle and Pedestrian Commission will discuss formalizing a procedure for the Sidewalk Master Plan and consider bicycle boulevards. Staff and commission reports include updates on Vision Zero, Parks and Recreation, and planning. The commission will also approve minutes from the June 18, 2025 meeting.

bicyclepedestriansidewalk-master-planbicycle-boulevardsvision-zerotransportationinfrastructure
✓ Decided: Commission approved agenda, minutes and adjourned the meeting

The Bicycle and Pedestrian Commission approved the meeting agenda on a motion by Frank Schmidt, seconded by Tommy Fieser. The June 18, 2025 minutes were approved after amendments on a motion by McKenzie Ortiz, seconded by Carol Elliott. The meeting was adjourned on a motion by McKenzie Ortiz, with seconds by Frank Schmidt and Carol Elliott.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Jul 16, 2025 · 5:00 PM

Tree Board

Tree Board to discuss City Tree Fund and officer elections

The Tree Board will meet to approve minutes, elect officers, and discuss the City Tree Fund with the City Council. The city arborist will provide an update on current projects.

tree-boardcity-councilarboristpublic-meetingcolumbia-mo
✓ Decided: Board elected Renee Scheidt‑Hahn as Chair and Michael Kyd as Vice Chair

The Tree Board approved its agenda and the minutes from the previous meeting. Members elected Renee Scheidt‑Hahn as Chair and Michael Kyd as Vice Chair. The board approved a motion for the liaison to register for two upcoming events. The meeting was adjourned at 6:17 PM.

City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 2 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee present · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ELECTION OF OFFICERS — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
WORK CALENDAR — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed Jul 16, 2025 · 2:00 PM

City Council

Council holds FY26 budget work session on enterprise funds

The City Council is meeting for a budget work session focused on the FY26 budget, including a presentation on enterprise funds. No votes or decisions are scheduled; the session is for discussion and review.

budgetenterprise-fundscity-council
✓ Decided: Council held FY26 budget work session, no decisions were made

The July 16, 2025 City Council meeting was a budget work session where staff presented enterprise fund data and proposed rate increases for parking, water, and electric services. Council members asked for example bills and a communications plan, but no motions were voted on or approved. The meeting adjourned without any formal decisions.

City Hall Council Chamber 701 E. Broadway Columbia, MO.
Wed Jul 16, 2025 · 4:15 PM

Food Council

Columbia Food Council to discuss food system emergency preparedness

The Food Council will meet to review updates on the OFBC and county representation. The body will also discuss emergency preparedness within the food system and current food policy updates.

food-policyemergency-preparednesspublic-health
✓ Decided: Food Council unanimously approved agenda and prior meeting minutes

The council voted to approve the meeting agenda, with the motion passing unanimously. It also approved the June 18, 2025 meeting minutes, again unanimously. No other formal actions or votes were recorded during this session.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Jul 15, 2025 · 1:00 PM

Office of Violence Prevention Advisory Committee

Committee will review reports and gather public input

The Office of Violence Prevention Advisory Committee will hold its regular meeting, approve the minutes from the prior meeting, receive a current report, discuss the scope of its ongoing work, and provide time for public comments. No specific decisions or actions beyond routine agenda items are listed.

violence-preventionpublic-commentscommitteecity-government
✓ Decided: Committee discussed violence‑prevention initiatives but made no formal decisions

The Office of Violence Prevention Advisory Committee reviewed several proposed programs, including community mental‑health trainings, a Clean, Safe Neighborhoods Initiative, and a $99,000 potential investment for Community Violence Interrupters. No votes or approvals were recorded; members noted upcoming meetings and follow‑up actions such as D’Markus Thomas‑Brown meeting with Mike Sokoff and sharing information about Baltimore’s program.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO
Tue Jul 15, 2025 · 5:30 PM

Public Transit Advisory Commission

PTAC to review June ridership, discuss collaboration with other commissions

The Public Transit Advisory Commission will hold a regular meeting on July 15, 2025. Agenda items include approval of June meeting minutes, a report on June 2025 ridership figures, and discussion of Google Maps and collaboration with other commissions. The meeting is largely procedural with no major proposals or votes expected.

transitpublic-transitridershipcollaborationgoogle-mapscommission-updatespublic-comments
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Jul 14, 2025 · 4:30 PM

Commission on Cultural Affairs

Columbia commission to finalize FY26 arts grants

The Commission on Cultural Affairs will ratify scores and finalize funding levels for the FY26 Annual Arts Grants. The meeting includes a public hearing on the funding process and updates on the Columbia Arts Fund and FY25 Mid-Year Grant status.

artsfundinggrantscultural-affairspublic-hearing
✓ Decided: Commission approved FY26 arts grant scores and funding allocations

The commission approved the meeting agenda and the June 17 minutes. It then ratified the FY26 arts grant scores and finalized funding levels for the $200,000 grant pool. The commission also approved the stipulated deliverables for four awardees and adjourned the meeting.

City Hall Council Chambers 701 E Broadway Columbia, MO
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Spencer Thompson yea
APPROVAL OF MINUTES — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Spencer Thompson yea
TMP-30779 — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Spencer Thompson yea
TMP-30780 — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Spencer Thompson yea
ADJOURNMENT — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Spencer Thompson yea
Mon Jul 14, 2025 · 2:00 PM

City Council

Council holds FY26 budget work session on general fund

The City Council is holding a budget work session to review the FY26 General Fund overview. The meeting includes a presentation on the proposed budget and discussions. No votes are scheduled; this is a preliminary review session.

budgetcity-councilgeneral-fundwork-session
✓ Decided: Council held a budget work session; no decisions were approved

Mayor Buffaloe called the July 14 meeting to order and the Finance Director presented the General Fund overview and FY26 budget proposal. The presentation covered revenue sources, staffing changes, and a draft proposal to halt the transfer from the General Fund to the Public Improvement Fund. No votes or formal actions were recorded during the session.

City Hall Council Chamber 701 E. Broadway Columbia, MO.
Thu Jul 10, 2025 · 12:00 PM

Commission on Cultural Affairs Standing Committee on Public Art

Committee to review Pollinator Art Pole design

The Standing Committee on Public Art will meet to review the Pollinator Art Pole design as new business, along with routine approvals of minutes and public comment. No other substantive decisions are on the agenda.

public-artdesign-reviewpollinatorcultural-affairs
✓ Decided: Committee recommends six pollinator art pole designs for Ward 2

The committee approved the meeting agenda and the minutes from May 1, 2025. It voted to recommend six art pole designs created by artist Adrienne Luther Johnson for the Pollinator Art Pole pilot along North Providence Road. The meeting was then adjourned.

City Hall Room 1C 701 E. Broadway Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
TMP-30759 — Approved a Motion
4 yea · 1 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl yea · Jamie Scheppers yea
TMP-30760 — Approved a Motion
4 yea · 1 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl yea · Jamie Scheppers yea
ADJOURNMENT — Approved a Motion
4 yea · 1 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl yea · Jamie Scheppers yea
Thu Jul 10, 2025 · 5:30 PM

Board of Health

Board to review proposed revisions to animal abuse and tethering ordinance

The Board of Health will consider proposed revisions to Section 5-6 of the city code regarding animal abuse, unlawful impoundment, confinement, and tethering. The meeting also includes approval of previous minutes, a Director's Report by Rebecca Roesslet, and an opportunity for public comment.

animal-controlpublic-healthordinanceboard-of-health
✓ Decided: Board adopts broader tethering rule for animals during any weather warning

The Board of Health approved language that prohibits tethering animals outdoors during any National Weather Service warning unless adequate provisions are provided. It also voted not to conduct school‑based flu vaccinations this year. The board scheduled further work on the ordinance for an August meeting and a pre‑council review on November 3.

Columbia/Boone County Public Health & Human Service Training Room 1 1005 W. Worley St Columbia, MO.
Thu Jul 10, 2025 · 12:00 PM

Columbia Sports Commission

Sports Commission meeting to approve agenda, minutes and set next date

The Columbia Sports Commission will approve the meeting agenda and the May 2025 minutes (TMP-30578). A staff report on July sports activities will be presented. The commission will hear public comments and schedule the next meeting for August 14, 2025.

sportscommissionmeetingminutespublic-comments
✓ Decided: Commission approved its meeting agenda

The Columbia Sports Commission approved its agenda and the May 2025 meeting minutes. The commission then adjourned the meeting at 12:57 PM. No other substantive actions were taken.

Columbia Sports Fieldhouse - Meeting Room 4251 Philips Farm Rd Columbia, MO
Thu Jul 10, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission to discuss ADA grievance form and community services

The commission will hold a discussion with Boone County Family Resources regarding community services and programs. Members will also discuss the City's ADA Grievance Form and the 2025 ADA Symposium.

adadisability-servicescommunity-programsaccessibility
✓ Decided: Commission approved the amended agenda, removing a discussion item

The commission voted to approve the agenda as amended, removing the discussion with Boone County Family Resources and moving it to next month. Members also decided to postpone approval of the June 12, 2025 meeting minutes until the July meeting for further review.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Thu Jul 10, 2025 · 5:30 PM

Planning and Zoning Commission

Planning and Zoning Commission to discuss UDC revisions

The Planning and Zoning Commission will hold a work session to review Unified Development Code (UDC) updates. The body will discuss the definition of 'Family' and the status of small lot integration.

zoningudcland-use
Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-30694 — Approved a Motion
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
ADJOURNMENT — Approved a Motion
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Jul 10, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to review short-term rental permits and industrial rezoning

The Planning and Zoning Commission will hold public hearings for multiple short-term rental conditional use permits and one industrial rezoning request. The body will also consider two subdivision plat approvals. Three other development cases have been requested for tabling.

zoningshort-term-rentalsindustrialsubdivisionsland-use
Columbia City Hall Council Chambers 701 E Broadway
Wed Jul 9, 2025 · 8:00 AM

Water and Light Advisory Board

Proposed electric rate increase discussed

The Water and Light Advisory Board will discuss a proposed FY 2026 electric rate increase and receive monthly financial reports, power cost adjustment report, and updates from council and community summit. The meeting also includes approval of prior minutes and introduction of a new member.

utilityelectric-rateswaterlightadvisory-boardcolumbiamissouri
✓ Decided: Board unanimously recommends up to 2.4% electric rate increase to City Council

The board approved the meeting agenda and the June 11, 2025 minutes without dissent. It voted to recommend that City Council consider an electric rate increase of up to 2.4%. The rolling calendar was left unchanged and the meeting was adjourned unanimously.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Jul 9, 2025 · 6:30 PM

Community Land Trust Organization Board

Community Land Trust Board to discuss home selling prices and strategic plan

The Community Land Trust Organization Board will meet to review its strategic plan and discuss the selling price for homes. The board will also address a QuickBooks subscription renewal and review May 2025 financial statements.

housingcommunity-land-trustfinancestrategic-planning
✓ Decided: Board adopted 2025 strategic plan outcomes for the Community Land Trust

The board approved the meeting agenda, June 4 minutes, and the treasurer’s report, each by a 7‑0 vote. It authorized a QuickBooks subscription renewal at $1,242 and set the selling price for two 8th St homes at $170,000 each. The board also approved staff to determine a sell price for 115 Lynn and adopted the strategic plan’s primary outcomes and measures.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-30753 — Approved a Motion
41 yea · 28 present · 1 nay
Shirley Rhoades present · Anthony Stanton present · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter present · Tracey Bush-Cook present · Douglas Hunt present · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present · Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt nay · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell yea
The other 5 items passed by unanimous or near-unanimous consent.
Wed Jul 9, 2025 · 6:00 PM

Citizens Police Review Board

Police Review Board to discuss FY26 budget and legal restrictions on police dialogue

The Citizens Police Review Board will meet to discuss the FY26 budget update and legal restrictions regarding dialogue between the board and the Chief of Police in misconduct cases. The board will also review use-of-force complaints in a closed session.

police-oversightbudgetmisconductuse-of-force
✓ Decided: Board unanimously approved agenda and minutes, then voted to enter closed session

The board approved the meeting agenda with amendments by unanimous vote. It approved the draft open‑session minutes of May 14, 2025 (all in favor, one abstention) and the draft closed‑session minutes of the same meeting unanimously. Later, members voted to go into closed session to discuss protected records.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Tue Jul 8, 2025 · 12:00 PM

City of Columbia New Century Fund, Inc. Board

New Century Fund Board to discuss future planning and awards

The New Century Fund, Inc. Board will meet to discuss the future of the fund and review its by-laws. The board is also scheduled to address Lang Awards and a historic preservation donation.

new-century-fundhistoric-preservationawardsgovernance
City Hall Conference Room 1A 701 E. Broadway Columbia, MO 65201
Mon Jul 7, 2025 · 5:00 PM

City Council

City Council holds public meeting on AV modernization, then closed session

This pre-council meeting opens with an interested parties meeting and presentation on the City Hall Audio/Visual (AV) Modernization Project. The Council will then vote to enter closed session to discuss personnel, real estate, negotiations, and legal matters under several state exemptions. No open votes on ordinances or resolutions are scheduled.

city-councilav-modernizationclosed-sessionpersonnelreal-estatelitigationcolumbia-mo
✓ Decided: City Council approved motion and entered closed session

Mayor Buffaloe moved, and Council Member Peters seconded, a motion for the council to go into closed session to discuss confidential personnel, real‑estate, and legal matters. The council entered the closed session in Conference Room 1A/1B at about 5:23 p.m. No other actions were taken during the meeting.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-30678 — Approved a Motion
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Mon Jul 7, 2025 · 7:00 PM

City Council

Council to consider voluntary annexation of 3501 New Haven Road for mobile home park

The council will hold a public hearing and vote on the voluntary annexation of 3501 New Haven Road to establish R-MH zoning and approve the Woodstock Mobile Home Park. Old business includes a vote on rezoning 5320 Clark Lane from M-N to M-C, tabled from June 16, and a second reading to repeal and replace agreements for downtown public housing replacement on Park Avenue. The consent agenda covers multiple infrastructure projects, including a roundabout at Fairview and Chapel Hill roads, Garth Avenue improvements, and a grant to restore air service to Denver. New business includes first readings for rezonings on Starke Avenue and Grindstone Parkway, and conditional use permits for short-term rentals.

annexationzoninghousingpublic-hearingtransportationinfrastructurebudget
✓ Decided: Council adopts FY 2025‑2029 plan amendments and approves multiple infrastructure projects

The City Council unanimously adopted the FY 2025‑2029 Consolidated Plan and related action plans (R97-25). It tabled two rezoning and plat items (B122-25, R91-25) until the August 18 meeting. The Council also approved amendments and final enactments for utility conveyances (B141-25) and the Park Avenue housing project (B149-25). A consent agenda approved several infrastructure permits and projects, including a short‑term rental permit, a roundabout, and street improvements.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (22 roll-call votes)
Named votes as recorded in the official record.
B136-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B145-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B146-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B137-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B138-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B139-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B140-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B147-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B142-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B148-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B149-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B135-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B143-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B144-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B141-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B134-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R93-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R96-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R97-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R95-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Thu Jul 3, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council will review mini‑grant application and plan upcoming event

The Mayor's Council on Physical Fitness and Health will consider a mini‑grant application and discuss an event planning timeline. The meeting will also include routine items such as the treasurer's report, approval of the agenda and minutes, and general public comments. The next meeting is scheduled for August 7, 2025.

grantseventscity-councilpublic-meeting
ARC Meeting Room 1701 W. Ash Columbia, MO
Tue Jul 1, 2025 · 5:30 PM

Commission on Human Rights

Commission on Human Rights meeting canceled

The July 1, 2025, meeting of the Commission on Human Rights was canceled due to a lack of quorum. No items were decided or discussed.

human-rightsprocedural
Conference Room 1A 701 E Broadway Columbia, MO
Tue Jul 1, 2025 · 5:30 PM

Historic Preservation Commission

Final public input session on preservation plan

The Historic Preservation Commission will hold its third and final public input session for the city's preservation plan, as required by a Certified Local Government grant. Additional input sessions may occur before the plan goes to Planning & Zoning Commission and City Council. The commission will also consider a demolition permit for 105 Forest Avenue and hear staff updates on the interactive historic properties map and a CLG grant survey.

historic-preservationpublic-inputdemolition-permitgrantsmapsplanningcolumbia
✓ Decided: Commission closed review of demolition permit for 105 E. Forest Ave

The Historic Preservation Commission approved its agenda and the June 3 minutes unanimously by voice vote. It closed the review of a demolition permit application for 105 E. Forest Ave, also by unanimous voice vote. The commission scheduled a Historic Preservation Plan work session for September 3 and appointed Commissioner Parshall to serve as interim secretary until the September elections. No other substantive actions were taken.

Conference Room 1B Columbia City Hall 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
Mon Jun 30, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Convention and Visitors Advisory Board meeting canceled

This meeting of the Convention and Visitors Advisory Board has been canceled. No business will be conducted. The next regular meeting is scheduled for July 28, 2025.

canceledmeetingconvention-and-visitors-advisory-board
300 S. Providence Road - Thomas G. Walton Building
Wed Jun 25, 2025 · 3:00 PM

Airport Advisory Board

Airport Board to review Master Plan and Terminal Kitchen design

The Columbia Airport Advisory Board will meet to approve minutes from previous meetings and discuss the Master Plan Update and Terminal Kitchen Design. The public may attend.

airportplanningcolumbia-mopublic-meeting
✓ Decided: Board unanimously approved agenda and minutes, deferred May 28 minutes

The Airport Advisory Board approved the meeting agenda and the March meeting minutes by unanimous vote. Approval of the May 28, 2025 minutes was deferred to the August meeting due to delayed submission. Board member Ed Longoria volunteered to serve on the bid‑review panel for upcoming airport projects.

Columbia Regional Airport Conference Room 11350 S Airport Drive Columbia, MO
Wed Jun 25, 2025 · 7:00 PM

Housing and Community Development Commission

Public hearing on 5-year consolidated plan and annual action plan for housing funds

The Housing and Community Development Commission will hold a public hearing on the FY 2025-2029 Consolidated Plan and Citizen Participation Plan, and the FY 2025 Annual Action Plan. The commission will also consider amended annual action plans for FY 2019, 2023, and 2024, and discuss draft funding recommendations for FY 2026 HOME and CDBG programs.

housingcommunity-developmentconsolidated-planannual-action-plancdbghomepublic-hearing
✓ Decided: Commission fails to approve May 21, 2025 meeting minutes due to lack of quorum

The commission unanimously approved the meeting agenda (4‑0) and the May 14, 2025 minutes (4‑0). A motion to approve the May 21, 2025 minutes did not pass because a majority was not present. The commission held a public hearing on amendments to the FY 2025‑2029 Consolidated Plan and Citizen Participation Plan, but deferred any vote until a later meeting.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
TMP-30664 — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
TMP-30665 — Discussed
3 present · 3 yea · 1 abstain
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh abstain · Scott Cristal present · Ryan King present · Elizabeth Downing yea
TMP-30667 — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
TMP-30668 — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
TMP-30669 — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
TMP-30670 — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
ADJOURNMENT — Approved a Motion
4 yea · 3 present
Mitchell Ritter present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal present · Ryan King present · Elizabeth Downing yea
Tue Jun 24, 2025 · 6:00 PM

Climate and Environment Commission

Commission to review 2025 Renewable Energy Plan and Demand-Side Management Report

The Climate and Environment Commission will discuss the 2025 Renewable Energy Plan and the FY24 Demand-Side Management Report. The body will also review the 2025 CEC Priority Actions.

renewable-energyclimateenvironmentenergy-management
✓ Decided: Commission approves agenda, minutes and FY2025 budget priority statement

The Climate and Environment Commission approved the amended agenda and the meeting minutes. Members unanimously adopted a statement supporting the internal staff teams’ FY2025 budget priorities. No other formal actions were taken.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
OLD BUSINESS — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
Tue Jun 24, 2025 · 3:00 PM

Mayor's Task Force on the U.S.S. Columbia

Task force to discuss formal invitation for USS Columbia 30th anniversary

The Mayor's Task Force on the U.S.S. Columbia will consider a formal invitation for the submarine's crew to visit for its 30th anniversary, including a city reception. The meeting also includes approval of prior minutes, updates on the submarine, and public comments.

uss-columbianavyceremonyinvitationscity-receptionanniversary
✓ Decided: Task Force approves agenda, minutes and adjourns meeting

The task force approved its meeting agenda and the minutes from the May 20, 2025 meeting, each by a carried motion. The meeting was then adjourned at 3:26 p.m. by a carried motion. No other substantive actions were decided.

Walton Building Board Room 300 S. Providence Rd. Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 3 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer present · Marty Walker present · Chris Kelly yea · Walter Lantzy yea
TMP-30642 — Approved a Motion
6 yea · 3 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer present · Marty Walker present · Chris Kelly yea · Walter Lantzy yea
ADJOURNMENT — Approved a Motion
6 yea · 3 present
Anne Moore yea · Anne Clark present · John Clark yea · Peter Koukola yea · Robert Ross yea · Becky Wischmeyer present · Marty Walker present · Chris Kelly yea · Walter Lantzy yea
Wed Jun 18, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Columbia Bicycle and Pedestrian Commission meets to discuss transportation plans

The Bicycle and Pedestrian Commission will approve minutes from April 2025 and review staff reports on Vision Zero, parks, and planning. The body will also discuss support letters for the Safe Streets for All program and the Missouri Complete Streets Workgroup.

bicyclepedestriantransportationplanningvision-zeromo-dotsidewalksstaff-reports
✓ Decided: Commission unanimously approved two Safe Streets for All support letters

The Bicycle and Pedestrian Commission approved a support letter for the City of Columbia's Safe Streets for All (SS4A) program, and a separate support letter for MU's SS4A program, both by unanimous vote. The meeting was then adjourned after a motion to close the session.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Jun 18, 2025 · 5:15 PM

Columbia Parks and Recreation Fund Advisory Committee

Committee will vote on authorizing the 2025 COMOGIVES campaign fee

The Parks and Recreation Fund Advisory Committee will consider authorizing a fee to support the 2025 COMOGIVES campaign. The meeting will also include an update on the fund's current balance and a period for public comments. The next meeting is scheduled for July 17, 2025.

parksfundingfeespublic-commentsbudget
Parks Management Center 1507 Business Loop 70 Columbia, MO
Wed Jun 18, 2025 · 5:00 PM

Tree Board

Columbia Tree Board to discuss City Tree Fund and budget

The Tree Board will meet to elect officers and discuss the board's budget. Members will also discuss addressing the City Tree Fund with City Council and receive a report from the city arborist on current projects.

treesbudgetcity-councilenvironment
City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 3 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
4 yea · 3 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
ELECTION OF OFFICERS — Tabled
4 yea · 3 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
4 yea · 3 present
Michael Kyd present · Jacob McMains yea · Samuel Wright yea · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
Wed Jun 18, 2025 · 1:00 PM

Loan and Grant Committee

Committee reviews updated CDBG and HOME administrative guidelines

The Loan and Grant Committee will review updated administrative guidelines for the Community Development Block Grant (CDBG) and HOME programs. The committee is also scheduled to go into closed session to discuss welfare cases of identifiable individuals under state law. The agenda includes approval of minutes from a previous meeting and general public comments.

loangrantcdbghomeadministrative-guidelinesclosed-sessionwelfarecolumbia
✓ Decided: Loan and Grant Committee approved updated CDBG and HOME guidelines

The committee approved its agenda (4‑0) and the May 13, 2024 meeting minutes (4‑0). It then approved the updated CDBG and HOME administrative guidelines with modifications, including raising the change‑order limit to $3,000, by a vote of 5‑0. The committee entered and exited a closed session on welfare cases, each motion passing 5‑0, and adjourned the meeting by a 5‑0 vote.

Room A 11 N 7th St Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 1 present
Lynn Limback present · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer yea
TMP-30622 — Approved a Motion
4 yea · 1 present
Lynn Limback present · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer yea
TMP-30623 — Approved a Motion
5 yea
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer yea
TMP-30624 — Approved a Motion
10 yea
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer yea · Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer yea
ADJOURNMENT — Approved a Motion
5 yea
Lynn Limback yea · Chris Steuber yea · Mitchell Ritter yea · Paul Prevo yea · Matthew Meyer yea
Wed Jun 18, 2025 · 5:00 PM

Parks and Recreation Commission

Parks commission to elect officers, consider CPS tennis court resurfacing

The Parks and Recreation Commission will vote on officer elections and discuss a proposed agreement with Columbia Public Schools (CPS) to resurface tennis courts at Cosmo-Bethel Park. They will also approve monthly reports for April and May 2025. After adjournment, members will tour several park projects including Cosmo Park, Albert-Oakland Park, and others.

parksrecreationtennis-courtscps-agreementofficer-electionscommission
Parks Management Center 1507 Business Loop 70 W Columbia, MO
Wed Jun 18, 2025 · 4:15 PM

Food Council

Food Council to discuss epinephrine access in schools

The Food Council will discuss updates on the Ozarks Food Harvest (OFBC) and county representation, and consider new business including epinephrine access in schools and public services, current food policy updates, and future food events.

foodpublic-healthschoolspolicyepinephrine
✓ Decided: Food Council approved agenda and corrected minutes unanimously

The council unanimously approved the meeting agenda after a motion by Tish Johnson. The minutes from the May 21 meeting were corrected to replace "CCLA Field Day" with "CCUA Field Day" and then approved unanimously. No other motions were adopted during the session.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Jun 17, 2025 · 5:30 PM

Public Transit Advisory Commission

Public Transit Advisory Commission to review May ridership data

The commission will discuss the annual report and the bus stop evaluation matrix. Members will also review ridership data from May 2025 for COMO routes and ParaTransit TigerLine.

public-transitridershiptransportation
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Tue Jun 17, 2025 · 4:30 PM

Commission on Cultural Affairs

Commission on Cultural Affairs to finalize FY26 Annual Arts Grants

The Commission will review applications and finalize scores for the FY26 Annual Arts Grants. Members will also receive updates on FY25 mid-year grant proposals and the Columbia Arts Fund.

artsgrantsfundingculture
✓ Decided: Commission approves Dismal Niche Arts FY25 grant change

The commission voted to table the proposed changes for Talking Horse Productions pending further clarification. It approved the recommended project change for Dismal Niche Arts under the FY25 Mid‑Year Grant. The commission also accepted the language of a letter urging continued federal support for the National Endowment for the Arts.

City Hall Council Chambers 701 E Broadway Columbia, MO
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
APPROVAL OF MINUTES — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
TMP-30538 — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
ADJOURNMENT — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
TMP-30537 — Approved a Motion
22 yea · 2 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea · Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
Mon Jun 16, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Committee discusses FY26 budget and parking rates

The Finance Advisory and Audit Committee will review the proposed FY26 budget and a parking rate analysis. They will also discuss the five-year trend manual, LAGERS pension topic, and the monthly economic report. The committee may approve prior meeting minutes and agenda items.

budgetparkingpensionsfinanceeconomic-reporttrends
✓ Decided: Committee approved agenda and postponed the parking‑rate report

The Finance Advisory and Audit Committee approved the meeting agenda after a motion by Minchew and a second by Schneeberger. The discussion of the city’s mission statement was deferred to a future meeting. The 2025 Budgetary Analysis Parking Rate report was postponed to the next meeting. No other formal actions were taken.

City Hall Council Chambers 701 E. Broadway Columbia, MO.
Mon Jun 16, 2025 · 5:00 PM

City Council

City Council to review pedestrian safety study and FY26 budget priorities

The City Council will review a presentation on a street and intersection pedestrian safety study. Members will also discuss FY26 budget priorities and interview applicants for the Water and Light Advisory Board.

pedestrian-safetybudgetpublic-worksappointments
✓ Decided: Council discussed pedestrian safety study and FY26 budget priorities

The council reviewed a draft pedestrian safety study and asked staff to provide feedback within the next few weeks. They also examined FY26 budget priority proposals—including housing, public safety, social services, technology, and infrastructure—and solicited input on which items to prioritize. No formal actions, approvals, or votes were recorded.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Jun 16, 2025 · 7:00 PM

City Council

Council to vote on rezoning 5320 Clark Lane and strategic plan update

The City Council will consider several items including the rescission and adoption of a new strategic plan for the city, a rezoning of property at 5320 Clark Lane from mixed-use neighborhood to mixed-use corridor, and multiple conditional use permits for short-term rentals. The agenda also includes a consent agenda with items such as a mutual aid fire agreement with Boonville and Mexico, a budget amendment, and setting public hearings for sidewalk projects and an annexation. New business includes first readings for a roundabout at Fairview and Chapel Hill roads and street improvements along Garth Avenue.

zoningstrategic-planshort-term-rentalsbudgetpublic-hearingsroadsfire-servicespolice
✓ Decided: Council adopts rezoning of 5320 Clark Lane and approves preliminary plat (5-1)

The City Council amended and adopted Policy Resolution PR56-25, voting 5‑1 to adopt it. The resolution includes rezoning 5320 Clark Lane from District M‑N to M‑C and approving the preliminary plat for the Armstrong Subdivision. The council also confirmed appointments to several boards and commissions.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
B124-25 — Passed
5 nay · 1 yea
Barbara Buffaloe nay · Nick Foster nay · Don Waterman yea · Betsy Peters nay · Valerie Carroll nay · Jacquelyn Sample nay
PR56-25 — Adopted
5 yea · 1 nay
Barbara Buffaloe yea · Nick Foster yea · Don Waterman nay · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
The other 21 items passed by unanimous or near-unanimous consent.
Fri Jun 13, 2025 · 9:30 AM

Police Retirement Board

Police Retirement Board to review financial reports

The Police Retirement Board will meet to approve the agenda and prior meeting minutes, and to review financial reports including revenue and expenses, the retire register, and the DROP report. No new business or old business items are listed, making this a largely procedural meeting.

policeretirementpensionsfinancecolumbia
✓ Decided: Police Retirement Board approved agenda and adjourned unanimously

The board unanimously approved the meeting agenda after a motion by Mr. Nichols and a second by Mr. Frede. The meeting was then adjourned unanimously following a motion by Mr. Nichols and a second by Mr. Frede. No other substantive actions were taken.

Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Fri Jun 13, 2025 · 8:30 AM

Investment Committee

Investment Committee to review policy and actuarial report

The Investment Committee will review an actuarial report and consider updates to the City of Columbia's Investment Policy. A presentation from UBS on alternative investment options is also scheduled. The agenda is focused on policy review and financial reporting, with no specific projects or contracts up for vote.

investmentpolicyfinanceactuarialcommittee
✓ Decided: Committee approved investment allocation shift and policy amendment

The Investment Committee unanimously approved moving 1.5% of the JP Morgan High Yield fund to the Vanguard Long Term corporate bond fund. The committee also unanimously approved the proposed amendments to the City’s Investment Policy Statement, with the exception of section thirteen, which will be revised as discussed. Both motions were adopted without opposition.

Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Fri Jun 13, 2025 · 8:00 AM

Firefighters' Retirement Board

Firefighters' Retirement Board reviews financial reports

The board will receive financial reports including the retirement register, DROP report, and revenue/expenses. No major decisions are on the agenda; the meeting is largely procedural with no old business.

firefightersretirementboardfinancescolumbia
✓ Decided: Board unanimously approved the agenda and adjourned the meeting

The Firefighters' Retirement Board approved the meeting agenda with a unanimous vote. No minutes were approved; the December 13, 2024 draft minutes were deferred to the September 12, 2025 meeting. The board then adjourned the meeting unanimously.

Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Thu Jun 12, 2025 · 12:00 PM

Columbia Sports Commission

Columbia Sports Commission meeting canceled

The regular meeting scheduled for June 12, 2025, was canceled due to a lack of quorum.

sports-commissioncanceled-meeting
Columbia Sports FIeldhouse - Meeting Room 4251 Philips Farm Rd Columbia, MO
Thu Jun 12, 2025 · 5:30 PM

Board of Health

Board to consider dog/cat limits and dangerous animal rules

The Board of Health will discuss amendments to Section 5-57 on dangerous or aggressive animals and a proposed new Section 5-60 limiting the number of dogs and cats kept. The board will also receive a Director's Report and consider approval of previous meeting minutes.

board-of-healthanimal-controldogscatsordinancespublic-health
Columbia/Boone County Public Health & Human Service Training Room 1 1005 W. Worley St Columbia, MO.
Thu Jun 12, 2025 · 3:00 PM

Disabilities Commission

Commission to discuss Complete Streets Project with consultants

The Disabilities Commission will hold a discussion with CMT Consultants on the Complete Streets Project, consider an award-based program for accessible public businesses, and review nominations for the Senator Chuck Graham Disability and Advocacy Award. The agenda also includes approval of minutes from May 8 and reports from various committees.

disabilitiescomplete-streetsaccessibilityawardspublic-transportationcity-planning
✓ Decided: Commission approved two 2025 Chuck Graham Disability Awards: Jeff Johnson and a library

The commission approved the meeting agenda amendment adding an ADA Grievance Form, approved past meeting minutes, and voted to send a report on the Dawn Z Accessibility Program to City Council. It also approved two 2025 Chuck Graham Disability and Advocacy Awards—one for individual Jeff Johnson and one for the Daniel Boone Regional Library. The meeting was then adjourned.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Jun 11, 2025 · 8:00 AM

Water and Light Advisory Board

Board will discuss the Water Distribution System Master Plan

The Water and Light Advisory Board will review the final Water Distribution System Master Plan report. Financial reports for April 2025 water and electric usage will be presented. The board will also consider recommendations for water cost of service and rate structure changes. Public email comments on water property tax and net‑metered calculations will be noted.

waterutilitybudgetratespublic-comments
✓ Decided: Board unanimously approved agenda amendment and meeting minutes

The Water and Light Advisory Board moved the discussion of the draft water rates forward by amending the agenda, and the motion passed unanimously. The board also approved the May 8 and May 14 meeting minutes as submitted, with a unanimous vote.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Jun 11, 2025 · 6:00 PM

Citizens Police Review Board

Citizens Police Review Board to review use-of-force complaints

The Citizens Police Review Board will meet to approve previous minutes and receive a report from the Human Rights Commission. The board will enter a closed session to review use-of-force complaints and provide updates on specific administrative cases.

police-oversightuse-of-forcepublic-safetycivil-rights
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Jun 11, 2025 · 3:00 PM

Parking Advisory Commission

Parking Advisory Commission to review Walker cost report and parking revenue

The commission will discuss a cost report for the 5th and Walnut and the Ramp projects. Members will also receive updates on the Walker project and on-street parking revenue.

parkinginfrastructurerevenuecity-planning
Room 1A/1B 701 E. Broadway City Hall
Tue Jun 10, 2025 · 7:00 PM

Board of Adjustment

Board will hear request to apply cottage standards to 32‑lot Wyatt Acres subdivision

The Board of Adjustment will hold a public hearing on case 200‑2025. The hearing concerns a request by property owner Adam Kopriva to use the “cottage” optional development standards for a proposed 32‑lot subdivision called Wyatt Acres at 4100 N. Wyatt Lane. The request is made under Section 29‑6.4(j) of the Unified Development Code.

zoningdevelopmentpublic-hearingsubdivisioncode
Columbia City Hall Council Chambers 701 E Broadway
Thu Jun 5, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to consider citywide short-term rental regulation changes

The Planning and Zoning Commission will hold public hearings on several rezoning requests and short-term rental permits. The body is also considering citywide amendments to the Unified Development Code regarding the regulation of short-term rentals.

zoningshort-term-rentalsannexationcommercial-developmenthousing
Columbia City Hall Council Chambers 701 E. Broadway
Thu Jun 5, 2025 · 5:30 PM

Planning and Zoning Commission

Columbia P&Z to discuss definition of 'Family' and parking standards

The Planning and Zoning Commission will hold a work session to review a draft definition of 'Family' and related parking standard revisions. The meeting is scheduled for June 5, 2025, at 5:30 PM.

planningzoningfamily-definitionparkingwork-session
✓ Decided: Commission directs staff to gather public comments on family definition

The Planning and Zoning Commission adopted the agenda unanimously and approved the May 22 work‑session minutes unanimously, with three members abstaining. Commissioners discussed a proposed revision to the definition of “family” in the Unified Development Code and related parking standards, but no formal vote was taken. The Chair instructed staff to collect public comments and report back at the July 10 work session.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
TMP-30469 — Approved a Motion
6 present · 3 abstain
Anthony Stanton present · Sharon Geuea Jones present · Shannon Wilson present · Robert Walters present · McKenzie Ortiz present · David Brodsky present · Les Gray abstain · Kate Stockton abstain · Cody Darr abstain
ADJOURNMENT — Approved a Motion
9 yea
Anthony Stanton yea · Sharon Geuea Jones yea · Shannon Wilson yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea · Les Gray yea · Kate Stockton yea · Cody Darr yea
Thu Jun 5, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Mayor's Council on Physical Fitness and Health to discuss summer events

The Mayor's Council on Physical Fitness and Health will meet to review reports from the mini-grant subcommittee and Bike, Walk and Wheel Week. The council will discuss potential summer tabling events, including the Family Fun Fest on July 16.

healthfitnesscommunity-eventspublic-health
ARC Meeting Room 1701 W. Ash Columbia, MO
Wed Jun 4, 2025 · 6:30 PM

Community Land Trust Organization Board

Board to discuss land donation and 2025-2027 strategic plan

The Community Land Trust Organization Board will meet to review financial statements and a land donation from homeowner Pat Fowler. The board is also scheduled to discuss the 2025-2027 Strategic Plan and maintenance for 115 Lynn.

land-truststrategic-planningreal-estateproperty-maintenance
✓ Decided: Board ended current mowing contract and started renegotiating city services contract

The board approved the meeting agenda, the May 7 minutes, and the treasurer’s report showing a $34,837 balance. It voted to let the existing grass‑mowing contract expire, keep snow‑removal, and modify services for bio‑retention areas. The board also approved beginning renegotiation of the contract between the Columbia Community Land Trust and the City of Columbia. The meeting adjourned at 8:41 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 5 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
TMP-30500 — Approved a Motion
5 yea · 5 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
TMP-30501 — Approved a Motion
5 yea · 5 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
TMP-30503 — Approved a Motion
5 yea · 5 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
TMP-30504 — Approved a Motion
5 present · 4 yea · 1 abstain
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt abstain · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
ADJOURNMENT — Approved a Motion
5 yea · 5 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
Tue Jun 3, 2025 · 5:30 PM

Commission on Human Rights

Commission to review enforcement procedures for Chapter 12-57, discuss sanctioned camps

The Commission on Human Rights will review the enforcement procedures for Chapter 12-57 of the Code of Ordinances and discuss the topic of sanctioned camps. They will also consider a Juneteenth vendor opportunity and then move into closed session to discuss pending cases (2025-0003, 2025-0004, 2025-0005) under state law exemptions.

human-rightscode-of-ordinancesenforcementsanctioned-campsjuneteenthclosed-sessionlitigation
✓ Decided: Commission canceled the July meeting due to quorum and scheduling conflicts

The commission unanimously approved the meeting agenda, the draft minutes, and the closed‑meeting minutes. It voted to enter and later exit a closed session. The commission also unanimously canceled the July meeting and adjourned.

Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-30435 — Approved a Motion
5 yea · 2 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum yea · Paige Lubbering present · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
5 yea · 2 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum yea · Paige Lubbering present · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
Tue Jun 3, 2025 · 5:30 PM

Historic Preservation Commission

Historic Preservation Commission to discuss proposed $158M federal funding cuts

The commission will review the latest draft of the Preservation Plan and plan logistics for the third public input session. Staff will report on proposed $158 million federal cuts to the Historic Preservation Fund. The commission will also discuss activities and staffing for a Juneteenth booth.

historic-preservationpreservation-planfederal-fundingpublic-inputjuneteenthcity-of-columbia
✓ Decided: Commission unanimously approved agenda and minutes, then adjourned

The Historic Preservation Commission approved the meeting agenda and the May 6 minutes by unanimous voice vote. No demolition permit applications were reviewed. Staff presented an updated interactive historic property map and discussed future presentation to City Council. Commissioners organized feedback on the preservation plan, arranged a public input session for July 1, and confirmed a Juneteenth booth, then adjourned at 7:03 PM.

Conference Room 1B City Hall 701 E. Broadway
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 1 absent
Melissa Hagen absent · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
5 present · 1 absent
Melissa Hagen absent · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
Mon Jun 2, 2025 · 5:00 PM

City Council

Council to discuss Material Recovery Facility feasibility and recycling evaluation

The City Council will discuss the Material Recovery Facility during a pre-council session, with a presentation and reports on feasibility and waste diversion. No formal votes are on the agenda; this is a discussion only. The meeting also includes time for any other items council members wish to discuss.

recyclingwaste-diversionmaterial-recovery-facilitycity-council
✓ Decided: Council discussed recycling facility options but took no formal action

The council reviewed three potential sites for a new Material Recovery Facility and considered a transfer option and a multimaterial environmental center. Council members requested more detailed cost comparisons and asked that automated recycling costs be included in the upcoming budget. No votes or formal approvals were recorded.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Jun 2, 2025 · 7:00 PM

City Council

Council to vote on Twin Lakes Recreation Area improvements

The City Council will hold a public hearing and take a final vote on approving a revised master plan and authorizing construction of improvements at Twin Lakes Recreation Area. The consent agenda includes multiple items such as conditional use permits for short-term rentals, annexation agreements, a road audit of the Business Loop 70 corridor, and mutual aid fire services agreements. Several items receive first reading, including a rezoning at 5320 Clark Lane. The meeting also includes the swearing in of a new Utilities Director.

zoningshort-term-rentalsparks-and-recreationbudgettransportationannexationutilitiesfire-services
✓ Decided: Council approves Twin Lakes park upgrades and several short‑term rental permits

The council adopted the revised Twin Lakes Recreation Area Master Plan and authorized construction of improvements, voting 5‑0. It also approved conditional use permits for short‑term rentals at 221 Brenda Lane, 115 Clinton Drive, and 1010 W. Broadway, each with a 5‑0 vote. A series of consent‑agenda items were enacted, including vacating portions of Artemis Drive, amending the Discovery Apartments development, and authorizing an annexation agreement with D & D Investments. The council adopted a resolution to temporarily close sidewalks and parking stalls on Eighth Street and Broadway for Central Bank building repairs, also by a 5‑0 vote.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (19 roll-call votes)
Named votes as recorded in the official record.
B109-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B110-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B115-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B119-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B120-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B111-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B117-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B116-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B112-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B113-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B114-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B107-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B121-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B118-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B106-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
B108-25 — Passed
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
R79-25 — Adopted
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
R78-25 — Adopted
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
R77-25 — Adopted
5 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample absent
Thu May 29, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council to discuss potential mini grant program for physical fitness and health

The Mayor's Council on Physical Fitness and Health will discuss creating a mini grant program, including qualifications, budget/grant amounts, and application methods. This is a discussion item only; no decisions are scheduled. The meeting is open to the public.

healthfitnessgrantsmayors-councilcommunity
ARC Conference Room 1701 W. Ash, Columbia, MO
Wed May 28, 2025 · 3:00 PM

Airport Advisory Board

Airport board to discuss parking violations, marketing strategy, car rental walkway

The Columbia Regional Airport Advisory Board will discuss parking violations as old business, and hear a marketing strategy presentation from The Quotient Group. A walkway to the future car rental facility is also on the new business agenda. The board will also approve minutes from March 25, 2025.

airportparkingmarketingcar-rentalfacilitiescolumbia
✓ Decided: Board changed order, deferred March minutes, and approved a parking ordinance letter

The board unanimously approved moving new business before old business on the agenda. Approval of the March 25, 2025 meeting minutes was deferred to the next meeting. The board passed a motion to draft a letter to the mayor and council urging adoption of a parking ordinance to address abandoned vehicles.

Columbia Regional Airport Terminal Conference Room 11350 Airport Drive Columbia MO
Thu May 22, 2025 · 2:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO to consider TIP amendment and reclassify Ash Street

The Columbia Area Transportation Study Organization will hold public hearings to consider amending the FY 2025-2028 Transportation Improvement Program and reclassifying Ash Street from a major to a neighborhood collector. The meeting will also include a public hearing for an update to the Coordinated Public Transit-Human Services Transportation Plan.

transportationpublic-hearingash-streetzoningcouncilcolumbia-motiproads
✓ Decided: CATSO approves $668,521 amendment to FY 2025‑2028 Transportation Improvement Program

The Coordinating Committee unanimously approved the meeting agenda and the minutes from the February 25 meeting. It then approved a proposed amendment to the FY 2025‑2028 Transportation Improvement Program that adds a new project costing $668,521, with $568,243 federal (FTA) funds and a $100,278 local match, an 85‑15 split. No vote was taken on the Ash Street reclassification; the committee indicated it will hold a public hearing and consider a corridor‑study scope before any change.

Council Chamber City Hall 701 E. Broadway Columbia, Missouri
Thu May 22, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss short-term rental rules and 'family' definition

The Planning and Zoning Commission holds a work session to follow up on two pending amendments to the Unified Development Code: short-term rental use-specific standards and the definition of 'family.' No votes are scheduled; the session is for discussion only.

planningzoningshort-term-rentalsudcdefinition-of-familywork-session
✓ Decided: Commission directed staff to revise short‑term rental rules to allow parking relief

The agenda and the May 8 work‑session minutes were approved unanimously. Commissioners voted to direct staff to modify the short‑term rental amendment text and retain provisions that provide parking relief. Staff was instructed to prepare the final amendment draft for a public hearing on June 5. The discussion on a new definition of “family” was deferred to the next work session.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30406 — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Thu May 22, 2025 · 7:00 PM

Planning and Zoning Commission

Public hearing on short-term rental at 209 Alexander Avenue

The Planning and Zoning Commission will hold a public hearing on a request to allow a portion of the dwelling at 209 Alexander Avenue to operate as a short-term rental. The proposal seeks up to 6 transient guests and a maximum of 210 nights per year in an R-2 (Two-Family Dwelling) zone. The commission will consider approval of a conditional use permit and also review minutes from the May 8, 2025 meeting.

zoningshort-term-rentalpublic-hearingconditional-useplanning-and-zoning
✓ Decided: Commission unanimously recommends approving STR permit for 209 Alexander Ave

The Planning and Zoning Commission approved its agenda unanimously and approved the May 8 meeting minutes with eight votes in favor and one abstention. The commission then voted 9‑0 to recommend approval of a conditional use permit for a short‑term rental at 209 Alexander Avenue, subject to a maximum of 210 nights per year and no more than six transient guests. The recommendation will be forwarded to City Council.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30407 — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30410 — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Wed May 21, 2025 · 5:00 PM

Tree Board

Tree Board to discuss City Tree Fund with Council

This meeting will include election of officers and discussion of the City Tree Fund, with plans to address the topic with the City Council. The board will also review upcoming outreach and education opportunities, and receive an update from the city arborist on current projects.

treesurban-forestrycity-council-fundingoutreacheducationarborist-report
✓ Decided: Board tables election of officers and city tree fund discussions

The Tree Board approved the meeting agenda and the minutes from the prior meeting. It voted to table the discussion on electing officers and on the City Tree Fund. The meeting was adjourned at 5:41 PM.

City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 3 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
ELECTION OF OFFICERS — Tabled
4 yea · 3 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
CITY TREE FUND — Tabled
4 yea · 3 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
5 yea · 2 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed May 21, 2025 · 7:00 PM

Housing and Community Development Commission

✓ Decided: Commission approved meeting agenda unanimously

The Housing and Community Development Commission approved the meeting agenda with a 6‑0 vote. No other actions were voted on. The commission heard presentations from Job Point and Upwards Care about FY26 CDBG and HOME funding requests, but no decisions were made on those proposals.

City Hall Council Chambers 701 E. Broadway Columbia, MO.
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 1 present
Mitchell Ritter yea · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh present · Scott Cristal yea · Ryan King yea · Elizabeth Downing yea
ADJOURNMENT — Approved a Motion
6 yea · 1 present
Mitchell Ritter yea · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh present · Scott Cristal yea · Ryan King yea · Elizabeth Downing yea
Wed May 21, 2025 · 4:15 PM

Food Council

Columbia Food Council to discuss OFBC and county representation

The Food Council will meet to review updates regarding the OFBC and county representation. The body will also discuss the meeting schedule and current food policy updates.

food-policycounty-representationpublic-health
✓ Decided: Council approved drafting a letter to add county representatives to the Food Council

The council unanimously approved the agenda and the meeting minutes. Members voted to move forward with drafting a letter to the city council requesting an ordinance amendment to add two county representatives to the Food Council. The group decided to keep the current meeting day and time for now. The meeting was adjourned unanimously at 5:09 p.m.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue May 20, 2025 · 3:00 PM

Mayor's Task Force on the U.S.S. Columbia

Task Force discusses 30th anniversary plans and submarine updates

The Mayor's Task Force on the U.S.S. Columbia will meet to discuss old business including a new member appointment, Christmas cards, and a review of the 2024 crew visit. New business includes planning for the 30th anniversary of the submarine's commissioning, possible dates, and a Mayor's reception with the Chamber of Commerce. Reports on submarine updates will also be presented. No formal decisions are expected, but the group will discuss and coordinate upcoming events.

uss-columbiatask-forcenaval-relationseventsanniversarysubmarine
✓ Decided: Task Force approved agenda, minutes and adjourned the meeting

The board approved the meeting agenda and the minutes from the October 22, 2024 meeting, each by a motion that carried. The meeting was then adjourned by a motion that also carried. No other formal actions were taken.

Walton Building Board Room 300 S. Providence Rd. Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 1 present
Anne Moore yea · Anne Clark yea · John Clark yea · Peter Koukola present · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
APPROVAL OF MINUTES — Approved a Motion
8 yea · 1 present
Anne Moore yea · Anne Clark yea · John Clark yea · Peter Koukola present · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Anne Moore yea · Anne Clark yea · John Clark yea · Peter Koukola present · Robert Ross yea · Becky Wischmeyer yea · Marty Walker yea · Chris Kelly yea · Walter Lantzy yea
Tue May 20, 2025 · 12:00 PM

City of Columbia New Century Fund, Inc. Board

Board to discuss future planning, bylaws changes, and term limits

The New Century Fund Board will consider planning for the fund's future, discuss potential changes to bylaws and board term limits, and take up items including the Share the Light program, advertising, and the Lang Award. The meeting includes approval of past meeting minutes and public comment.

new-century-fundboard-meetingbylawsterm-limitsadvertisingawardsfuture-planning
✓ Decided: Board approved moving NCF funds to City’s pooled account at Commerce Bank

The board voted to transfer the New Century Fund accounts from the Community Foundation to the City’s pooled account at Commerce Bank. Blake Willoughby was unanimously approved as Chair. Tim Howald and Keri Gilbert were confirmed to continue as Treasurer and Secretary respectively.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
Tue May 20, 2025 · 5:30 PM

Public Transit Advisory Commission

Transit commission to review bus stop evaluation matrix and ridership data

The commission will discuss old business including Earth Day outreach, the annual report, and a bus stop evaluation matrix. New business is not listed. Members will also review April ridership data from Go COMO and receive updates from City Council and other commissions on Vision Zero, disability, bike/ped, and CATSO.

public-transitadvisory-commissionridershipbus-stopsvision-zeroannual-reportearth-day
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon May 19, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Convention and Visitors Advisory Board to review strategic plan update

The board will meet to discuss an update to the CVB Strategic Plan. The meeting includes reports from The District and the Boone County Commission.

tourismstrategic-planningeconomic-development
✓ Decided: Board approved agenda and minutes; no substantive actions taken

The Convention and Visitors Advisory Board approved the meeting agenda and the prior meeting minutes, both motions passing. No new business or substantive decisions were made during the session.

Walton Building Community Room 300 S. Providence Columbia, MO.
Mon May 19, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Finance Advisory and Audit Committee to review parking rate analysis

The committee is meeting to discuss financial reports and administrative reviews. Key items include a parking rate analysis and an actuarial report for the Police and Firemen's Retirement Fund.

financeparking-ratespensionseconomic-reportsaudit
City Hall Council Chambers 701 E. Broadway Columbia, MO.
Mon May 19, 2025 · 7:00 PM

City Council

Council to vote on pedestrian improvements cost share for I-70/US 63 interchange

The Columbia City Council holds public hearings on sanitary sewers for Henderson Branch Watershed and Strawn Park Phase III improvements. It takes final votes on a cost-share agreement for pedestrian improvements at the I-70/US 63 interchange and a rezoning on Merideth Drive. Several short-term rental conditional use permits and a consent agenda with health department contracts are also up for decision.

transportationinfrastructurezoningparksshort-term-rentalspublic-healthbudget
✓ Decided: Council approved sanitary sewer design for Henderson Branch and connection fee

The Council authorized staff to proceed with the final design of the Henderson Branch sanitary sewer extension and to establish a special connection fee, passing the motion 5‑1. It also approved the Strawn Park Phase III improvement project and amended a cost‑share agreement for pedestrian improvements at the I‑70/US‑63 interchange, both unanimously. Several board and commission members were appointed, and the consent agenda items B79‑25 through B87‑25 were adopted.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (38 roll-call votes)
Named votes as recorded in the official record.
B101-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B104-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B96-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B98-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B90-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B91-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B92-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B93-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B94-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B89-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B102-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B103-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B100-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B95-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B99-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B105-25 — Passed
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R66-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R67-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R69-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R65-25 — Adopted
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Mon May 19, 2025 · 5:00 PM

City Council

Council to discuss labor negotiations in closed session

The City Council will hold a pre-council meeting featuring a closed session to discuss negotiations with employee groups CPOA, Local 1055, and Local 955. The agenda also includes interviews for Planning and Zoning Commission applicants and annual presentations from labor groups. No voting items are listed.

city-councillabornegotiationsclosed-sessionplanning-and-zoning
✓ Decided: City Council approved closed‑session meeting to discuss employee‑group negotiations

Mayor Buffaloe moved at 6:22 p.m. to enter a closed session to discuss preparation for negotiations with employee groups, and Council Member Waterman seconded the motion. The council then entered closed session at 6:25 p.m. in Conference Room 1A/1B. No other substantive actions were recorded.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-30359 — Approved a Motion
6 yea
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Fri May 16, 2025 · 8:30 AM

City Council

Council retreat discusses future direction and strategic plan for Columbia

The City Council will hold a two‑day retreat at the Old Kinderhook Hotel. Council members will discuss topics such as the future of Columbia, community summit report, strategic planning, and departmental updates. The agenda lists tentative discussion items for each day and allows additional items at the council's discretion.

governancestrategic-planningcommunity-engagementretreat
✓ Decided: Council adopts plan to create a legislative priority process like Springfield

The council agreed to implement a Springfield‑style process for setting legislative priorities, with drafts prepared in June and a resolution expected in October or November. The council also tabled a proposal to amend the definition of “equity” in the strategic plan, scheduling it for reconsideration on June 16. Staff will continue to review the Community Summit report as the council plans upcoming agenda items.

Old Kinderhook Hotel 678 Old Kinderhook Dr. Camdenton, MO. 65020
Thu May 15, 2025 · 10:00 AM

City Council

City Council holds two‑day retreat to discuss strategic planning

The City Council will hold a two‑day retreat at the Old Kinderhook Hotel. Council members will discuss a series of tentative topics, including the future of Columbia, communication, governance, and a community‑summit strategic plan. No formal actions or votes are scheduled; the agenda is for discussion and networking.

retreatstrategic-plancommunity-summitgovernancenetworking
✓ Decided: Council tables council‑member stipend proposal

The council voted to table the stipend research for elected officials until a later date. It also agreed to review board and commission budget requests after the retreat and to develop policy guidance for prioritizing board and commission training. The council will consider piloting off‑week Monday work sessions later in the year.

Old Kinderhook Hotel 678 Old Kinderhook Dr. Camdenton, MO. 65020
Wed May 14, 2025 · 8:00 AM

Water and Light Advisory Board

Water and Light board to discuss water cost of service study, review FY2024 report

The Water and Light Advisory Board will review the FY2024 annual comprehensive financial report, discuss a water cost of service study that could affect future rates, and receive updates on capital improvement projects, renewable energy plans, and electric capacity needs. The board will also hear a director's report on pending disconnections and consider a utility survey and renewable energy requirement from the public.

waterelectriccost-of-servicefinancial-reportrenewable-energycapacity-planningutility-survey
✓ Decided: Board approved meeting agenda unanimously

The Water and Light Advisory Board approved the meeting agenda and the April 9, 2025 minutes, each by unanimous vote. No other actions were voted on. The board deferred recommendations on the Water Cost of Service Study to the next meeting on June 11, 2025.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed May 14, 2025 · 7:00 PM

Housing and Community Development Commission

Housing commission to review 2026 needs survey and reallocated funding

The Housing and Community Development Commission will discuss the 2026 Housing and Community Development Needs Survey and review reallocated funding recommendations for various city projects and non-profits. The meeting will also cover public project requests and approve previous meeting minutes.

housingcommunity-developmentbudgetcolumbia-moreallocated-fundssurveypublic-worksnon-profits
✓ Decided: Commission unanimously approved agenda and prior meeting minutes

The Housing and Community Development Commission voted 8‑0 to approve the meeting agenda. It also voted 8‑0 to approve the minutes from the April 16, 2025 meeting. No other actions were decided; a code‑enforcement funding request was presented but not voted on.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea
Mitchell Ritter yea · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
TMP-30395 — Approved a Motion
8 yea
Mitchell Ritter yea · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
TMP-30398 — Approved a Motion
8 yea
Mitchell Ritter yea · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
ADJOURNMENT — Approved a Motion
8 yea
Mitchell Ritter yea · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
Wed May 14, 2025 · 12:00 PM

Substance Use Prevention Advisory Commission

Meeting cancelled — no business conducted

This meeting of the Substance Use Prevention Advisory Commission was cancelled. No items were discussed or decided.

cancelledsubstance-use-preventionadvisory-commissioncolumbia-missouri
Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed May 14, 2025 · 6:00 PM

Citizens Police Review Board

CPRB to discuss closed session topics and review complaint data

The Citizens Police Review Board will approve minutes from April 9, 2025, and review a plan for analyzing 2024 complaint data. The board will also consider a motion to enter closed session to discuss specific records and complaints.

cprbpolicecomplaintsminutestraining
✓ Decided: Board approved agenda amendment adding CPD complaint process and anonymous complaints

The board unanimously approved an amendment to the agenda to add the CPD complaint process and anonymous complaints to new business. It also unanimously approved the draft open and closed session minutes from the April 9, 2025 meeting. By consensus the board decided to print 25 brochures for each member and additional copies for public areas. The board agreed to review the first six use‑of‑force complaints from 2024 and voted to enter a closed session to discuss protected records.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed May 14, 2025 · 3:00 PM

Parking Advisory Commission

Parking Commission to discuss meter changes and revenue

The Parking Advisory Commission will consider proposed meter changes and their layout, as well as review parking occupancy data and revenue. No votes on specific ordinances or contracts are listed; the items are discussion-oriented.

parkingmeter-changesrevenuecity-commission
Room 1A/1B 701 E. Broadway City Hall
Tue May 13, 2025 · 5:00 PM

City Council

Council meets in closed session for legal, personnel, and contract talks

This special meeting has no public agenda. The Council is immediately voting to go into a closed meeting to discuss legal actions, personnel matters, employee negotiations, sealed bids, and personnel records. No public decisions or ordinances are scheduled.

closed-sessionlegalpersonnelemployee-negotiationscity-councilcolumbia-mo
✓ Decided: Council approved moving into closed session to discuss confidential matters

Mayor Barbara Buffaloe moved to enter a closed meeting to discuss legal actions, personnel matters, sealed bids and other confidential topics. Council Member Betsy Peters seconded the motion. The motion passed with six yes votes (Foster, Waterman, Peters, Buffaloe, Carroll, Sample) and no no votes; Council Member Lisa Meyer was absent. The council entered closed session in Conference Room 2A and adjourned the closed meeting at 7:18 p.m.

City Hall Council Chamber 701 E. Broadway Columbia, MO
Tue May 13, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council to discuss 2025 Youth Summit

The Youth Advisory Council will meet to discuss the 2025 Youth Summit and the council's annual report. The body will also review updates regarding City Council meeting attendees.

youth-servicescommunity-engagementcity-government
✓ Decided: Youth Advisory Council moved its annual report to the fall

The council approved its meeting agenda and the minutes from March 11 and April 1, 2025. A motion to shift the annual report to the fall was passed unanimously. The meeting was then adjourned unanimously.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon May 12, 2025 · 4:15 PM

Commission on Cultural Affairs

Commission on Cultural Affairs to discuss grant funding and public art

The Commission on Cultural Affairs will meet to review annual grant funding evaluations and the status of FY25 funding. The body will also receive reports on the Columbia Arts Fund and the Celebration of the Arts.

artsculturegrantspublic-artfunding
✓ Decided: Commission approved four public‑art licenses for the city’s program

The commission voted to approve four artwork recommendations submitted by the Standing Committee on Public Art for the Public Art License Program. The approved works will be licensed at $500 each and added to the city’s public‑art collection. The commission also agreed that Chair Moxon will draft a formal letter to support local arts organizations in response to recent NEA grant cuts.

City Hall Council Chambers 701 E. Broadway Columbia, MO
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 3 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea
APPROVAL OF MINUTES — Approved a Motion
8 yea · 3 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea
TMP-30322 — Approved a Motion
8 yea · 3 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea
ADJOURNMENT — Approved a Motion
8 yea · 3 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea
Thu May 8, 2025 · 1:00 PM

Water and Light Advisory Board

Advisory board to review MISO market and capacity auction results

The Water and Light Advisory Board will hear presentations from The Energy Authority on MISO market operations, including a daily market overview, market updates, load forecasting, and capacity auction results. No voting items are listed; the session is informational.

energyadvisory-boardmisoload-forecastingcapacity-auction
✓ Decided: Board held Energy Authority presentation; no decisions were made

The Water and Light Advisory Board met on May 8, 2025 to hear a presentation by the Energy Authority covering market updates and load forecasting. No agenda items were voted on or acted upon. The meeting adjourned at 4:11 p.m.

701 E Broadway Columbia, MO Conference Room 1A/1B
Thu May 8, 2025 · 1:00 PM

City Council

Council hears TEA presentation on MISO market and capacity auction results

This is an informational meeting with no voting items. The City Council will receive a presentation from The Energy Authority covering MISO market operations, load forecasting, and recent capacity auction results.

energymisopresentationload-forecastingcapacity-auction
✓ Decided: Council heard an Energy Authority presentation, no actions taken

The council met on May 8, 2025, and heard a presentation covering the Energy Authority, MISO market overview, load forecasting, and capacity auction results. No motions, approvals, or votes were recorded. The meeting adjourned at 4:11 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Thu May 8, 2025 · 12:00 PM

Columbia Sports Commission

Update on 1Movement Hoops Sports Development Fund Application

The Columbia Sports Commission will receive an update on the 1Movement Hoops Sports Development Fund application. The commission will also review the May Sports Commission Report and related post‑event reports for basketball events in 2024 and 2025. No formal decisions are listed on the agenda.

sportsreportsdevelopment-fundbasketballcommunity
✓ Decided: City Council approved $10,000 for 1Movement Hoops Sports Development Fund

The Sports Commission approved its agenda and the April 2025 meeting minutes. The commission noted that the City Council approved a $10,000 grant to the 1Movement Hoops Sports Development Fund. No new business was taken and the meeting was adjourned unanimously.

Columbia Sports FIeldhouse - Meeting Room 4251 Philips Farm Rd Columbia, MO
Thu May 8, 2025 · 5:30 PM

Board of Health

Board of Health to consider dangerous/aggressive animal ordinance changes

The Board of Health will discuss old business on the Feral Cat Colony Caretaker Permit (Sec. 5-112(a)(4)) and new business on adding language to the Dangerous or Aggressive Animals section (Sec. 5-57). The board will also review its roles and expectations and hear the Director's Report.

healthanimalsferal-catsdangerous-animalsboard-of-health
✓ Decided: Board approved updates to feral cat colony and dangerous animal ordinances

The Board of Health unanimously accepted the revised language for the feral cat colony ordinance, including a broader definition and a one‑time rabies vaccination requirement. The board also unanimously approved added provisions to the dangerous or aggressive animals ordinance, such as hearing rights and signage requirements. The next meeting will address the household limit of four dogs or cats.

Columbia/Boone County Health & Human Services Training Room 1 1005 W. Worley St. Columbia, MO.
Thu May 8, 2025 · 8:00 AM

Railroad Advisory Board

Railroad Advisory Board to review traffic and financial reports

The Railroad Advisory Board will meet to review financial statements for the Railroad and Transload utilities. The board will also examine COLT traffic reports and year-to-date comparisons for April 2025.

railroadtransportationfinancetraffic-reports
✓ Decided: Board unanimously approved agenda amendment and prior meeting minutes

The Railroad Advisory Board approved an amendment to the agenda to include Old Business and New Business, with a unanimous vote. The minutes from the February 13, 2025 meeting were also approved unanimously. The meeting was then adjourned by unanimous consent.

701 E Broadway Columbia, MO Conference Room 1C
Thu May 8, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission discusses award program for accessible businesses and Paratransit

The Disabilities Commission will hold discussions on several old business items, including a proposed award-based program for accessible public businesses, Paratransit and trip capacity, and nominations for the Senator Chuck Graham Disability and Advocacy Award. They will also review ADA grievance forms and online reporting. Reports from the staff, the MU Chancellor's Committee, and working groups will be presented. No final decisions or votes are scheduled; the meeting is primarily for discussion and updates.

disabilitiesaccessibilityparatransitawardsadaoutreachearth-day
✓ Decided: Commission approved agenda and postponed several items to June

The Disabilities Commission approved the meeting agenda unanimously. Approval of the March 13 and April 10, 2025 meeting minutes was postponed until the June meeting. Discussions on the award‑based accessibility program and the ADA grievance form were also tabled for future meetings. The meeting was adjourned by unanimous vote.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Thu May 8, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss short-term rental regulations

The Planning and Zoning Commission will hold a work session to follow up on Unified Development Code (UDC) amendments. The discussion focuses on use-specific standards for short-term rentals.

zoningshort-term-rentalsudc-amendments
✓ Decided: Commission appointed interim secretary and approved agenda and minutes

The Planning and Zoning Commission unanimously approved the meeting agenda and the April 24 minutes. Commissioners appointed David Brodsky as interim secretary until the September/October election. The commission accepted the inclusion of M‑OF, M‑N, M‑C, and M‑DT districts in the proposed short‑term‑rental tier structure, kept the school‑proximity CUP trigger, and agreed to add a parking trigger to the final draft regulations.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30272 — Approved a Motion
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Thu May 8, 2025 · 7:00 PM

Planning and Zoning Commission

Rezoning 2.56 acres at 5320 Clark Lane from Mixed‑Use Neighborhood to Mixed‑Use Corridor

The Planning and Zoning Commission will consider rezoning a portion of the 6.80‑acre site at 5320 Clark Lane and approve a 7‑lot preliminary plat for the Armstrong Subdivision. It will also review rezoning and a 23‑lot preliminary plat for the 5.09‑acre property at 3310 Oakland Gravel Road. Additional items include Conditional Use Permits for accessory dwelling units at 2317 Cherry Ridge Court and 1120 Westwinds Drive, and short‑term rental permits for 1617 Highridge Circle and 534 West Southampton Drive.

zoningdevelopmenthousingaccessory-dwellingsshort-term-rentals
✓ Decided: Commission approved rezoning of 2.56 acres at 5320 Clark Lane to M‑C (6‑2)

The Planning and Zoning Commission unanimously approved its agenda and approved the April 24 minutes with seven votes in favor and one abstention. A withdrawn case (121‑2025) was removed from the agenda. The commission voted 6‑2 to approve Case 154‑2025, rezoning 2.56 acres of the 5320 Clark Lane site from M‑N to M‑C, and will forward the recommendation to City Council.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
TMP-30269 — Approved a Motion
6 yea · 2 nay · 1 present
Sara Loe nay · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier nay · Shannon Wilson present · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30270 — Approved a Motion
7 yea · 1 nay · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier nay · Shannon Wilson present · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30265 — Approved a Motion
4 nay · 4 yea · 1 present
Sara Loe nay · Anthony Stanton nay · Sharon Geuea Jones nay · Peggy Placier yea · Shannon Wilson present · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky nay
The other 7 items passed by unanimous or near-unanimous consent.
Thu May 8, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council to discuss Bike, Walk and Wheel Week event

The Mayor's Council on Physical Fitness and Health will review the Mayor's Awards report and mini-grant program under old business, and discuss plans for Bike, Walk and Wheel Week including the Mayor's Mile and breakfast station under new business. The meeting includes approval of minutes and a treasurer's report. No votes on rezoning, fees, or contracts are scheduled.

fitnesshealthbikingwalkingcommunity-events
ARC Meeting Room 1701 W. Ash Columbia, MO
Wed May 7, 2025 · 5:30 PM

Historic Preservation Commission

Historic Preservation Commission to honor notable properties

The Historic Preservation Commission will hold an awards ceremony to recognize 2025 Most Notable Properties and present commemorative plaques. The meeting includes a proclamation by Mayor Barbara Buffaloe marking National Historic Preservation Month.

historic-preservationawardscolumbiamayorstephens-lake-parkriechmann-pavilion
Riechmann Pavilion Stephens Lake Park 2300 E. Walnut
Wed May 7, 2025 · 1:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO Tech Committee to consider TIP amendment, West Ash reclassification

The Technical Committee will discuss a proposed amendment to the FY 2025-2028 Transportation Improvement Program (TIP), a potential reclassification of West Ash Street on the Major Roadway Plan, and an update to the Coordinated Public Transit Human Services Transportation Plan. A public hearing on the West Ash Street reclassification is scheduled for the May 22 Coordinating Committee meeting. The committee will also discuss the Route B intersection with the future Northeast Loop Major Collector.

transportationroadstransitpublic-hearingtiproadway-planwest-ash-street
✓ Decided: CATSO forwarded a new GoCOMO transit system amendment to the Coordinating Committee

The Technical Committee unanimously approved the meeting agenda and minutes. It then voted to forward a Transportation Improvement Program amendment that adds a new GoCOMO transit system project, recommending approval by the Coordinating Committee. The committee also unanimously recommended that the Coordinating Committee adopt an updated public‑transit human services plan. No actions were taken on the Ash Street reclassification or Route B improvements.

Conference Room 1C City Hall 701 E. Broadway Columbia, Missouri
Wed May 7, 2025 · 6:30 PM

Community Land Trust Organization Board

Board to consider RWJF grant, amended budget, and 115 Lynn St.

The Community Land Trust Organization Board will consider a Robert Wood Johnson Foundation grant opportunity, proposed changes to bylaws, and an amended budget. Old business includes discussion of 115 Lynn St. and strategic goals for 2025-2026. The meeting also includes routine approvals and a treasurer's report.

community-land-trustgrantsbudgetbylawsstrategic-planhousingcolumbia-mo
✓ Decided: Board approves amended budget and moves to apply for RWJF grant

The board approved the April 2, 2025 meeting minutes, the agenda, and the treasurer’s report. It adopted an amended budget that raises the accounting fee to $6,750 and reallocates $42,580 from the money market to the bill‑pay account. The board also approved applying for a Robert Wood Johnson Foundation grant with the CCLT as fiscal sponsor and authorized the board president to submit the proposal. The meeting was adjourned at 8:37 pm.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF MINUTES — Approved a Motion
8 yea · 2 present
Shirley Rhoades yea · Anthony Stanton present · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
TMP-30281 — Approved a Motion
8 yea · 2 present
Shirley Rhoades yea · Anthony Stanton present · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
TMP-30282 — Approved a Motion
8 yea · 2 present
Shirley Rhoades yea · Anthony Stanton present · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
TMP-30283 — Approved a Motion
16 yea · 2 abstain · 2 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani abstain · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani abstain · Valerie Carroll present · Sabra Mitchell yea
ADJOURNMENT — Approved a Motion
8 yea · 2 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
TMP-30285 — Approved a Motion
8 yea · 2 present
Shirley Rhoades yea · Anthony Stanton present · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
Tue May 6, 2025 · 5:30 PM

Commission on Human Rights

Review enforcement procedures for human rights ordinance

The Commission on Human Rights will follow up on vendoring at the Food Bank Market, discuss updates to the HREP proposal form language, and review the status of public sanitary facilities. They will also review the protocol for Chapter 12-57 of the Code of Ordinances to determine enforcement procedures. The meeting includes a closed session to discuss pending legal cases (2024-00031, 2025-0001, 2025-0002).

human-rightsenforcementordinancesfood-bankpublic-facilitieslegal-casesclosed-session
✓ Decided: Commission approved agenda, minutes and adjourned meeting unanimously

The commission unanimously approved the meeting agenda. The draft minutes from April 1, 2025 and the closed‑meeting minutes from that date were also approved, with five members voting yes, one member excused, and one member abstaining. The meeting was adjourned unanimously at 7:12 p.m.

Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-30223 — Approved a Motion
5 yea · 1 present · 1 abstain
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum abstain · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
7 yea
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
Tue May 6, 2025 · 7:00 PM

Historic Preservation Commission

Commission to consider demolition permits for 1201 Lakeview Ave and Miller Hall

The Historic Preservation Commission will hold a regular meeting to consider two demolition permit applications (1201 Lakeview Avenue and 602 N. Eighth Street/Miller Hall). The agenda also includes staff updates on budget, historic map improvements, and preservation plan definitions, as well as review of a preservation plan draft and scheduling of a public input meeting. The commission will also discuss a proposed change to regular meeting time.

historic-preservationdemolition-permitspreservation-planpublic-inputmeeting-schedulebudgetcolumbia-mo
✓ Decided: Commission rescheduled monthly meetings to 5:30 PM and approved $100 Juneteenth booth

The Historic Preservation Commission voted unanimously to move its regular meeting time to 5:30 PM on the first Tuesday of each month. It also approved spending up to $100 to register a commission booth at the Juneteenth event. Additional actions included approving the agenda and April minutes, and closing review of pending demolition permit applications.

Conference Room 1B City Hall 701 E. Broadway
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
TMP-30257 — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
ADJOURNMENT — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
TMP-30260 — Approved a Motion
6 present
Melissa Hagen present · Stephen Bybee present · Tanner Ott present · Tyler Travers present · Carrie Gartner present · Josh Parshall present
Mon May 5, 2025 · 5:00 PM

Water and Light Advisory Board

Water Cost of Service Study results discussed

The Water and Light Advisory Board will discuss the results of a Water Cost of Service Study. The presentation will be posted to the City website after the meeting. No votes or formal actions are listed on the agenda.

waterutility-ratescost-of-servicecolumbia-mo
City Hall Council Chambers 701 E Broadway Columbia, MO
Mon May 5, 2025 · 5:00 PM

City Council

Council to discuss water cost-of-service study results

The City Council will receive a presentation on the Water Cost of Service Study results. No votes or decisions are scheduled; the item is for discussion only. The presentation will be posted on the city website after the meeting.

waterutilitiescost-of-serviceratescity-council
✓ Decided: Council discussed water cost study and resignation; no formal actions taken

The council heard a presentation on the water cost of service study, which detailed a total cost of $36.0 M broken into personnel, capital, debt service, and transfers. Members discussed the upcoming resignation of Councilmember Lisa Meyer and considered possible dates for the special election, with several members favoring an August election. No motions were voted on, and no decisions were formally adopted.

City Hall Council Chambers 701 E. Broadway Columbia, MO
Mon May 5, 2025 · 7:00 PM

City Council

Council to vote on rezoning for Centerstate East Subdivision near Vandiver Drive

The council will hold a public hearing on interior and exterior renovations to the Waters House in the Waters-Moss Memorial Wildlife Area. They will vote on a rezoning of property near Vandiver Drive and US 63 for the Centerstate East Subdivision, which requires a two-thirds majority. Other votes include multiple short-term rental conditional use permits, a sidewalk project on Vandiver Drive, and a contract to replace downtown public housing units on Park Avenue.

zoninghousingshort-term-rentalssidewalksparks-and-recreationcommunity-developmentbudget
✓ Decided: Council approves Waters House renovation project

The council approved the minutes from the April 21 meeting and added a resolution to call a special election for the Ward 2 vacancy. It enacted a bill to fund interior and exterior renovations to the Waters House in the Waters‑Moss Memorial Wildlife Area, and approved a financial‑assistance agreement for the Benton‑Stephens Neighborhood Historic Survey. All votes were unanimous or recorded with all present members voting yes.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B62-25 — Passed
5 nay · 1 yea · 1 absent
Barbara Buffaloe nay · Nick Foster nay · Don Waterman yea · Lisa Meyer absent · Betsy Peters nay · Valerie Carroll nay · Jacquelyn Sample nay
The other 27 items passed by unanimous or near-unanimous consent.
Thu May 1, 2025 · 5:00 PM

Community Land Trust Organization Board

Community Land Trust Organization Board to hold documentary and panel event

The Community Land Trust Organization Board is holding a meeting featuring a film and panel discussion. The agenda consists of a social hour, guest speaker, and a documentary screening.

community-land-trustpublic-eventcolumbia-mo
✓ Decided: Board held a fundraiser and panel; no formal decisions recorded

The Community Land Trust Board hosted a fundraiser at Ragtag Cinema, screened the documentary The Pruitt‑Igoe Myth, and held a panel discussion on homeownership. Guest speaker Phyllis Kelley shared her experiences in affordable housing. After the event, the board adjourned with no formal actions taken.

Ragtag Cinema 10 Hitt St Columbia, MO
Thu May 1, 2025 · 2:00 PM

Commission on Cultural Affairs Standing Committee on Public Art

Public Art Committee to review license program and exhibit submissions

The Commission on Cultural Affairs Standing Committee on Public Art will meet to discuss new business. The committee is reviewing submissions for the Public Art License Program and the Shops at Sharp End exhibit.

public-artcultural-affairsarts-licensing
✓ Decided: Committee recommended licensing four public‑art works for 2025

The committee reviewed submissions from 11 artists and recommended licensing works by Craig Miles, Ni Kang, Karina Bedilion, and Christine Doerr for the 2025 Public Art License Program. It also recommended artists Craig Miles, Ni Kang, and Sarah Mosteller for inclusion in the Shops at Sharp End exhibit. Both recommendations were adopted by motion carried.

City Hall Room 1C 701 E Broadway Columbia, MO
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 yea · 2 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl present · Jamie Scheppers yea
TMP-30216 — Approved a Motion
3 yea · 2 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl present · Jamie Scheppers yea
TMP-30217 — Approved a Motion
3 yea · 2 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl present · Jamie Scheppers yea
ADJOURNMENT — Approved a Motion
3 yea · 2 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl present · Jamie Scheppers yea
TMP-30215 — Approved a Motion
3 yea · 2 present
Tootie Burns yea · Kristin Gadsden yea · Cameron Dorth present · Sarah Bohl present · Jamie Scheppers yea
Mon Apr 28, 2025 · 4:30 PM

Building Construction Codes Commission

Building Construction Codes Commission meeting cancelled

The meeting scheduled for April 28, 2025, was cancelled. The agenda contained only procedural boilerplate items.

building-codesprocedural
Council Chambers
Fri Apr 25, 2025 · 8:00 AM

City Council

Joint work session for updates from county, schools, city, chamber, and university

The Columbia City Council will hold a joint work session with Boone County, Columbia Public Schools, the Chamber of Commerce, and the University of Missouri. The meeting consists of brief updates from each entity and closing remarks. No formal decisions or votes are scheduled.

governmentupdateseducationcommerceuniversitycounty
✓ Decided: Joint work session held; council received updates, no decisions taken

The City Council convened a joint work session with Boone County, the Chamber of Commerce, Columbia Public Schools, and the University of Missouri. Updates were presented on public safety, NextGen 911, federal budget impacts, community development, workforce development, and the university brand. No motions, approvals, or votes were recorded. The meeting adjourned at approximately 9:40 a.m.

Emergency Communications Center 2145 County Drive Columbia, MO.
Thu Apr 24, 2025 · 5:30 PM

Planning and Zoning Commission

Commission discusses short-term rental rule changes

The Planning and Zoning Commission will hold a work session to discuss proposed amendments to the Unified Development Code (UDC) regarding short-term rental use-specific standards. No final votes are expected; this is a discussion item only.

short-term-rentalszoningudc-amendmentsplanningcolumbia-mo
✓ Decided: Commission discusses STR amendment proposals, no decisions made

The Planning and Zoning Commission held a work session to discuss three proposed amendments to the short‑term rental ordinance. Commissioners debated eliminating Tier 1, consolidating night limits, and modifying conditional‑use‑permit triggers, and they recommended revising the first CUP trigger language. No formal votes were taken; the matter will continue at the May 8 work session and move to a public hearing later.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30163 — Approved a Motion
6 yea · 2 abstain · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones abstain · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky abstain
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Thu Apr 24, 2025 · 7:00 PM

Planning and Zoning Commission

Rezoning 2.56 acres at 5320 Clark Lane from mixed‑use neighborhood to corridor

The Planning and Zoning Commission will consider several land‑use requests. Items include a rezoning of 2.56 acres at 5320 Clark Lane from M‑N to M‑C, an amendment to Lot 5 at 5000 Artemis Drive to allow apartments, a development plan for the Discovery Apartments site near Endeavor Drive, and multiple short‑term rental permits. The commission may also table some items for future meetings.

zoningdevelopmenthousingshort-term-rentalsplanning
✓ Decided: Commission tables two rezoning requests and approves agenda

The Planning and Zoning Commission unanimously approved its meeting agenda. The April 10 minutes were approved with six votes in favor and two abstentions. Two development requests (Case 154‑2025 and Case 158‑2025) were each moved to be considered at a later meeting, with both motions passing 8‑0. No other substantive actions were taken.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
TMP-30159 — Approved a Motion
6 yea · 2 nay · 1 present
Sara Loe nay · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson nay · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-30161 — Approved a Motion
4 nay · 4 yea · 1 present
Sara Loe nay · Anthony Stanton nay · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz nay · David Brodsky nay
The other 7 items passed by unanimous or near-unanimous consent.
Tue Apr 22, 2025 · 6:00 PM

Climate and Environment Commission

Climate commission to hear CAAP update, discuss annual report

The Climate and Environment Commission will receive an update from the CAAP team, discuss participation in the upcoming Earth Day booth and Butterfly Festival, and review the 2024 priorities and draft accomplishments for the annual report. The commission will also consider an alternative meeting date for May 2025.

climateenvironmentcaapannual-reportprioritiesearth-daypublic-events
✓ Decided: Commission approved 2024 priorities for Climate Action report

The commission approved the agenda and the previous meeting minutes. It adopted the final 2024 Climate and Environment Commission priorities and accomplishments for inclusion in the 2024 Climate Action and Adaptation Plan Annual Report. The commission also voted to cancel the May 2025 meeting. No other substantive actions were taken.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
TMP-30122 — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
TMP-30145 — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
TMP-30148 — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
Mon Apr 21, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Finance Advisory and Audit Committee to review 2024 Popular Annual Financial Report

The committee will review the 2024 Popular Annual Financial Report and the April 2025 Monthly Economic Report. The meeting also includes a review of the Finance Ordinance and the committee's mission statement.

financeauditeconomic-reportscity-ordinance
✓ Decided: Finance Advisory and Audit Committee approved agenda, minutes, and adjourned

The committee unanimously approved the meeting agenda. It also unanimously approved the March 17, 2025 draft minutes. The meeting was then adjourned by unanimous vote.

City Hall Council Chambers 701 E. Broadway Columbia, MO.
Mon Apr 21, 2025 · 5:00 PM

City Council

Council discusses FY26 budget revenue forecast

The City Council holds a pre-council session to discuss the revenue forecast for the FY26 budget and receive a feedback report on boards and commissions. No formal votes or decisions are scheduled.

budgetrevenueboards-and-commissionspre-council
✓ Decided: Council discussed FY26 revenue forecast and board survey findings

The council heard a presentation from Finance Director Matthew Lue on the FY26‑FY31 revenue and expenditure forecast, covering general fund, special revenue, enterprise, and internal service fund projections. The council also received a report from City Management Fellow Lacey Salazar summarizing the November 2024 boards and commissions survey and a follow‑up survey of department heads and liaisons. No motions or votes were taken on these items.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
Mon Apr 21, 2025 · 12:00 PM

Convention and Visitors Advisory Board

CVB Board to review tourism grant applications for Senior Games, State Games

The board will consider two tourism development funding applications: a Signature Series application for the 2025 Show-Me Senior Games and a Sports Development application for the 1MH State Games. They will also receive the FY 2025 second-quarter staff report, the April CVB board report, and updates from The District and Boone County Commission. No old business is on the agenda.

tourismsports-developmentgrantssenior-gamesstate-gamesquarterly-reportcolumbia
✓ Decided: Board approved $20,000 for Show-Me State Games tourism funding

The Convention and Visitors Advisory Board approved a $20,000 request to support the Show-Me State Games and Missouri Senior State Games. It also approved a $10,000 request for the 1Movement Hoops 2025 State Games. The board approved its agenda, the February 24, 2025 minutes, and adjourned the meeting.

300 S. Providence Road, Thomas G. Walton Building, Columbia, MO 65203
Mon Apr 21, 2025 · 7:00 PM

City Council

Council to consider annexation of Old Plank Road property and Vandiver Drive rezoning

The Columbia City Council will hold public hearings on stormwater, street, and airport parking improvements, then vote on a voluntary annexation with R-2 zoning and a rezoning of Vandiver Drive to Planned Development. The consent agenda includes short-term rental permits, plat approvals, and various funding agreements. New business includes a temporary street closure for MU power plant repairs. Introductions cover a strategic plan update, another annexation, and three short-term rental permits.

zoningannexationshort-term-rentalpublic-hearinginfrastructurehousingbudgettransportation
✓ Decided: Council approved storm‑water, street, and airport projects and several annexations

The council authorized final design for storm‑water improvements on Chadwick Drive and approved street and sidewalk upgrades on Garth Avenue, both by unanimous voice vote. It enacted B55-25 to construct a parking‑lot improvement at the Columbia Regional Airport with a 6‑0 vote, and passed B51-25 to annex property at 4100 N. Wyatt Lane with a 5‑1 vote. Several consent‑agenda items, including short‑term rental permits and budget amendments, were also approved.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (23 roll-call votes)
Named votes as recorded in the official record.
B55-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B58-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B54-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B59-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B56-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B51-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B52-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B57-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
B53-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R45-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R47-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R50-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R43-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R55-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R49-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R48-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R46-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R51-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R52-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
R53-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea · Jacquelyn Sample yea
Thu Apr 17, 2025 · 6:30 PM

Parks and Recreation Commission

Public hearings on Twin Lakes and Strawn Park improvements

The Parks and Recreation Commission will hold public hearings on proposed improvements at Twin Lakes Recreation Area and Strawn Park (Phase III). The agenda also includes routine approval of minutes, monthly report, and reports on capital projects, bicycle/pedestrian issues, and recreation services.

parkspublic-hearingstwin-lakesstrawn-parkimprovementscolumbia-mo
ARC Meeting Room 1701 W. Ash Columbia, MO
Thu Apr 17, 2025 · 5:00 PM

City Council

Council declares April 8 election results and appoints new officials

The City Council will formally declare the results of the April 8, 2025 municipal election. Council members will take oaths, make comments, and appoint a mayor pro tem. The council will also appoint members to the City of Columbia New Century Fund, Inc. board, the CAM Stakeholder Committee, and the Youth Advisory Council.

electionsappointmentscouncilgovernancemunicipal
✓ Decided: Council unanimously adopts amended April 8 election results

The council approved the amendment to Resolution R42-25, officially declaring the April 8, 2025 municipal election results by unanimous voice vote. Council Member Nick Foster was confirmed to continue as Mayor Pro Tem without objection. Existing liaison appointments to the New Century Fund board, the CAM Stakeholder Committee, and the Youth Advisory Council were reaffirmed without objection.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
R42-25 — Adopted
5 yea · 2 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman absent · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
Wed Apr 16, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Bicycle and Pedestrian Commission to receive I-70 improvement update

The commission will meet to receive reports from city staff and discuss updates regarding the Improve I-70 project from Rocheport to Columbia. The meeting also includes reports on Vision Zero and Parks & Recreation.

transportationbikingpedestrian-safetyi-70vision-zero
✓ Decided: Commission approved sending safety letter to mayor for I‑70 Rocheport‑US 63 project

The Bicycle and Pedestrian Commission approved its agenda and the March 19 meeting minutes. It added an item to the September 2025 meeting to consider a letter to MODOT engineers, and unanimously approved sending Chair Boyd’s draft letter to the mayor urging safety for all users in the I‑70 Rocheport‑US 63 rebuild. The meeting was then adjourned.

Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Apr 16, 2025 · 5:02 PM

Tree Board

Tree Board to discuss City Tree Fund and upcoming volunteer events

The Tree Board will discuss how to address the City Tree Fund with City Council. The board will also coordinate volunteer assignments for Earth Day and Arbor Day events.

city-tree-fundvolunteeringarbor-dayearth-dayurban-forestry
✓ Decided: Board approved agenda, minutes and tabled city tree fund discussion

The Tree Board unanimously approved its agenda. The minutes from the prior meeting were approved with six votes in favor and one abstention. The board voted to table the City Tree Fund discussion and then adjourned the meeting unanimously.

City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
6 yea · 1 abstain
Michael Kyd yea · Jacob McMains abstain · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
CITY TREE FUND — Tabled
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
7 yea
Michael Kyd yea · Jacob McMains yea · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed Apr 16, 2025 · 7:00 PM

Housing and Community Development Commission

Approve release of RFP for FY 2026 housing funds

The commission will consider approving the release of a Request for Proposal for FY 2026 and reallocated housing funds. They will also review the FY 2026 Housing and Community Development Needs Survey and related reports. The meeting includes approval of the March 19, 2025 minutes.

housingcommunity-developmentrfpfy2026needs-surveyfunding
✓ Decided: Commission unanimously approves FY 2026 housing RFP and reallocated funds

The Housing and Community Development Commission approved its agenda and the March 19, 2025 meeting minutes by voice vote (6‑0 each). The commission then approved the amended Request for Proposals for FY 2026 housing and reallocated CDBG/HOME funds with a roll‑call vote of 6‑0. A community‑development needs survey was presented, but no further action was taken.

City Hall Council Chambers 701 E. Broadway Columbia, MO.
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 3 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman present · Jay McIntosh yea · Scott Cristal present · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
TMP-30106 — Approved a Motion
6 yea · 3 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman present · Jay McIntosh yea · Scott Cristal present · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
TMP-30108 — Approved a Motion
6 yea · 3 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman present · Jay McIntosh yea · Scott Cristal present · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
ADJOURNMENT — Approved a Motion
6 yea · 3 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman present · Jay McIntosh yea · Scott Cristal present · Heather Morgan yea · Ryan King yea · Elizabeth Downing yea
Wed Apr 16, 2025 · 4:15 PM

Food Council

Columbia Food Council to discuss mapping proposal and county representation

The Food Council will meet to review current food policy updates and a mapping proposal. The body will also discuss county representation and provide an update on a focus group.

food-policymappingpublic-healthcounty-representation
✓ Decided: Food Council approved agenda and minutes unanimously

The council unanimously approved the meeting agenda and the corrected March 19 minutes. Members discussed updates on health‑care integration, One Health initiatives, the Double Up Food Bucks program, and mapping proposals, but no formal actions were taken on those items. The next meeting is scheduled for May 21, 2025.

Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Apr 15, 2025 · 5:30 PM

Public Transit Advisory Commission

Public Transit Advisory Commission to review 2024 annual report and ridership

The commission will discuss the draft 2024 annual report and review ridership data from October 2024 through March 2025. The body will also elect officers and receive updates on Vision Zero and other city commissions.

public-transitridershipvision-zerocity-administration
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Tue Apr 15, 2025 · 6:00 PM

Human Services Commission

Human Services Commission to elect Community Development Commission representatives

The Human Services Commission will meet to elect representatives for the Community Development Commission. The agenda also includes a presentation on Opportunity Campus and a discussion regarding the FY2025 Social Services RFP.

human-servicesappointmentssocial-servicescommunity-development
✓ Decided: Commission unanimously approves new liaison and keeps RFP unchanged

The Human Services Commission approved the meeting agenda and the February 11, 2025 minutes by unanimous vote. Commissioners voted unanimously to keep the existing RFP unchanged, leaving transportation out of the basic needs list. The commission also unanimously approved Elizabeth Downing as the new liaison for the Community Development Commission.

Training Room 1 Columbia/Boone County Department of Public Health and Human Services 1005 W. Worley St.
Mon Apr 14, 2025 · 4:15 PM

Commission on Cultural Affairs

Commission on Cultural Affairs to discuss arts funding and public art

The Commission on Cultural Affairs will meet to review reports on public art and arts funding. Discussion items include the Columbia Arts Fund and the status of FY25 funding.

artsculturepublic-artgrantsbudget
✓ Decided: Agenda and minutes approved; meeting adjourned

The commission approved the agenda and the March 10, 2025 minutes, both motions carried. No new business or substantive actions were taken. The meeting was adjourned at 5:25 p.m.

City Hall Council Chambers 701 E Broadway Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
APPROVAL OF MINUTES — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
ADJOURNMENT — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood present · Jennifer Jennings yea · Phillip Overeem yea
Sat Apr 12, 2025 · 1:00 PM

Youth Advisory Council

Youth Advisory Council to discuss Youth Summit

The agenda is largely procedural with introductions, approval of minutes, and old business. The only substantive item under new business is a discussion of the City of Columbia Youth Summit, though no details or decisions are specified in the agenda.

youthadvisory-councilsummitcolumbia
✓ Decided: Youth Advisory Council met; only procedural items were addressed

The council called the meeting to order, introduced members, approved the agenda and minutes, noted the upcoming Youth Summit, set the next meeting date, and adjourned. No substantive actions, approvals, or votes were recorded.

701 E Ash St, Columbia, MO 65201
Thu Apr 10, 2025 · 12:00 PM

Columbia Sports Commission

Commission to review Sports Development Fund application for 1Movement Hoops

The Columbia Sports Commission will meet to approve previous meeting minutes, review a Sports Development Fund application from 1Movement Hoops, and receive staff updates on sports sales activities and planning for the NCAA Cross Country Nationals. Public comments are also taken.

sportscommissionsports-development-fund1movement-hoopsncaa-cross-countryplanningpublic-meeting
✓ Decided: Commission approves $10,000 Sports Development Fund grant for 1Movement Hoops

The Columbia Sports Commission approved a $10,000 Sports Development Fund application submitted by 1Movement Hoops. The meeting agenda and February meeting minutes were also approved. The commission then adjourned the meeting.

300 S. Providence Road - Thomas G. Walton Building
Thu Apr 10, 2025 · 5:30 PM

Board of Health

Board of Health to review feral cat ordinance and care regulations

The Board of Health will discuss and review proposed edits to Chapter 5 (Animals and Fowl) and consider City Ordinance Article VI regarding feral cats. Attachments include research on feral cat population regulations, requirements for care of feral cat colonies, and information on Trap-Neuter-Return (TNR) programs. The board will also receive a director's report and hear general comments from the public.

animalsferal-catsordinancepublic-healthanimal-controltnr
✓ Decided: Board approved rabies vaccination requirement for feral cat permits

The Board of Health unanimously approved several changes to the feral cat ordinance: moving microchipping language, removing the annual trapping requirement for cats over 8 weeks, removing the annual testing requirement, and adding a requirement that all cats be vaccinated against rabies at the time of permit application. The next meeting is scheduled for May 8, 2025.

Columbia/Boone County Health & Human Services Training Room 1 1005 W. Worley St. Columbia, MO.
Thu Apr 10, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission to discuss paratransit and ADA reporting

The Disabilities Commission will meet to discuss accessibility initiatives and city services. The body will review paratransit capacity and the city's ADA grievance and reporting forms.

accessibilityadaparatransitpublic-services
✓ Decided: Commission approves Gumby’s access letter, tables minutes and other actions

The Disabilities Commission approved the agenda amendment and voted to table the March 13 minutes until the May meeting. It approved sending a community access letter to Gumby’s restaurant and decided not to send a letter regarding A‑1 Contracting. The meeting was then adjourned.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Thu Apr 10, 2025 · 5:30 PM

Planning and Zoning Commission

Commission discusses family definition and small‑lot subdivision revisions

The Planning and Zoning Commission will discuss a proposed definition of "family" and potential revisions to the Unified Development Code. It will also review revisions to Article 5 (Subdivisions) and Appendix A concerning small‑lot subdivisions. No formal decisions are indicated on these topics at this work session.

zoningplanningdevelopment-codesubdivisionsfamily-definition
✓ Decided: Planning and Zoning Commission adopted agenda and approved minutes

The commission adopted the meeting agenda unanimously and approved the March 20 work session minutes unanimously. Commissioners discussed potential revisions to the definition of "family" and to small‑lot regulations, but no actions were taken. The next meeting was scheduled for April 24, 2025.

​City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present
TMP-30019 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present
Thu Apr 10, 2025 · 7:00 PM

Planning and Zoning Commission

Rezoning 1.91 acres from two‑family to multi‑family at Merideth Drive

The Planning and Zoning Commission will review several development applications. Items include a 2‑lot preliminary plat for the Walter Miller Subdivision at 1516 Wilson Avenue, a design adjustment and final plat for Oscar Plat 1 at 1901 Range Line Street, and a conditional use permit for a bar/nightclub at 801 College Avenue. The commission will also consider a rezoning request to change 1.91 acres from R‑2 to R‑MF at the south end of Merideth Drive, and multiple short‑term rental permits across the city.

zoningsubdivisionsconditional-useshort-term-rentalsrezoningplanning
✓ Decided: Commission approves agenda, minutes and Walter Miller subdivision plat

The Planning and Zoning Commission unanimously approved the meeting agenda. The minutes from the March 20 meeting were approved with six votes in favor and one abstention. The Walter Miller Subdivision preliminary plat (Case 23-2025) was approved by a 7‑0 vote and will be forwarded to City Council. No recorded vote outcome is provided for the design adjustment and final plat of Case 90-2025.

City Hall Council Chambers 701 E Broadway Columbia, MO.
🗳️ How they voted — 3 divided votes
Named votes as recorded in the official record.
TMP-29986 — Approved a Motion
6 yea · 2 present · 1 nay
Sara Loe nay · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present
TMP-29995 — Approved a Motion
6 yea · 2 present · 1 nay
Sara Loe nay · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky present
TMP-30014 — Approved a Motion
6 yea · 2 present · 1 nay
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz nay · David Brodsky present
The other 9 items passed by unanimous or near-unanimous consent.
Wed Apr 9, 2025 · 8:00 AM

Water and Light Advisory Board

Board to discuss FY 2026 capital plans and battery storage study

The Water and Light Advisory Board will receive and discuss several reports, including the introduction of the proposed FY 2026 Capital Improvement Plans for water and electric utilities. They will also review a battery storage study, annual NERC compliance and DSM reports, a monthly power cost adjustment, and a capacity study. The board may consider approval of minutes and financial reports.

waterelectricutilitiescapital-improvementbattery-storagenerc-compliancedemand-side-managementpower-cost-adjustment
✓ Decided: Board unanimously approved the agenda and the March 12 minutes

The Water and Light Advisory Board voted to approve the meeting agenda as presented, with a motion by Jennifer Coleman and a second by Phillip Fracica. The board also approved the March 12, 2025 minutes, correcting Gregg Coffin’s last name, after a motion by Gregg Coffin and a second by Phillip Fracica. Both motions passed unanimously.

701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Apr 9, 2025 · 6:00 PM

Citizens Police Review Board

Board to discuss three closed-session complaint cases and complaint data analysis

The Citizens Police Review Board will consider approval of March minutes and old business including a brochure update and a plan to analyze 2024 complaint data for a supplemental annual report. New business features a training session on the complaint and investigation process with the police department. The board will then move into closed session to discuss three specific complaint cases (2025-0001, 2025-0002, and 2025-0003) under state confidentiality laws.

police-oversightcomplaint-dataclosed-sessiontrainingcprbcolumbia-missouri
✓ Decided: Board unanimously approved agenda, minutes and entered then exited closed session

The Citizens Police Review Board unanimously approved the meeting agenda. It also unanimously approved the draft open‑session minutes from March 12 2025 and the draft closed‑session minutes from March 12 2025 and February 26 2025. The board voted to go into closed session to discuss protected records and later voted to return to open session.

City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Apr 9, 2025 · 3:00 PM

Parking Advisory Commission

Commission will review layout of proposed parking meter changes

The Parking Advisory Commission will receive updates on enforcement, revenue, and the Parking Commission Plan. New business includes discussion of the layout of proposed meter changes, review of occupancy data, and a walker discussion. The meeting also includes standard procedural items such as agenda and minutes approval.

parkingrevenueenforcementmetersdata
Room 1A/1B City Hall 701 E. Broadway
Tue Apr 8, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council to discuss 2025 Youth Summit and annual report

The Youth Advisory Council is meeting to discuss planning for the 2025 Youth Summit, provide updates from City Council meeting attendees, and review the annual report. The council will also consider approval of minutes from previous meetings.

youth-advisory-councilyouth-summitannual-reportcity-councilcolumbia-missouri
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Tue Apr 8, 2025 · 7:00 PM

Board of Adjustment

Board to decide on variances and cottage standards for Carol Drive lots

The Board of Adjustment will hold public hearings on two concurrent requests: Case 119-2025 seeks variances to reduce front, corner-side, and rear yard setbacks for Lot 16 of Meadowvale Subdivision following subdivision, and Case 120-2025 requests authorization to use 'cottage' optional dimensional standards for a proposed new lot (Lot 16B) between 2107-2109 and 2111-2113 Carol Drive. The board will decide whether to grant the requested relief from Unified Development Code requirements.

zoningvariancesland-useboard-of-adjustmentdevelopment-standardshousingcolumbia-mo
Columbia City Hall Council Chambers 701 E Broadway
Mon Apr 7, 2025 · 6:00 PM

City Council

Council to enter closed session for legal discussions

This meeting is largely procedural, with the council voting to go into a closed session under state law to discuss legal actions and privileged communications. No public hearings or substantive legislative actions are listed. The meeting includes a call to order, any other council items, and adjournment.

city-councillegalclosed-session
✓ Decided: Council voted to enter closed session to discuss legal matters

Mayor Buffaloe moved, and Council Member Foster seconded, a motion for the City Council to go into a closed session to discuss legal actions and privileged communications. All six council members present voted yes, and the council entered closed session at 6:01 p.m. The closed meeting lasted until approximately 6:56 p.m.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-29920 — Approved a Motion
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
Mon Apr 7, 2025 · 7:00 PM

City Council

City Council to consider annexation and police technology agreements

The Columbia City Council will consider a voluntary annexation of property on Wyatt Lane and approve a software agreement with Axon Enterprise for the Police Department. The meeting also includes public hearings on annexation and a short-term rental permit.

councilannexationpolicetechnologybudgetpublic-hearingzoning
✓ Decided: Council approved police services contract and FY 2025 budget amendments

The Council voted to approve B48-25, a master services and purchasing agreement with Axon Enterprise for the Police Department, and B50-25, an amendment to the FY 2025 budget for second‑quarter appropriations. Both measures passed with all six members voting yes and one absent (Council Member Meyer). The council also moved B44-25 to be tabled until the May 5 meeting. All consent‑agenda items were approved unanimously.

City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (16 roll-call votes)
Named votes as recorded in the official record.
B47-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B46-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B45-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B49-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B48-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B43-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B50-25 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R35-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R33-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R36-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R34-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R37-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R41-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R39-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R38-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R40-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
Fri Apr 4, 2025 · 1:00 PM

City of Columbia New Century Fund, Inc. Board

New Century Fund Board meets without listed action items

This meeting of the New Century Fund Board consists of procedural items only: call to order, introductions, approval of agenda and minutes, new business, and setting next meeting date. No specific resolutions, contracts, or public hearings are listed on the agenda.

boardproceduralmeeting
✓ Decided: Board approved moving New Century Fund to Commerce Bank

The board approved the meeting agenda. The board approved transferring the New Century Fund from Central Bank to Commerce Bank. The next meeting was set for May 20, 2025.

701 E Broadway Columbia, Mo Conference Room 1A/1B
Thu Apr 3, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Mayor's Council on Physical Fitness and Health to discuss Bike, Walk and Wheel Week

The Mayor's Council on Physical Fitness and Health will meet to discuss upcoming health initiatives. The agenda includes planning for Bike, Walk and Wheel Week and youth clinics.

healthfitnessyouthcommunity-events
ARC Meeting Room 1701 W. Ash Columbia, MO
Wed Apr 2, 2025 · 6:30 PM

Community Land Trust Organization Board

CLT Board to discuss development, ARPA funds, and sealed bids

The Columbia Community Land Trust Organization Board will meet to consider new business including a ribbon cutting for Cullimore Cottage and lawn care maintenance. Old business items include external marketing materials, expenditure of ARPA funds, a fundraising event, development at 6 Fourth Ave., a strategic plan, and 2025-2026 goals. The board will also vote to go into a closed session under Missouri law to discuss sealed bids and related documents.

community-land-trusthousingdevelopmentarpa-fundsclosed-sessionstrategic-planfundraising
✓ Decided: Board approved $602,000 ARPA allocation and marketing material purchase

The board approved the meeting agenda and the March 5, 2025 minutes. It authorized a $602,000 ARPA fund allocation for two houses and the Job Point home, and approved purchase of marketing materials for conferences. The board also moved into and out of closed session and adjourned the meeting.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
7 yea · 3 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
TMP-29949 — Approved a Motion
7 yea · 3 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Sabra Mitchell present
TMP-29952 — Approved a Motion
9 yea · 1 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
TMP-29957 — Approved a Motion
18 yea · 2 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea · Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
ADJOURNMENT — Approved a Motion
9 yea · 1 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Sabra Mitchell yea
Tue Apr 1, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council to prepare for 2025 Youth Summit

The Youth Advisory Council is holding a special meeting to discuss preparation for the 2025 Youth Summit. The agenda also includes routine items such as approval of minutes and public comments. No votes on ordinances or contracts are scheduled.

youthsummitplanningcouncil
✓ Decided: Youth Advisory Council approved agenda and scheduled April 8 meeting

The council approved the meeting agenda after a motion by Isabella Shah and a second by Aanya Shetty. No prior minutes were presented for approval. Members discussed preparations for the 2025 Youth Summit but made no formal decisions. The next meeting was scheduled for April 8, 2025.

City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Tue Apr 1, 2025 · 5:30 PM

Commission on Human Rights

Commission to discuss HREP form, food bank vendoring, and closed cases

The Commission on Human Rights will discuss old business including vendoring at the Food Bank Market and an update on the HREP proposal form language. New business covers the status of public sanitary facilities. The meeting will conclude with a closed session to discuss pending cases.

human-rightsfood-bankpublic-facilitiesclosed-sessionpending-cases
✓ Decided: Commission approved agenda, minutes, $25 purchase and adjourned meeting

The commission unanimously approved the meeting agenda and the draft and closed minutes from March 4, 2025. A $25.00 purchase for a cookie tray for the Food Bank Market was also approved unanimously. Motions to enter and exit closed session and to adjourn the meeting were approved, each with a 5‑2 vote. The next meeting is scheduled for May 6, 2025.

Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
5 yea · 2 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum present · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
TMP-29862 — Approved a Motion
5 yea · 2 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum present · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
Tue Apr 1, 2025 · 7:00 PM

Historic Preservation Commission

Historic Preservation Commission will review public comments on the Preservation Plan

The commission will consider public and SHPO feedback on the 70% draft Historic Preservation Plan. Staff will present updates on the FY 2025 budget, the Benton‑Stephens Survey Phase I, and a grant application for the East‑Campus/Eastland Hills survey. The board will also discuss demolition permit applications and a deconstruction versus demolition topic.

historic-preservationbudgetsurveygrantdemolitionplanning
✓ Decided: Commission approved funding for a seventh historic plaque

The Historic Preservation Commission unanimously approved the agenda and the March meeting minutes. It also approved additional funding to order a seventh plaque for the Centro‑Latino property. The commission appropriated up to $450 for the May 7 Most Notable Properties event and set the event to open at 5:30 PM with a 6:00 PM start. The deconstruction‑vs‑demolition discussion was tabled until the May meeting.

Conference Room 1B City Hall 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
TMP-29937 — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
TMP-29940 — Approved a Motion
5 present · 1 absent
Melissa Hagen present · Stephen Bybee present · Tanner Ott absent · Tyler Travers present · Carrie Gartner present · Josh Parshall present
Mon Mar 31, 2025 · 12:00 PM

Convention and Visitors Advisory Board

Convention and Visitors Advisory Board meeting canceled

The meeting scheduled for March 31, 2025, was canceled. The agenda contained only procedural items and staff reports.

tourismprocedural
300 S. Providence Road - Thomas G. Walton Building
Thu Mar 27, 2025 · 8:00 AM

Police Retirement Board

Police Retirement Board to discuss LAGERS buyout

The Police Retirement Board will meet to discuss a LAGERS buyout. The remainder of the agenda consists of procedural items.

policeretirementpensionslagers
701 E Broadway Columbia, Mo Conference Room 1C.
Tue Mar 25, 2025 · 6:00 PM

Climate and Environment Commission

Commission will discuss the CEC Priorities and Annual Report

The Climate and Environment Commission will review old business items, including the Earth Day booth scheduled for April 27, 2025, the Butterfly Festival on June 21, 2025, and the CEC Statement on the IECC 2024 code and appendices. New business includes a discussion of the CEC Priorities and Annual Report. A special presentation by Elise Buchheit on the Missouri Municipal Stormwater Management Division will also be heard.

climateenvironmentcommunity-eventsreportspublic-comment
✓ Decided: Commission adopted CEC statement on 2024 IECC code review (9-0-1)

The commission approved its agenda and the previous meeting’s minutes by unanimous voice votes. It adopted a draft statement supporting the 2024 International Energy Conservation Code, with nine members voting yes and one abstaining. The meeting was then adjourned unanimously.

City Hall Conference Room 1A 701 E. Broadway Columbia, MO.
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
APPROVAL OF MINUTES — Approved a Motion
15 present
Linda Godwin present · Leanne Tippett Mosby present · Abra Spisso present · Emily Gustafson present · David Huhman present · Alexis Hall present · Richard Shanker present · Eric Kvam present · Andrew Sell present · Kira Smith present · Abby Dickinson present · Nathan Elwood present · Cherylyn Kelley present · Morgan Wozniak present · Eileen Avery present
TMP-29819 — Approved a Motion
9 yea · 5 present · 1 abstain
Linda Godwin yea · Leanne Tippett Mosby yea · Abra Spisso yea · Emily Gustafson yea · David Huhman present · Alexis Hall yea · Richard Shanker abstain · Eric Kvam present · Andrew Sell yea · Kira Smith present · Abby Dickinson yea · Nathan Elwood yea · Cherylyn Kelley yea · Morgan Wozniak present · Eileen Avery present
Tue Mar 25, 2025 · 3:00 PM

Airport Advisory Board

Airport Advisory Board to discuss air service plans and grant status

The Airport Advisory Board will meet to review the status of the Master Plan and a Small Community Air Service Development Grant. The board will also discuss a customer satisfaction survey and the Air Service Strategic Plan.

airportgrantsstrategic-planningtransportation
✓ Decided: Board unanimously approved agenda and meeting minutes

The Airport Advisory Board approved its agenda after a motion by Gary Thompson, seconded by Todd Culley, with a unanimous vote. The board also approved two sets of meeting minutes—January 29 2025 and February 26 2025—each after motions by Todd Culley and seconded by Tom Richards, both passing unanimously. No other substantive actions were decided at this meeting.

Columbia Regional Airport Terminal Conference Room
Mon Mar 24, 2025 · 4:30 PM

Building Construction Codes Commission

Commission to review updates to building and electrical codes

The Building Construction Codes Commission will meet to receive presentations on significant changes to several construction codes. Subcommittees will provide updates on the IRC, IECC, and IBC/IEBC codes, as well as NEC code changes.

building-codesconstructionelectrical-codespublic-safety
✓ Decided: Commission approved key code changes on insulation, HVAC GFCI and Appendix RK

The Building Construction Codes Commission adopted an equivalency for R‑10 slab insulation in the IECC residential requirements (8‑0 vote). It approved a motion to not require GFCI protection for HVAC service receptacles located in attics (8‑0 vote). The commission also voted to keep Appendix RK as an appendix and not adopt it into the code (7‑0‑1 vote).

Council Chambers
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
12 present · 8 yea
Kas Carlson present · Brian Connell yea · Jay Creasy present · Robert Jackson present · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young present · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · William DeYoung present · Kyle Saunders present · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley present · Paul Prevo present · John Page yea
APPROVAL OF MINUTES — Approved a Motion
12 present · 8 yea
Kas Carlson present · Brian Connell yea · Jay Creasy present · Robert Jackson present · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young present · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · William DeYoung present · Kyle Saunders present · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley present · Paul Prevo present · John Page yea
Fri Mar 21, 2025 · 8:00 AM

Firefighters' Retirement Board

Firefighters' Retirement Board evaluates LAGERS buyout

The Firefighters' Retirement Board will meet to evaluate a LAGERS buyout option. The agenda also includes routine items such as call to order, introductions, approval of the agenda, public comments, and setting the next meeting date.

retirementfirefighterspensionslagersboard-meeting
701 E Broadway Conference Room 1C
Thu Mar 20, 2025 · 5:30 PM

Parks and Recreation Commission

Park commission to review FY'26 CIP, parks dedication, and tour sites

The commission will review proposed sites for a parks tour, receive an update on park dedication, and discuss the FY 2026 Capital Improvement Program. Reports from council, bicycle/pedestrian, capital projects, and recreation services will also be presented.

parkscapital-improvementrecreationplanningpublic-meeting
ARC Meeting Room 1701 W Ash Columbia, MO
Thu Mar 20, 2025 · 5:30 PM

Planning and Zoning Commission

Commission reviews draft amendment to small‑lot use standards in the UDC

The Planning and Zoning Commission will consider a staff report on a draft amendment to the Unified Development Code (UDC) concerning use‑specific standards for small lots. The amendment is presented as a working draft (revision dated March 6, 2025). No other decisions or actions are listed for this work session.

zoningdevelopment-codeplanning
✓ Decided: Commission lowered small‑lot trigger threshold to 15 lots

The Planning and Zoning Commission approved the agenda and the March 6 work‑session minutes unanimously. It accepted a change to the use‑specific standards, lowering the lot‑count threshold that triggers design standards from 16 to 15 lots. Commissioners requested the architectural‑style wording be changed to “Changes in material color or paint color alone shall be insufficient.” Staff was tasked with preparing a graphical exhibit of the standards and will begin presenting subdivision‑standard changes at the next work session.

Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29854 — Approved a Motion
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
8 yea · 1 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Thu Mar 20, 2025 · 7:00 PM

Planning and Zoning Commission

Planning Commission to review 72-acre Centerstate East development plan

The Planning and Zoning Commission will hold public hearings on several rezoning and development proposals, including a 72-acre mixed-use development with hotels and a conference center at Vandiver Drive and Highway 63, and a rezoning of 1.14 acres at 1710 Chapel Hill Road. They will also consider a request to table the Discovery Apartments PD plan, and hear multiple applications for short-term rental permits.

zoningplanningpublic-hearingdevelopmentshort-term-rentalrezoningmixed-usehotels
✓ Decided: Commission approved R‑2 permanent zoning for 201 East Old Plank Road

The Planning and Zoning Commission unanimously approved a motion to table the Discovery Apartments project (Case 92‑2025) to April 24, 2025. It also unanimously approved a recommendation to grant permanent R‑2 zoning for 201 East Old Plank Road, subject to annexation. Both motions passed with an 8‑0 vote.

Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-29852 — Approved a Motion
4 nay · 4 yea · 1 present
Sara Loe nay · Anthony Stanton yea · Sharon Geuea Jones nay · Peggy Placier nay · Shannon Wilson nay · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
The other 11 items passed by unanimous or near-unanimous consent.
Wed Mar 19, 2025 · 8:15 AM

Police Retirement Board

Police Retirement Board meeting cancelled

The March 19, 2025 meeting of the Columbia Police Retirement Board has been cancelled. No decisions or discussions will occur. The agenda had included a LAGERS buyout evaluation.

cancelledpolice-retirementprocedural
701 E Broadway Conference room 1C
Wed Mar 19, 2025 · 8:00 AM

Firefighters' Retirement Board

Firefighters' Retirement Board meeting cancelled

This meeting of the Columbia Firefighters' Retirement Board has been cancelled. No decisions or discussions took place.

cancelledfirefightersretirementboard
701 E Broadway, Conference room 1C
Wed Mar 19, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to discuss Business Loop 70 grant, I-70 update, and MoDOT survey

The Bicycle and Pedestrian Commission will hear staff reports on Vision Zero, Parks & Recreation, and planning, then take up new business items: a MoDOT Long Range Transportation Plan survey, an update on the Improve I-70 project from Rocheport to Columbia, and a discussion of a Business Loop 70 grant. Standard procedural items including approval of minutes and public comments are also scheduled.

bicyclepedestriantransportationvision-zeroi-70business-loop-70modotcolumbia-mo
✓ Decided: Commission authorized presentation of Top Ten summary to City Council on I‑70/US‑63 plans

The commission approved its meeting agenda and the minutes from the January 15, 2025 meeting. It unanimously authorized representatives to present a “Top Ten” summary of the commission’s efforts to the City Council regarding the I‑70/US‑63 interchange. The meeting was then adjourned.

Conference Room 1A City Hall 701 E. Broadway City Hall
Wed Mar 19, 2025 · 5:00 PM

Tree Board

Tree Board to discuss City Tree Fund and FY25 budget

The Columbia Tree Board will meet to discuss addressing the City Tree Fund topic with City Council and review FY25 budget items. The board will also plan upcoming outreach and education opportunities and hear a report from the city arborist.

tree-boardbudgetcity-tree-fundoutreacheducation
City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
TREE BOARD BUDGET — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
WORK CALENDAR — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed Mar 19, 2025 · 7:00 PM

Housing and Community Development Commission

HCDC to review annual rating criteria and approve FY 2026 RFP release

The Housing and Community Development Commission will discuss reallocating funds, review annual rating criteria for housing programs, and examine the FY 2026 Needs Survey. They will also consider approving the release of the FY 2026 Request for Proposals (RFP) for community development projects. Additionally, the commission will vote on minutes from previous meetings, receive training on the Missouri Sunshine Law and conflicts of interest, and elect officers.

housingcommunity-developmentpublic-hearingrfpssunshine-lawconflicts-of-interestcaperneeds-survey
✓ Decided: Commission approved agenda and minutes, and tabled fund‑release request

The Housing and Community Development Commission unanimously approved its agenda (6‑0). It approved the September 18, 2024 minutes with a 4‑0 vote and two abstentions, and approved the January 22, 2025 minutes with a 5‑0 vote and one abstention. The commission also decided to table the request for release of funds and the related RFP, with no vote recorded.

City Hall Council Chambers 701 E. Broadway Columbia, MO.
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 2 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan present · Ryan King yea
TMP-29839 — Approved a Motion
4 yea · 2 present · 2 abstain
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal abstain · Heather Morgan present · Ryan King abstain
TMP-29840 — Approved a Motion
5 yea · 2 present · 1 abstain
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh abstain · Scott Cristal yea · Heather Morgan present · Ryan King yea
TMP-29842 — Approved a Motion
18 yea · 6 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan present · Ryan King yea · Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan present · Ryan King yea · Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan present · Ryan King yea
TMP-29844 — Approved a Motion
6 yea · 2 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan present · Ryan King yea
ADJOURNMENT — Approved a Motion
6 yea · 2 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman yea · Jay McIntosh yea · Scott Cristal yea · Heather Morgan present · Ryan King yea
Wed Mar 19, 2025 · 4:15 PM

Food Council

Food Council holds focus group work session on food policy updates

The Columbia Food Council will meet on March 19, 2025 to discuss current food policy issues and conduct a focus group work session. The agenda includes reviewing distributor topics and planning a retailer and producer survey. The meeting also covers routine items such as approving the agenda, minutes, and setting the next meeting date.

food-policycommunity-engagementsurveymeeting-procedures
Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Mar 18, 2025 · 1:00 PM

City of Columbia New Century Fund, Inc. Board

City of Columbia New Century Fund Board meeting cancelled

The City of Columbia New Century Fund, Inc. Board meeting scheduled for March 18, 2025 was cancelled. No agenda items were acted upon. The agenda listed topics such as planning the future for NCF, discussion on the board’s future, and the central bank account, but no decisions were made.

boardfinanceplanninggovernance
Conference Room 1C Columbia City Hall 701 E. Broadway
Tue Mar 18, 2025 · 5:30 PM

Public Transit Advisory Commission

Paratransit presentation and FY26 budget discussion

The Public Transit Advisory Commission will hear a paratransit presentation from Mike Sokoff, discuss the FY26 budget, and consider several events including Transit Driver Appreciation Day and Earth Day. The commission will also review ridership data for January and February and approve the January 21 meeting minutes.

transitparatransitbudgetridershippublic-transit-advisory-commissioncolumbia
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Mar 17, 2025 · 1:00 PM

Finance Advisory and Audit Committee

FAAC will review the 2024 financial audit and FY24 comprehensive financial report

The Finance Advisory and Audit Committee will discuss several oversight items, including a review of its own structure and mandate, the city finance ordinance, and the City Council agenda. New business includes reviewing the 2024 financial audit and the Annual Comprehensive Financial Report for fiscal year 2024. The committee will also consider expenditure comparison reports and monthly economic charts for March 2025.

financeauditbudgetreportingoversight
Conference Room 1C Columbia City Hall 701 E. Broadway
Mon Mar 17, 2025 · 7:00 PM

City Council

City Council to approve Axon Enterprise contract for police technology services

The Columbia City Council will consider a master services and purchasing agreement with Axon Enterprise, Inc. to provide software, equipment, and technology for the Police Department, including a budget appropriation. Other items include a HOME investment partnership for 14 affordable housing units at Providence Landing, a professional engineering study for pedestrian safety, a conditional use permit for a short‑term rental at 5406 Gemstone Way, and the annexation and zoning of property at 5961 S. Highway KK. The council will also hear the fiscal year 2024 financial audit and swearing‑in of the new Director of Economic Development.

policehousingzoningbudgetdevelopmentpublic-safetyinfrastructure
City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (15 roll-call votes)
Named votes as recorded in the official record.
B36-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B38-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B39-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B42-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B40-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B37-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R28-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R25-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R26-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R30-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R31-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R32-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R29-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R27-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B41-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
Mon Mar 17, 2025 · 5:00 PM

City Council

City Council to receive Complete Streets presentation

The City Council will hold a meeting to view a Complete Streets presentation. The body will also enter a closed session to discuss personnel records and employee matters.

transportationpersonnelcity-council
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-29772 — Approved a Motion
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
Thu Mar 13, 2025 · 4:00 PM

Mayor's Council on Physical Fitness and Health

Awards subcommittee to review Mayor's Awards applications, finalize ceremony plans

The Mayor's Council on Physical Fitness and Health Awards Subcommittee will review applications for the Mayor's Awards and discuss ceremony logistics, including plaques, timeline, and other arrangements. The meeting also includes approval of the agenda and minutes from the November 14, 2024, subcommittee meeting. Public comments are welcome.

awardsphysical-fitnesshealthsubcommitteeceremonycity-of-columbia
ARC Conference Room 1701 W Ash Columbia, MO
Thu Mar 13, 2025 · 5:30 PM

Board of Health

Board of Health meeting canceled

This meeting of the Columbia/Boone County Board of Health was canceled. No decisions or discussions took place. The agenda had included a review of City Ordinance Article VI on feral cats and a director's report.

board-of-healthcanceledferal-cats
Columbia/Boone County Health & Human Services Training Room 1 1005 W. Worley St. Columbia, MO.
Thu Mar 13, 2025 · 3:00 PM

Disabilities Commission

Disabilities Commission to discuss accessible-business awards, elect officers

The Disabilities Commission will discuss creating an award-based program for accessible public businesses and consider selecting members to attend the National ADA Symposium. Elections for Chair, Vice-Chair, and Secretary will be held. A public comment on the West Ash Improvement Project is also on the agenda. The meeting includes approval of minutes and reports from several advisory bodies.

disabilitiesaccessibilityawardselectionspublic-transitada-symposiumwest-ash
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Wed Mar 12, 2025 · 8:00 AM

Water and Light Advisory Board

Advisory board reviews MISO capacity, water rates, battery storage

The Water and Light Advisory Board will hear presentations on MISO Zone 5 capacity needs and a water cost of service overview process. They will also review financial reports, a battery storage study, and quarterly updates on disconnections, CIP projects, and renewable energy.

utilitieselectricitywaterratescapacitybattery-storagerenewable-energycip
701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Mar 12, 2025 · 6:30 PM

Housing and Community Development Commission

FY26 CDBG and HOME pre-application workshop

The commission will conduct a pre-application workshop for FY26 Community Development Block Grant (CDBG) and HOME Investment Partnerships Program funding. This is an informational session for applicants, not a decision-making meeting.

housingcommunity-developmentcdbghomefundingworkshop
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Wed Mar 12, 2025 · 6:00 PM

Citizens Police Review Board

Board to discuss 2024 complaint data analysis and enter closed session

The Citizens Police Review Board will consider a plan for analyzing 2024 complaint data for a supplemental annual report. They will also review minutes from February 26, update a brochure, hear a report from the Human Rights Commission, and take public comment. The board then plans to enter a closed session to discuss protected records, including a status update and the 2024 complaint data.

police-oversightcomplaintsdata-analysisclosed-sessionpublic-comment
City Council Chambers 701 E Broadway Columbia, Missouri
Wed Mar 12, 2025 · 3:00 PM

Parking Advisory Commission

Commission to discuss on-street parking layout overhaul

The Parking Advisory Commission will discuss an overhaul of on-street parking layouts and receive updates on the Plaza Garage and parking operations. Revenue matters are also on the agenda. The meeting is open to the public.

parkingtransportationdowntownpublic-works
Room 1A/1B City Hall 701 E. Broadway Columbia, MO 65201 City Hall
Tue Mar 11, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to discuss adopting 2024 International Energy Conservation Code

The Building Construction Codes Commission will review and discuss positions on the 2024 International Energy Conservation Code (IECC), including potential appendices, amendments, and adoption. The meeting also includes an update on air leakage testing for commercial buildings. No votes or final decisions are scheduled; the discussion informs future recommendations.

energy-codebuilding-codescommercial-buildingsieccenergy-conservationcolumbia-mo
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
6 yea
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
TMP-29769 — Approved a Motion
6 yea
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
Tue Mar 11, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council to discuss 2025 Youth Summit and Missouri bill

The Youth Advisory Council will meet to discuss the 2025 Youth Summit, consider support for a new Missouri bill, and review updates from City Council meetings. They will also work on the annual report to the City Council. All items are for discussion; no votes are scheduled.

youthadvisory-councilcolumbiameetingyouth-summitmissouri-billannual-report
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Mar 10, 2025 · 4:15 PM

Commission on Cultural Affairs

Cultural Affairs Commission to review FY25 mid-year grants

The Commission will consider recommendations for FY25 Mid-Year Grants and Small Request Applications. Reports include updates on FY26 grant funding, City Hall public art, and the Columbia Arts Fund. The meeting also covers the Commemorative Poster Call for Artists and Celebration of the Arts.

cultural-affairsgrantspublic-artarts-fundingcity-hall-artcolumbia-mo
City Hall Council Chambers 701 E. Broadway Columbia, MO
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem present
APPROVAL OF MINUTES — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem present
TMP-29719 — Approved a Motion
20 yea · 2 abstain · 2 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings abstain · Phillip Overeem present · Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings abstain · Phillip Overeem present
TMP-29720 — Approved a Motion
11 yea · 1 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte yea · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem present
Mon Mar 10, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review International Residential Code appendices

The Building Construction Codes Commission will meet to continue a subcommittee review of the International Residential Code. The session focuses on reviewing code appendices starting with appendix BG.

building-codesresidential-constructionregulatory-review
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Fri Mar 7, 2025 · 8:30 AM

Investment Committee

Investment Committee to hear UBS presentation on city funds

The Investment Committee is meeting to receive a presentation from UBS regarding city investments. The agenda also includes approval of minutes from the previous meeting. No old business is scheduled.

investmentfinancepresentationcity-funds
Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Fri Mar 7, 2025 · 9:30 AM

Police Retirement Board

Police Retirement Board to review financial reports

The Police Retirement Board will meet to approve minutes and review financial reports for the Police Retire Register and Police Revenue and Expenses.

policeretirementfinanceboardcolumbia
Conference Rooms 1A & 1B Columbia City HAll 701 E. Broadway
Fri Mar 7, 2025 · 8:00 AM

Firefighters' Retirement Board

Actuarial study for LAGERS impact to be reviewed

The Firefighters' Retirement Board will review an actuarial study regarding the LAGERS impact and hear financial reports including DROP, retire register, and revenue/expenses. No old business is scheduled. The meeting is primarily procedural with routine updates.

firefightersretirement-boardpensionactuarialfinancecolumbia-mo
Conference Rooms 1A & 1B Columbia City Hall 701 E. Broadway
Thu Mar 6, 2025 · 5:30 PM

Planning and Zoning Commission

UDC text amendment on small lot standards discussed

The Planning and Zoning Commission will hold a work session to discuss a proposed UDC text amendment concerning use-specific standards for small lots. This item is carried over from a previous meeting as old business. No final vote is expected; the discussion will inform future recommendations.

zoningurban-development-codesmall-lotstext-amendmentplanning
Columbia City Hall Conference Rm 1A/1B 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29655 — Approved a Motion
7 yea · 2 abstain
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones abstain · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters abstain · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Thu Mar 6, 2025 · 7:00 PM

Planning and Zoning Commission

Commission considers 32-lot cottage development and short-term rental permits

The Planning and Zoning Commission will review a proposal to annex and rezone 5.05 acres for a 32-lot cottage development. The body will also consider several short-term rental permits and a 14-acre preliminary plat.

zoningannexationhousingshort-term-rentalsland-development
Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-29662 — Approved a Motion
7 yea · 2 nay
Sara Loe nay · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams nay · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
The other 9 items passed by unanimous or near-unanimous consent.
Thu Mar 6, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Mayor's Council on Physical Fitness and Health to meet March 6

The Mayor's Council on Physical Fitness and Health will meet to discuss ongoing fitness and health initiatives. The agenda includes the election of a Vice-Chair and the development of a mini-grant program.

healthfitnessgrantscommunity-wellness
ARC Meeting Room 1701 W. Ash
Wed Mar 5, 2025 · 2:00 PM

Columbia Arts Fund Advisory Committee

Committee will consider FY26 funding distribution recommendations

The Columbia Arts Fund Advisory Committee will review and recommend how to allocate funds for fiscal year 2026 and discuss fundraising plans. The meeting also includes routine approvals of the agenda and minutes from April 10, 2024, and allows public comments.

artsfundingbudgetcommunitynonprofit
City Hall Conference Room 1C 701 E. Broadway Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea
Sarah Dresser yea · Diana Moxon yea · Kathleen Murphy yea · Kate Nolte yea · Jennifer Jennings yea
APPROVAL OF MINUTES — Approved a Motion
5 yea
Sarah Dresser yea · Diana Moxon yea · Kathleen Murphy yea · Kate Nolte yea · Jennifer Jennings yea
TMP-29664 — Approved a Motion
4 yea · 1 abstain
Sarah Dresser yea · Diana Moxon yea · Kathleen Murphy yea · Kate Nolte yea · Jennifer Jennings abstain
Wed Mar 5, 2025 · 6:30 PM

Community Land Trust Organization Board

Board to discuss ARPA fund spending and 6 Fourth Ave development

The Community Land Trust Organization Board will review expenditures of ARPA funds, discuss the development of 6 Fourth Ave, and consider a wooden privacy fence for Hickman Houses. The board also plans to go into closed session to discuss sealed bids and real estate transactions.

community-land-trusthousingdevelopmentarpa-fundsreal-estateclosed-sessionfences
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 4 present
Shirley Rhoades yea · Anthony Stanton present · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present
TMP-29667 — Approved a Motion
6 yea · 3 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
TMP-29668 — Approved a Motion
7 yea · 2 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present
TMP-29670 — Approved a Motion
14 yea · 4 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present
TMP-29676 — Approved a Motion
14 yea · 4 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present · Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook present · Douglas Hunt yea · Rikki Ascani yea · Valerie Carroll present
Tue Mar 4, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to discuss adoption of 2024 International Energy Conservation Code

The Building Construction Codes Commission will revisit commercial provisions and discuss positions on appendices and amendments regarding adoption of the 2024 IECC text with the City Energy Code. They will also approve minutes from the February 18, 2025 subcommittee meeting.

building-codesenergy-conservationiecccommercial-provisionscode-adoption
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 1 present
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
5 yea · 1 present
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
TMP-29640 — Approved a Motion
5 yea · 1 present
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
Tue Mar 4, 2025 · 7:00 PM

Historic Preservation Commission

Demolition permit for 406 Sanford Ave and grant agreement on agenda

The Historic Preservation Commission will consider a demolition permit application for 406 Sanford Avenue. They will also review a draft grant agreement for the Benton-Stephens Survey Phase I and a 70% draft of the Preservation Plan. Additionally, they will plan a public input meeting and discuss partnering with CoMo Preservation for architectural salvage.

historic-preservationdemolition-permitpreservation-plangrantbenton-stephenspublic-inputarchitectural-salvagecolumbia-mo
Conference Room 1B City Hall 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
TMP-29677 — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
TMP-29680 — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
Tue Mar 4, 2025 · 5:30 PM

Commission on Human Rights

Commission to hear DIVERT program update, discuss budget and HREP proposal

The Commission will hear a presentation from Janie Ridgwell on the DIVERT program, receive an update on the HRC budget, and discuss language updates to the HREP proposal form. Old business includes a brainstorming workshop at the Food Bank and confirmation of rack card distribution. The meeting will also go into closed session to discuss five pending discrimination cases (2024-00020, 2024-00021, 2024-00022, 2024-00023, 2024-00031). Next meeting is April 1, 2025.

human-rightsdivert-programbudgethrepclosed-sessiondiscriminationpublic-safety
Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-29593 — Approved a Motion
4 yea · 3 present
Amanda Hinnant yea · Meera Sood present · Astrid Villamil present · Stephanie Yoakum present · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
7 yea
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
Mon Mar 3, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review twelve building code updates from Feb. 24 meeting

The Building Construction Codes Commission will meet to approve minutes from the previous meeting and review twelve code updates discussed at the February 24, 2025 meeting. No new business or public hearings are scheduled. The agenda is largely procedural with a focus on ongoing code review work.

building-codeselectric-codecode-reviewcolumbiacommission-meeting
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Mon Mar 3, 2025 · 5:00 PM

City Council

Council to discuss convention center feasibility study

The City Council will hold a public discussion on a Convention Center Feasibility Study, then vote to enter closed session to discuss legal matters. No votes on ordinances or contracts are scheduled.

convention-centerfeasibility-studycity-councilpublic-discussionclosed-session
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-29647 — Approved a Motion
5 yea · 2 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
Mon Mar 3, 2025 · 4:45 PM

Building Construction Codes Commission

Continues International Residential Code review

The Building Construction Codes Commission will continue its review of the International Residential Code as part of its new business. The meeting includes approval of prior minutes and public comment. No decisions or votes on specific code changes are scheduled.

building-codesresidential-codecode-reviewconstructioncolumbia-mo
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Mon Mar 3, 2025 · 7:00 PM

City Council

Council to vote on rezoning North Cedar Lake Drive to multi-family

The Council will vote on a rezoning of property at North Cedar Lake Drive and John Garry Drive from mixed-use to multi-family, and on several final plats and development agreements. Public hearings are scheduled for traffic calming on Rollins Road and the annexation of 5961 S. Highway KK. New business includes introductions for a voluntary annexation, budget amendments, a conditional use permit for a short-term rental, and a pedestrian safety study.

zoningannexationtraffic-calmingpublic-safetyhousinginfrastructurebudgetshort-term-rentals
City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (15 roll-call votes)
Named votes as recorded in the official record.
B35-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B31-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B34-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B32-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B30-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B27-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B25-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B26-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B24-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B28-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B29-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
B33-25 — Passed
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R23-25 — Adopted
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R24-25 — Adopted
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
R22-25 — Adopted
4 yea · 3 absent
Barbara Buffaloe yea · Nick Foster absent · Roy Lovelady absent · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
Thu Feb 27, 2025 · 12:00 PM

Columbia Parks and Recreation Fund Advisory Committee

Committee to consider expenditure for MKT Bridges project

The Columbia Parks and Recreation Fund Advisory Committee will meet to discuss fund allocations. The primary action item is the authorization of a designated expenditure for the MKT Bridges project.

parksinfrastructuremkt-bridgesfunding
Gentry Building Conference Room #1 South 7th St. Columbia, MO
Thu Feb 27, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review amendments to existing building code

The Building Construction Codes Commission will meet to discuss the layout for reviewing the International Existing Building Code, select a committee chairperson, and examine current amendments and their placement in the new text. The meeting includes public comment and planning for the next meeting on March 6, 2025. This is a procedural work session with no final decisions expected.

building-codesamendmentsinternational-existing-building-codecolumbia-mocommission-meetingprocedural
Columbia Convention & Visitors Bureau, 300 S. Providence Rd, Columbia MO 65203
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 1 present
Brian Connell yea · David Weber present · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
4 yea · 1 present
Brian Connell yea · David Weber present · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
3) Review of Current Amendments and their location in the new text — Approved a Motion
4 yea · 1 present
Brian Connell yea · David Weber present · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
Wed Feb 26, 2025 · 3:00 PM

Airport Advisory Board

Airport Advisory Board to discuss aircraft support equipment

The Airport Advisory Board will meet to discuss aircraft support equipment and review the board's meeting schedule. The session includes a report from Mike Parks and a review of travel and training.

airportequipmentaviationcity-administration
Columbia Regional Airport Terminal Conference Room 11350 S Airport Drive Columbia MO
Wed Feb 26, 2025 · 6:00 PM

Citizens Police Review Board

Board to go into closed session for protected records discussion

This is largely a procedural meeting. The Citizens Police Review Board will consider approving draft minutes from January 2025 and then vote to enter closed session to discuss records exempt from disclosure under Missouri law. No public hearings or policy decisions are scheduled.

police-reviewclosed-sessionminutescity-of-columbiaprocedural
City Council Chambers 701 East Broadway Columbia, Missouri
Tue Feb 25, 2025 · 4:00 PM

Building Construction Codes Commission

Columbia building codes commission meeting set for Feb. 25

The Building Construction Codes Commission will meet to review commercial provisions and discuss the adoption of the 2024 International Energy Conservation Code. The meeting is held at Columbia City Hall.

building-codesconstructionenergycity-hallpublic-meeting
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Tue Feb 25, 2025 · 2:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO to vote on state safety targets and Business Loop 70 map revision

The CATSO Coordinating Committee will consider adopting MoDOT's statewide safety, pavement and bridge, and system performance targets. They will also discuss revisions to the functional classification map for Business Loop 70, an update to the CATSO Unfunded Needs List, and a request to revise the Ash Street Major Roadway Plan. The meeting is open for public comment.

transportationsafety-targetsroad-mapbusiness-loop-70ash-streetunfunded-needspublic-transitcoordinating-committee
City Council Chamber City Hall 701. E. Broadway Columbia, Missouri
Tue Feb 25, 2025 · 6:00 PM

Climate and Environment Commission

Climate Commission to elect officers, review energy code, discuss budget

The Climate and Environment Commission will elect a Chair, Vice Chair, and Secretary, and receive an update on the 2024 International Energy Conservation Code review, including appendices. The commission will also continue its discussion of the City of Columbia budget, considering a FY25 budget proposal and an updated FY26 budget timeline.

climateenergy-codebudgetcommission-electionscolumbia-mo
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Mon Feb 24, 2025 · 2:00 PM

City Council

City Council will discuss revenue and upcoming fiscal year budgets

The council will hold a revenue discussion, reviewing presentations and documents related to the FY 2025 budget and FY 2026 budget requests for city boards and commissions. No other agenda items are listed beyond the revenue discussion and standard procedural items.

budgetfinancerevenuecity-council
City Hall Council Chambers 701 E. Broadway Columbia, MO.
Mon Feb 24, 2025 · 4:30 PM

Building Construction Codes Commission

Commission to review 2024 updates to multiple international building codes

The Building Construction Codes Commission will receive presentations on changes to the 2024 International Property Maintenance, Fire, Fuel Gas, Plumbing, and Mechanical Codes. Subcommittees will also provide updates on the IBC/IEBC, IRC, IECC, and NEC codes, with further discussion on NEC changes.

building-codesfire-codeplumbingmechanicalfuel-gasproperty-maintenancesubcommittee-updates
Council Chambers
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
13 yea · 6 present
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson yea · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young yea · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
ADJOURNMENT — Approved a Motion
13 yea · 6 present
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson yea · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young yea · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
TMP-29575 — Approved a Motion
13 yea · 6 present
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson yea · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young yea · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
1) Presentation of International Property Maintenance Code 2024 changes. — Approved a Motion
13 yea · 6 present
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson yea · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young yea · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
5) Presentation of International Mechanical Code 2024 changes. — Approved a Motion
13 yea · 6 present
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson yea · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young yea · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
9) Updates from NEC code subcommittee — Approved a Motion
13 yea · 6 present
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson yea · Fred Malicoat yea · Richard Shanker yea · David Weber yea · Matthew Young yea · John Neyens present · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove present · Robert Schreiber present · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
Thu Feb 20, 2025 · 4:30 PM

Building Construction Codes Commission

Commission to review International Building Code Chapter 16

The Building Construction Codes Commission will meet to continue a subcommittee review of the International Building Code. The session focuses on a specific section of the code.

building-codesinternational-building-codeconstruction
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 yea · 2 present
David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber present · Brian Connell yea
ADJOURNMENT — Approved a Motion
3 yea · 2 present
David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber present · Brian Connell yea
TMP-29408 — Approved a Motion
3 yea · 2 present
David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber present · Brian Connell yea
Thu Feb 20, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss short-term rental rules, small lot code changes

The Planning and Zoning Commission will hold a work session to discuss potential revisions to short-term rental conditional use permit questions and a text amendment to the Unified Development Code for small lot use-specific standards. No votes are scheduled; items are under discussion only.

short-term-rentalszoningplanningcode-amendmentsland-use
CONFERENCE RM 1A/1B CITY HALL 701 E BROADWAY
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
TMP-29584 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
Thu Feb 20, 2025 · 7:00 PM

Planning and Zoning Commission

Commission considers annexation and zoning for 201 Old Plank Road

The Planning and Zoning Commission will review a request to establish permanent city zoning for a property being annexed. The body will also consider a final plat for a lot at 1300 Fellows Place.

zoningannexationland-usesubdivisions
Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
TMP-29585 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
TMP-29588 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
TMP-29589 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones present · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters present · McKenzie Ortiz yea · David Brodsky yea
Wed Feb 19, 2025 · 5:00 PM

Tree Board

Tree Board to discuss establishing a city tree fund and FY25 budget

The Tree Board will discuss creating a dedicated city tree fund and review items for the FY25 budget. The board will also plan upcoming outreach and education opportunities. The city arborist will provide an update on current issues and projects. Public comments are allowed.

tree-boardcity-tree-fundbudgetoutreacheducationurban-forestry
City Hall Conference Room 1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 3 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
3 yea · 3 present · 1 abstain
Michael Kyd yea · Jacob McMains abstain · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
4 yea · 3 present
Michael Kyd yea · Jacob McMains yea · Samuel Wright present · Stephen Bybee present · Patricia Quackenbush present · Max Miller yea · Renee Scheidt-Hahn yea
Wed Feb 19, 2025 · 8:00 AM

Water and Light Advisory Board

Board reviews water cost of service overview and monthly utility reports

The Water and Light Advisory Board will discuss the Water Cost of Service Overview Process presented by Stantec. It will also review December 2024 water and electric financial statements, the monthly power cost adjustment report, and quarterly utility disconnection and CIP progress reports. No formal decisions are indicated on the agenda.

waterelectricfinanceutility-reportscost-of-service
701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Feb 19, 2025 · 5:30 PM

Historic Preservation Commission

Public input session on Historic Preservation Plan draft

The Historic Preservation Commission is holding a public input session on the draft Historic Preservation Plan (December 2024 draft). No votes or decisions are scheduled; the meeting is solely for gathering public comment on the plan.

historic-preservationpublic-inputplanning
Watt Room Boone Electric Cooperative Community Building 1413 Rangeline Street
Wed Feb 19, 2025 · 7:00 PM

Housing and Community Development Commission

Housing and Community Development Commission meeting cancelled

The February 19, 2025, meeting was cancelled due to a lack of quorum. No decisions were made.

housingcommunity-developmentprocedural
City Hall Council Chambers 701 E. Broadway Columbia, MO.
Wed Feb 19, 2025 · 4:15 PM

Food Council

Columbia Food Council to hold focus group work session

The Food Council will conduct a focus group work session. The body will also receive updates on a retailer and producer survey and the ambassador program.

food-councilsurveyssolid-waste
Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Tue Feb 18, 2025 · 4:00 PM

Building Construction Codes Commission

Commission reviews International Energy Conservation Code

The Building Construction Codes Commission is meeting to conduct a subcommittee review of the International Energy Conservation Code. The session will focus on specific performance and energy rating methods.

building-codesenergy-conservationconstruction
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 1 present
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
5 yea · 1 present
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
TMP-29567 — Approved a Motion
5 yea · 1 present
Brian Connell yea · Richard Shanker yea · John Neyens yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
Tue Feb 18, 2025 · 5:30 PM

Public Transit Advisory Commission

Paratransit presentation, FY26 budget on PTAC agenda

The Public Transit Advisory Commission will hear a paratransit presentation from Mike Sokoff, discuss the FY26 budget and annual report, and plan events for Transit Driver Appreciation Day and Earth Day. The meeting also includes ridership data review and updates from other city commissions.

public-transitparatransitbudgetridershipcolumbia-mo
Conference Room 1A City Hall 701 E. Broadway Columbia, MO.
Mon Feb 17, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Finance Advisory and Audit Committee to review mission and revenue

The Finance Advisory and Audit Committee will discuss the committee's mission statement and revenue. The body will also review the February 2025 Monthly Economic Report and the Finance Ordinance.

financeauditeconomic-reportgovernment-operations
Conference Rooms 1A/1B Columbia City Hall 701 E. Broadway
Mon Feb 17, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review International Electric Code

The Building Construction Codes Commission is meeting to conduct a subcommittee review of the International Electric Code. The session includes a review of changes provided by Curtis Lichty.

building-codeselectrical-codepublic-safety
Regional Economic Development (REDI), 500 E Walnut ST #102, Columbia, MO.65201
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 2 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove yea · Andy Noordsy yea · Dan Shifley yea
ADJOURNMENT — Approved a Motion
6 yea · 2 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove yea · Andy Noordsy yea · Dan Shifley yea
TMP-29559 — Approved a Motion
6 yea · 2 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove yea · Andy Noordsy yea · Dan Shifley yea
Mon Feb 17, 2025 · 4:45 PM

Building Construction Codes Commission

Commission continues International Residential Code review after section 507.5

The Building Construction Codes Commission will continue its review of the International Residential Code, picking up after section 507.5. The meeting includes approval of prior minutes and public comment. No other substantive items are on the agenda.

building-codesconstructionresidential-codeirccode-review
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Mon Feb 17, 2025 · 7:00 PM

City Council

Council considers renovations for Fire Station #10 interim spaces

The City Council will hold a public hearing regarding renovations at 1020 S. El Chaparral Avenue for Fire Station #10. The body is also voting on several planned developments, infrastructure projects, and intergovernmental agreements with Boone County.

fire-departmentzoninginfrastructurehousingpublic-healthannexation
City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
B21-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B22-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B23-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B19-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B16-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B18-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B20-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B17-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B15-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R21-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R20-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R19-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
Thu Feb 13, 2025 · 8:00 AM

Railroad Advisory Board

Railroad Advisory Board reviews traffic reports and minutes

This is a routine meeting with no votes on legislation or funding. The board will review and approve previous meeting minutes, consider financial reports if available, and discuss COLT traffic data for January 2025. Public comment is invited.

railroadadvisory-boardtrafficcolumbia-mopublic-meeting
701 E Broadway Columbia, MO Conference Room 1C
Thu Feb 13, 2025 · 4:00 PM

Building Construction Codes Commission

Commission will review Chapter 16 section 1607.8.2 of the International Building Code

The Building Construction Codes Commission will resume its review of the International Building Code, specifically Chapter 16 section 1607.8.2. The agenda also includes routine items such as call to order, approval of the agenda and minutes, and a public comment period. No other substantive actions are listed for this meeting.

building-codespermitspublic-commentmeeting-procedures
Regional Economic Development (REDI), 500 E Walnut ST #102, Columbia, MO.65201
Thu Feb 13, 2025 · 5:30 PM

Historic Preservation Commission

Historic Preservation Commission to consider demolition permit for 1206 Smith Street

The commission will review a demolition permit application for 1206 Smith Street. They will also discuss a draft grant agreement for the Benton-Stephens Survey Phase I and receive a Preservation Plan status update. Old business includes reviewing feedback on the preservation plan and selecting most notable properties from a list of nine addresses.

historic-preservationdemolitiongrantpreservation-plancolumbia-mo
Conference Room 1C City Hall 701 E. Broadway
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott present · Tyler Travers present · Carrie Gartner absent · Josh Parshall absent
APPROVAL OF MINUTES — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott present · Tyler Travers present · Carrie Gartner absent · Josh Parshall absent
DEMOLITION PERMIT APPLICATIONS — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott present · Tyler Travers present · Carrie Gartner absent · Josh Parshall absent
TMP-29420 — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott present · Tyler Travers present · Carrie Gartner absent · Josh Parshall absent
TMP-29421 — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott present · Tyler Travers present · Carrie Gartner absent · Josh Parshall absent
Thu Feb 13, 2025 · 5:30 PM

Board of Health

Board of Health to discuss edits to animal and fowl ordinances

The Board of Health will meet to review proposed revisions to Chapter 5 of the City of Columbia Code of Ordinances. This section specifically concerns animals and fowl.

health-departmentanimalscity-codeordinances
Columbia/Boone County Health & Human Services Training Room 1 1005 W. Worley St. Columbia, MO.
Thu Feb 13, 2025 · 12:00 PM

Columbia Sports Commission

Sports Commission to elect chair, discuss 2025 NCAA cross-country champs

The Columbia Sports Commission will nominate and vote on a chair and vice-chair for 2025, and discuss the 2025 NCAA Cross-Country National Championships. Staff reports on sports commission activities and parks facilities will be presented. The meeting is primarily administrative with no budget or ordinance actions.

sports-commissionelectionsncaacross-countrycolumbiaparks-and-recreation
Columbia Sports Fieldhouse 4251 Philips Farm Rd Columbia, MO
Thu Feb 13, 2025 · 3:00 PM

Disabilities Commission

Commission to discuss Texas v. Becerra lawsuit on Section 504

The Disabilities Commission will hear presentations on the city's Strategic Plan and the Missouri Sunshine Law, then discuss an award program for accessible businesses, the commission budget, pedestrian safety and noise from electric buses, and the federal lawsuit Texas v. Becerra concerning Section 504 accessibility law.

disabilitiesaccessibilitystrategic-plansunshine-lawlawsuitbudgettransportation
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Thu Feb 13, 2025 · 6:30 PM

Parks and Recreation Commission

Commission holds public hearing on Parks Management Center fleet facility

The Parks and Recreation Commission will hold a public hearing regarding a fleet maintenance facility at the Parks Management Center. The body will also discuss updates to Strawn Park and a grant application for the MKT Trail bridge replacement project.

parksinfrastructurepublic-hearinggrantstrails
ARC Meeting Room 1701 W. Ash
Wed Feb 12, 2025 · 8:00 AM

Water and Light Advisory Board

Water and Light Advisory Board Feb. 12 meeting cancelled

The Water and Light Advisory Board meeting scheduled for February 12, 2025, was cancelled. The agenda had included a water cost of service overview by Stantec, monthly financial reports, quarterly disconnection and CIP reports, and a renewable energy report.

cancelledwaterelectricutility-ratesfinancial-reportsrenewable-energycapital-improvements
701 E Broadway Columbia, MO Conference Room 1A/1B
Wed Feb 12, 2025 · 12:00 PM

Substance Use Prevention Advisory Commission

Substance Use Prevention Advisory Commission meeting canceled

This meeting was canceled. There are no decisions or discussions to report.

meeting-canceledsubstance-use-preventioncolumbia-mo
Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed Feb 12, 2025 · 6:00 PM

Citizens Police Review Board

CPRB to review three complaints in closed session, hear Co-Responder Model report

The Citizens Police Review Board will meet to approve January minutes and update a brochure. New business includes a report on the Co-Responder Model from police, a discussion of confidentiality and closure of records, and a proposal for the annual report. The board will then vote to enter closed session to review three complaints. Public comments will be taken before closed session.

police-oversightcomplaints-reviewco-responder-modelconfidentialityannual-reportpublic-safety
City Council Chambers 701 East Broadway Columbia, Missouri
Wed Feb 12, 2025 · 3:00 AM

Parking Advisory Commission

Commission to discuss on-street parking layout overhaul

The Parking Advisory Commission will receive updates on the Plaza Garage and parking operations. New business includes a proposed overhaul of on-street parking layout and a discussion of revenue. Public comments will be heard.

parkingcommissionpublic-workstransportationdowntowninfrastructure
Room 1A/1B 701 E. Broadway Columbia, MO 65201 City Hall
Tue Feb 11, 2025 · 4:00 PM

Mayor's Council on Physical Fitness and Health

Council subcommittee to finalize Winter Well-Being Expo details

The Event Subcommittee of the Mayor's Council on Physical Fitness and Health will meet to finalize plans for the Winter Well-Being Expo, including weather contingencies, vendor and volunteer arrangements. The meeting also includes approval of the agenda and minutes from previous meetings, and an opportunity for public comment.

healthphysical-fitnesswinter-well-being-expocolumbiasubcommittee
ARC Conference Room 1701 W. Ash Columbia, MO
Tue Feb 11, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review energy code compliance methods and Section 408

The Building Construction Codes Commission will continue its review of the International Energy Conservation Code, focusing on Section 408, the simulated performance method, and the Energy Rating Index (ERI) method. The subcommittee previously discussed these items on February 4.

building-codesenergy-conservationiecccodes-review
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
APPROVAL OF MINUTES — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
Tue Feb 11, 2025 · 6:00 PM

Youth Advisory Council

Youth Council to discuss 2025 Youth Summit and new Missouri bill

The Youth Advisory Council will discuss planning for the 2025 Youth Summit, receive updates on working groups and the Six Areas of Focus, and consider support for a new Missouri bill. The council will also review its attendance policy.

youthadvisory-councilsummitattendance-policymissouri-bill
Conference Room 1A/1B 701 E. Broadway Columbia, MO.
Tue Feb 11, 2025 · 1:30 PM

Columbia Area Transportation Study Organization (CATSO)

CATSO to consider functional classification revisions to Business Loop 70

The CATSO Technical Committee will consider adopting MoDOT's statewide safety, pavement and bridge, and system performance targets. They will also discuss proposed functional classification revisions to Business Loop 70 (BL 70), update the CATSO unfunded needs list, and review a potential Ash Street major roadway plan revision and the draft coordinated public transit human services transportation plan.

transportationsafety-targetspavement-bridgesystem-performancefunctional-classificationbusiness-loop-70unfunded-needspublic-transit
Conference Room 1C City Hall 701 E. Broadway Columbia, Missouri
Tue Feb 11, 2025 · 6:00 PM

Human Services Commission

Commission to hear Boone Impact Group on ARPA funding, discuss social services RFP

The Human Services Commission will hear a presentation from the Boone Impact Group regarding ARPA funding, elect a representative to the Community Development Commission, and discuss the FY2025 social services RFP and funding timeline. The meeting includes approval of January minutes and staff reports.

human-servicessocial-servicesfundingarpacommunity-developmentboone-countycolumbia-missouri
Training Room 1 Columbia/Boone County Department of Public Health and Human Services 1005 W. Worley St.
Mon Feb 10, 2025 · 4:15 PM

Commission on Cultural Affairs

Cultural affairs commission hears funding updates and reports

The Commission on Cultural Affairs will discuss committee reports on public art and the funding process, and consider recognition of Nick Cave. Staff will provide updates on the Columbia Arts Fund, state arts advocacy, diversity events, and the status of FY24 and FY25 funding. No votes or decisions are scheduled; the meeting is informational.

artsculturefundingpublic-artevents
City Hall Council Chambers 701 E. Broadway Columbia, MO
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
10 yea · 2 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem yea
APPROVAL OF MINUTES — Approved a Motion
10 yea · 2 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem yea
ADJOURNMENT — Approved a Motion
10 yea · 2 present
Kristin Gadsden yea · Cameron Dorth yea · Molly Froidl yea · Linda Helmick yea · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy present · Kate Nolte yea · Ryan Hobart present · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem yea
Mon Feb 10, 2025 · 4:45 PM

Building Construction Codes Commission

Building Construction Codes Commission to continue International Residential Code review

The commission is meeting to continue a subcommittee review of the International Residential Code. No new business or specific ordinances are listed for decision.

building-codesresidential-constructionregulatory-review
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-29464 — Approved a Motion
4 yea · 1 present
Kas Carlson yea · Jonathan Trunk yea · John Page yea · Kyle Saunders present · David Weber yea
Mon Feb 10, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review International Electric Code and city amendments

The Building Construction Codes Commission will meet to continue reviewing the International Electric Code. The body will discuss amendments starting at section 300.5 and review city amendments to the 2017 Code.

building-codeselectrical-codepublic-safety
Regional Economic Development (REDI), 500 E Walnut ST #102, Columbia, MO.65201
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 3 present
Fred Malicoat present · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove yea · Andy Noordsy yea · Dan Shifley yea
ADJOURNMENT — Approved a Motion
5 yea · 3 present
Fred Malicoat present · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove yea · Andy Noordsy yea · Dan Shifley yea
TMP-29460 — Approved a Motion
5 yea · 3 present
Fred Malicoat present · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove yea · Andy Noordsy yea · Dan Shifley yea
Sat Feb 8, 2025 · 1:00 PM

Historic Preservation Commission

Demolition permit for 1206 Smith St. and budget request on agenda

The Historic Preservation Commission will hold a workshop on historic tax credits and National Register listing, then consider a demolition permit for 1206 Smith Street. New business includes review of preservation plan feedback, Black History Month activities, Juneteenth participation, and the FY 2026 budget request. Old business covers Most Notable Properties selections and an awards ceremony.

historic-preservationdemolition-permittax-creditsnational-registerbudgetmost-notable-propertiesblack-history-monthjuneteenth
Friends Room Columbia Public Library 100 W. Broadway
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-29426 — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
ADJOURNMENT — Approved a Motion
4 present · 3 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross absent · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
Fri Feb 7, 2025 · 2:00 PM

Commission on Cultural Affairs

Cultural Affairs commission discusses grant process updates

The Funding Process Subcommittee will discuss updates to the annual grant process, including application questions, evaluation criteria, and review procedures. No formal votes or decisions are scheduled; the meeting is a working discussion.

cultural-affairsgrantsfundingcommission
City Hall Room 1C 701 E. Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kate Nolte present
ADJOURNMENT — Approved a Motion
3 yea · 2 present
Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kate Nolte present
Thu Feb 6, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review International Building Code Chapter 16

The Building Construction Codes Commission will meet to continue its review of the International Building Code. The session focuses on a specific section of Chapter 16.

building-codesinternational-building-codeconstruction
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Thu Feb 6, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council to elect officers, discuss mini-grant program

The Mayor's Council on Physical Fitness and Health will elect officers for the coming term and receive updates on the Winter Well-Being Expo and Mayor's Awards. Members will also continue discussions on developing a mini-grant program.

health-fitnessphysical-fitnesscouncilmini-grantcommunity-eventscolumbia
ARC Meeting Room 1701 W. Ash
Thu Feb 6, 2025 · 7:00 PM

Planning and Zoning Commission

Commission to consider design adjustment and final plat for Arcadia Plat 10

The Planning and Zoning Commission will hold public hearings on three items: a design adjustment and final plat for a 13.66-acre industrial/mixed-use development at 2205 Brown School Road (Arcadia Plat 10); a conditional use permit for a short-term rental at 5406 Gemstone Way (tabled from January 23); and a request to zone 1.38 acres at 5961 S Highway KK to R-1 subject to annexation. The Commission will also approve minutes from the January 23 regular meeting.

planningzoningpublic-hearingsubdivisionshort-term-rentalannexationindustrialmixed-use
Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
TMP-29412 — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29417 — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29413 — Approved a Motion
9 yea
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Wed Feb 5, 2025 · 6:30 PM

Community Land Trust Organization Board

Community Land Trust Board to meet February 5

The Community Land Trust Organization Board will meet to approve previous minutes and conduct a closed session. The closed session will cover sealed bids, negotiated contracts, and the purchase or sale of real estate.

community-land-trustreal-estateclosed-session
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
TMP-29415 — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
TMP-29416 — Approved a Motion
11 yea · 7 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present · Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
GENERAL COMMENTS BY PUBLIC, MEMBERS AND STAFF — Approved a Motion
6 yea · 3 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
ADJOURNMENT — Approved a Motion
6 yea · 3 present
Shirley Rhoades yea · Anthony Stanton yea · Alexander LaBrunerie present · Linda Head yea · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt yea · Rikki Ascani present · Valerie Carroll present
Tue Feb 4, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review residential energy conservation code components

The Building Construction Codes Commission will meet to conduct an International Energy Conservation Code review. The session focuses on the residential prescriptive pathway components.

building-codesenergy-conservationresidential
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
Residential Prescriptive pathway components review. — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
TMP-29410 — Approved a Motion
3 present · 3 yea
Brian Connell present · Richard Shanker yea · John Neyens present · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
Tue Feb 4, 2025 · 7:00 AM

Historic Preservation Commission

Historic Preservation Commission meeting cancelled

The February 4, 2025 regular meeting of the Columbia Historic Preservation Commission was cancelled. No decisions or discussions occurred.

meeting-cancelledhistoric-preservationcolumbia
Conference Room 1B City Hall 701 E. Broadway
Tue Feb 4, 2025 · 5:30 PM

Commission on Human Rights

Commission to review enforcement procedures for human rights ordinance

The Commission will review protocol for Chapter 12-57 (Code of Ordinances) to determine enforcement procedures. Officer elections and a History Day sponsorship discussion are also on the agenda. The meeting will include a closed session to discuss pending cases (2024-00020, 2024-00021, 2024-00022, 2024-00023, 2024-00030, 2024-00031).

human-rightscode-of-ordinancesenforcement-proceduresofficer-electionsclosed-sessionpending-cases
Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-29358 — Approved a Motion
6 yea · 1 absent
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil absent · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
7 yea
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil yea · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
Mon Feb 3, 2025 · 4:00 PM

Building Construction Codes Commission

Commission reviews energy efficiency standards for residential code

The Building Construction Codes Commission is meeting to continue a subcommittee review of the International Residential Code. The discussion focuses specifically on Chapter 11 regarding Energy Efficiency.

building-codesenergy-efficiencyresidential-construction
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Mon Feb 3, 2025 · 4:45 PM

Building Construction Codes Commission

Building Construction Codes Commission reviews city amendments to 2017 code

The Building Construction Codes Commission will review proposed amendments to the 2017 International Electric Code and other significant changes. The meeting is scheduled for Monday, February 3, 2025, at 4:45 PM at the Regional Economic Development office.

building-constructioncode-amendmentselectric-codepublic-hearingcolumbia-mo
Regional Economic Development (REDI), 500 E Walnut ST #102, Columbia, MO.65201
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 4 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Jonathan Trunk present · Christopher Howe present · Kyle Saunders present · Andy Noordsy yea · Dan Shifley yea · Jim Dove yea
APPROVAL OF MINUTES — Approved a Motion
5 yea · 4 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Jonathan Trunk present · Christopher Howe present · Kyle Saunders present · Andy Noordsy yea · Dan Shifley yea · Jim Dove yea
ADJOURNMENT — Approved a Motion
5 yea · 4 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Jonathan Trunk present · Christopher Howe present · Kyle Saunders present · Andy Noordsy yea · Dan Shifley yea · Jim Dove yea
1) Review City Amendments to 2017 Code — Approved a Motion
5 yea · 4 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Jonathan Trunk present · Christopher Howe present · Kyle Saunders present · Andy Noordsy yea · Dan Shifley yea · Jim Dove yea
Mon Feb 3, 2025 · 5:00 PM

City Council

Columbia City Council to hold pre-council meeting on February 3

The City Council will meet to discuss the State of the Court and enter a closed session. The closed session will address personnel matters, including hiring, firing, disciplining, and promoting employees.

personnelcourtcity-council
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
TMP-29403 — Approved a Motion
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
Mon Feb 3, 2025 · 7:00 PM

City Council

Council to hold hearings on sidewalk and sewer projects

The City Council will hold public hearings regarding sidewalk construction on Vandiver Drive and Oakland Gravel Road, as well as the Clear Creek sewer improvement project. The body will also consider several contracts for fire services, health programs, and animal control.

infrastructurezoningpublic-safetysewerssidewalkshealth
City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted (12 roll-call votes)
Named votes as recorded in the official record.
B9-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B12-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B13-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B14-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B10-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
B11-25 — Passed
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R13-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R17-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R15-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R16-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R14-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
R18-25 — Adopted
7 yea
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters yea · Valerie Carroll yea
Wed Jan 29, 2025 · 3:00 PM

Airport Advisory Board

Airport Advisory Board to discuss budget

The Airport Advisory Board will meet to review new business regarding the board's budget. The meeting also includes the approval of minutes from December 3, 2024.

airportbudget
Columbia Regional Airport Terminal Conference Room
Wed Jan 29, 2025 · 4:00 PM

Building Construction Codes Commission

Commission continues review of plumbing, mechanical, fuel gas codes

The Building Construction Codes Commission will continue its subcommittee review of the International Plumbing, Mechanical, and Fuel Gas Codes. The meeting includes approval of prior meeting minutes and scheduling the next meeting for February 5, 2025. No new proposals or decisions are on the agenda.

building-codesplumbingmechanicalfuel-gascode-reviewsubcommitteecolumbia-mo
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
3 yea · 2 present
Fred Malicoat yea · John Neyens yea · Kyle Saunders present · Jim Dove yea · Robert Schreiber present
ADJOURNMENT — Approved a Motion
3 yea · 2 present
Fred Malicoat yea · John Neyens yea · Kyle Saunders present · Jim Dove yea · Robert Schreiber present
TMP-29396 — Approved a Motion
3 yea · 2 present
Fred Malicoat yea · John Neyens yea · Kyle Saunders present · Jim Dove yea · Robert Schreiber present
Tue Jan 28, 2025 · 4:00 PM

Building Construction Codes Commission

Building Codes Commission to review IBC Chapter 11

The Building Construction Codes Commission will continue its review of the International Building Code, starting with Chapter 11. The meeting includes approval of prior minutes and setting the next meeting date. This is a subcommittee review session with no final votes expected.

building-codesinternational-building-codechapter-11columbia-missouricommission-meetingpublic-comment
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF MINUTES — Approved a Motion
3 yea · 2 present
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber present
ADJOURNMENT — Approved a Motion
3 yea · 2 present
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber present
TMP-29392 — Approved a Motion
3 yea · 2 present
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber present
Mon Jan 27, 2025 · 4:00 PM

Mayor's Council on Physical Fitness and Health

Council finalizes Winter Well-Being Expo details

The Mayor's Council on Physical Fitness and Health is meeting to finalize plans for the Winter Well-Being Expo, including vendors, volunteers, and promotion. The subcommittee will also approve minutes from a previous meeting. General public comments will be taken.

healthfitnesseventsexpovolunteerpromotion
Activity & Recreation Center Conference Room 1701 W Ash Columbia, MO
Mon Jan 27, 2025 · 4:30 PM

Building Construction Codes Commission

Commission to discuss International Energy Code changes and subcommittee updates

The Building Construction Codes Commission will hold a meeting with no votes or decisions expected. Agenda items include updates from subcommittee reviews, a Q&A forum on the 2018 to 2024 International Energy Code changes, and planning for collaboration with the Climate and Energy Code Commission. The meeting also includes approval of previous minutes and public comment.

building-codesenergy-codesubcommitteeclimatecommission-meeting
Council Chambers
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
2. Chair updates on progress within the Subcommittee Reviews. — Approved a Motion
14 yea · 4 present · 1 nay
Kas Carlson yea · Brian Connell yea · Jay Creasy present · Robert Jackson present · Fred Malicoat yea · Richard Shanker nay · David Weber yea · Matthew Young yea · John Neyens yea · Jonathan Trunk yea · Christopher Howe yea · John Page yea · William DeYoung present · Kyle Saunders yea · Jim Dove yea · Robert Schreiber yea · Brock Biggerstaff present · Andy Noordsy yea · Dan Shifley yea
The other 3 items passed by unanimous or near-unanimous consent.
Thu Jan 23, 2025 · 5:30 PM

Planning and Zoning Commission

Commission to discuss UDC small lot standards and complete streets

At this work session, the Planning and Zoning Commission will discuss its recommendations and authority, a UDC text amendment for small lot use-specific standards, and IPMC occupancy determinations. They will also receive a presentation on Complete Streets and consider approval of previous meeting minutes. No final votes are expected.

planning-and-zoningudcsmall-lotcomplete-streetsoccupancyipmccolumbia-mo
CONFERENCE RM 1A/1B CITY HALL 701 E BROADWAY
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Adopted
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29324 — Approved a Motion
5 yea · 2 present · 2 abstain
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz abstain · David Brodsky abstain
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Thu Jan 23, 2025 · 7:00 PM

Planning and Zoning Commission

Planning and Zoning Commission to consider rezoning and development requests

The Planning and Zoning Commission will hold public hearings on three land-use requests, including a rezoning for multi-family dwellings. The body will also consider a design adjustment for utility easements and a revised plan for a planned development.

zoningland-usehousingdevelopment
Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29325 — Approved a Motion
5 yea · 2 present · 2 abstain
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz abstain · David Brodsky abstain
TMP-29328 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29329 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
TMP-29330 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson present · Thomas Williams present · Robert Walters yea · McKenzie Ortiz yea · David Brodsky yea
Wed Jan 22, 2025 · 4:00 PM

Building Construction Codes Commission

Building code subcommittee to review plumbing, mechanical, fuel gas amendments

The Building Construction Codes Commission subcommittee will discuss the layout for reviewing the International Plumbing, Mechanical, and Fuel Gas Codes and examine current amendments and their placement in the new text. No votes or final decisions are scheduled; this is a working session.

building-codesplumbingmechanicalfuel-gascode-amendmentscity-of-columbia
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 1 present
Fred Malicoat yea · John Neyens yea · Kyle Saunders present · Jim Dove yea · Robert Schreiber yea
Wed Jan 22, 2025 · 7:00 PM

Housing and Community Development Commission

Public hearing on housing & community development needs

The Housing and Community Development Commission will hold a public hearing to gather input on housing and community development needs. Commissioners will also review Policy Resolution PR 177-24 on CDBG and HOME funds, elect officers, and approve the FY2026 calendar. Approval of minutes from the September 2024 meeting is scheduled.

housingcommunity-developmentpublic-hearingCDBGHOMEpolicy-resolutionelectionscalendar
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO.
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-29343 — Approved a Motion
5 yea · 3 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman present · Jay McIntosh present · Scott Cristal yea · Heather Morgan yea · Ryan King yea
ADJOURNMENT — Approved a Motion
5 yea · 3 present
Mitchell Ritter yea · Ross Kasmann present · Thomas Rose yea · Erica Pefferman present · Jay McIntosh present · Scott Cristal yea · Heather Morgan yea · Ryan King yea
Tue Jan 21, 2025 · 1:00 PM

Finance Advisory and Audit Committee

Committee to review Q1 FY25 finances, parking rates, lodging tax, and transit study

The Finance Advisory and Audit Committee will discuss several financial and policy items including a review of the committee's structure and mandate, the city's finance ordinance, and the FY25 first-quarter financial reports. New business includes a parking study and rate analysis, a lodging tax report and five-year hotel tax analysis, a campus mass transit study, budget townhall plans, and the monthly economic report. No votes are anticipated; the meeting is primarily informational and advisory.

financebudgetparkinglodging-taxtransiteconomic-reportordinance-review
Conference Rooms 1A/1B Columbia City Hall 701 E. Broadway
Tue Jan 21, 2025 · 5:30 PM

Public Transit Advisory Commission

Public Transit Advisory Commission to review Complete Streets presentation

The commission will receive a Complete Streets presentation from Jacque Knight of CMT. The body will also discuss a transit job fair and review ridership data for November and December.

public-transitcomplete-streetsridershiprecruitment
Conference Room 1C City Hall 701 E. Broadway
Tue Jan 21, 2025 · 4:00 PM

Building Construction Codes Commission

Commission will continue International Building Code review

The Building Construction Codes Commission will meet on Jan 21, 2025 to continue its review of the International Building Code. The agenda includes approval of the agenda, approval of minutes from the Jan 7, 2025 meeting, and scheduling the next meeting for Jan 28, 2025. The public will have an opportunity for comments after the business items.

building-codecode-reviewcity-commissionpublic-meetingagenda
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
4 yea · 1 present
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
4 yea · 1 present
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
TMP-29289 — Approved a Motion
4 yea · 1 present
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders present · Robert Schreiber yea
Tue Jan 21, 2025 · 5:00 PM

City Council

Council to hear labor presentations, discuss priorities, then hold closed session

This pre-council meeting is primarily procedural. The council will hear annual presentations from three labor groups (Local 1055, Local 955, CPOA) and discuss legislative priorities. Afterward, a motion will be made to enter closed session to discuss negotiations with employee groups under state law. No votes on ordinances, rezonings, or contracts are scheduled.

labornegotiationsclosed-sessionlegislative-prioritiescity-councilprocedural
City Hall Conference Room 1A/1B 701 E. Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-29300 — Approved a Motion
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
TMP-29301 — Approved a Motion
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll yea
Tue Jan 21, 2025 · 7:00 PM

City Council

City Council to call municipal election for April 8, 2025

The City Council will vote on calling a municipal election for Mayor and Ward 3 and 4 council members. The body is also considering several zoning changes, short-term rental permits, and infrastructure projects.

electionzoningshort-term-rentalsinfrastructurepublic-artfire-services
City Hall Council Chamber 701 E. Broadway Columbia, MO
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
B5-25 — Passed
5 yea · 1 absent · 1 nay
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer absent · Betsy Peters yea · Valerie Carroll nay
The other 11 items passed by unanimous or near-unanimous consent.
Thu Jan 16, 2025 · 6:15 PM

Columbia Parks and Recreation Fund Advisory Committee

Committee to consider expenditure from Frank Morris Trust

The Columbia Parks and Recreation Fund Advisory Committee will meet to approve minutes, receive a CoMoGives update, and authorize a designated expenditure from the Frank Morris Trust. Public comments will be heard. The next meeting is scheduled for April 17, 2025.

parksrecreationfundraisingtrustpublic-participationcommittee-meeting
ARC Meeting Room 1701 W Ash
Thu Jan 16, 2025 · 6:30 PM

Parks and Recreation Commission

Public hearings on Waters House renovations and Twin Lakes playground

The Parks and Recreation Commission holds public hearings on renovations to Waters House and a new playground at Twin Lakes Recreation Area. Commissioners will also recognize CARE essay winners, discuss a CoMoGives update, and review the FY'26 commission budget. Reports on capital projects, recreation services, and bicycle/pedestrian issues are scheduled.

parksrecreationpublic-hearingsbudgetplaygroundrenovationcapital-projects
ARC Meeting Room 1701 W Ash
Wed Jan 15, 2025 · 7:00 PM

Bicycle and Pedestrian Commission

Commission to discuss Complete Streets Policy

The Bicycle and Pedestrian Commission will meet to discuss the Complete Streets Policy. The meeting includes staff reports on Vision Zero, Parks & Recreation, and planning updates.

bikingpedestrianssidewalkstraffic-calmingzoningtransportation
Conference Room 1A City Hall 701 E. Broadway Columbia, Missouri
Wed Jan 15, 2025 · 4:00 PM

Building Construction Codes Commission

Fire code review continues at Building Construction Codes Commission

The commission will continue its review of the International Fire Code, which began in a prior subcommittee meeting. The agenda includes approval of previous meeting minutes and public comment. No new ordinances, contracts, or fee changes are on the agenda.

fire-codebuilding-codescommission-meetingcolumbia-mo
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 2 present
Brian Connell yea · Fred Malicoat yea · Richard Shanker yea · Jonathan Trunk yea · Kyle Saunders yea · Jim Dove present · Brock Biggerstaff present
APPROVAL OF MINUTES — Approved a Motion
5 yea · 2 present
Brian Connell yea · Fred Malicoat yea · Richard Shanker yea · Jonathan Trunk yea · Kyle Saunders yea · Jim Dove present · Brock Biggerstaff present
Wed Jan 15, 2025 · 5:00 PM

Tree Board

Tree Board to discuss FY26 budget and Urban Forest Master Plan

The Tree Board will discuss its FY26 budget request, follow up on a letter to council regarding tree preservation, and review of the Urban Forest Master Plan. The city arborist will provide an update on current issues and upcoming projects. Public comment is allowed.

tree-boardurban-forestbudgettree-preservationmaster-plancity-projects
City Hall Conference Room 1B
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
APPROVAL OF MINUTES — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
TREE BOARD BUDGET — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
TREE PRESERVATION AND CITY PROJECTS — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
ADJOURNMENT — Approved a Motion
6 yea · 1 present
Michael Kyd yea · Jacob McMains present · Samuel Wright yea · Stephen Bybee yea · Patricia Quackenbush yea · Max Miller yea · Renee Scheidt-Hahn yea
Wed Jan 15, 2025 · 4:15 PM

Food Council

Columbia Food Council to discuss waste facility visit and producer surveys

The Food Council will meet to discuss a visit to a solid waste facility and the 65th Annual Agricultural Recognition Banquet. The body will also review a distribution plan for a retailer and producer survey.

food-policywaste-managementagriculturesurveys
Department of Public Health and Human Services Training Room 1 1005 W. Worley St. Columbia, MO 65203
Wed Jan 15, 2025 · 8:00 AM

Water and Light Advisory Board

Water & Light board to review FY 2026 budget request and capacity study

The Water and Light Advisory Board will review the FY 2026 board budget request and annual engineering reports. They will also discuss capacity study recommendations and a public comment regarding water system improvements at the Southwest Water Tower. Financial reports for November 2024 and a monthly power cost adjustment report are also on the agenda.

waterelectricbudgetinfrastructurecapacity-studyutility-ratespublic-comment
701 E Broadway Conference Room 1A/1B
Tue Jan 14, 2025 · 6:00 PM

Youth Advisory Council

Youth Advisory Council to discuss support for new Missouri bill and 2025 Youth Summit

The Youth Advisory Council will consider endorsing a new Missouri bill and continue planning the 2025 Youth Summit. The agenda also includes updates on City Council meetings and the council's six areas of focus. No votes on ordinances or expenditures are scheduled.

youth-advisory-councilmissouri-billyouth-summitcity-council-updatescolumbia-missouri
701 E. Broadway Columbia, MO. 65201 Conference Room 1A/1B
Tue Jan 14, 2025 · 6:00 PM

Human Services Commission

Human Services Commission will consider FY2025 social services RFP and funding process

The Human Services Commission will elect a Housing and Community Development Commission representative. Commissioners will review a request for proposals for FY2025 social services and discuss the City of Columbia social services funding allocation process. The meeting also includes routine approvals of the agenda, minutes, and reports.

human-servicessocial-servicesfundingrfphousing-developmentcity-government
Training Room 1 Columbia/Boone County Department of Public Health and Human Services 1005 W. Worley St.
Mon Jan 13, 2025 · 4:15 PM

Commission on Cultural Affairs

Commission discusses Poet Laureate appointment and cultural program updates

The Commission on Cultural Affairs will consider the Poet Laureate matter under old business. New business includes reports on the Nick Cave Recognition, Columbia Arts Fund, CoMoGives, and the Columbia Values Diversity Celebration. Staff will also provide updates on FY24 and FY25 funding for cultural initiatives.

cultureartsfundingpoet-laureatecommunity-events
City Hall 701 E Broadway Council Chambers
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte present · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem yea
TMP-29278 — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte present · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem yea
ADJOURNMENT — Approved a Motion
8 yea · 4 present
Kristin Gadsden present · Cameron Dorth present · Molly Froidl yea · Linda Helmick present · Diana Moxon yea · Stacey Thompson yea · Kathleen Murphy yea · Kate Nolte present · Ryan Hobart yea · Vera Elwood yea · Jennifer Jennings yea · Phillip Overeem yea
Mon Jan 13, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to complete review of energy efficiency code amendments

The Building Construction Codes Commission will finish reviewing proposed amendments to Chapter 11 (Energy Efficiency) of the International Residential Code. The meeting also includes approval of prior minutes and public comment.

building-codesenergy-efficiencyresidential-code
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Mon Jan 13, 2025 · 4:45 PM

Building Construction Codes Commission

Building Construction Codes Commission to continue International Electric Code review

The Building Construction Codes Commission is meeting to continue a subcommittee review of the International Electric Code. The session will also include the approval of minutes from the December 16, 2024, NEC meeting.

building-codeselectrical-codepublic-safety
Regional Economic Development (REDI), 500 E Walnut ST #102, Columbia, MO.65201
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 3 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove present · Andy Noordsy yea · Dan Shifley yea
ADJOURNMENT — Approved a Motion
5 yea · 3 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove present · Andy Noordsy yea · Dan Shifley yea
Continue with the Code Review — Approved a Motion
5 yea · 3 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove present · Andy Noordsy yea · Dan Shifley yea
TMP-29171 — Approved a Motion
5 yea · 3 present
Fred Malicoat yea · Richard Shanker yea · John Neyens present · Christopher Howe yea · Kyle Saunders present · Jim Dove present · Andy Noordsy yea · Dan Shifley yea
Thu Jan 9, 2025 · 3:00 PM

Disabilities Commission

Commission will discuss accessible business awards and parking challenges

The Disabilities Commission will hold a regular meeting to discuss several accessibility topics. Items include an award-based program for accessible public businesses, concerns about lack of accessible parking at a business, and on-demand transportation for medical appointments. The commission will also review its 2025 calendar and an end‑of‑year recap of the COMO Accessibility Plan. No formal decisions are indicated on these items.

disabilitiesaccessibilityparkingtransportationplanning
City Hall Council Chambers 701 East Broadway Columbia, Missouri
Thu Jan 9, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review 2024 International Property Maintenance Code changes and select chairperson

The Building Construction Codes Commission's subcommittee will meet to review the 2024 International Property Maintenance Code (IPMC) and discuss current amendments. They will also select a committee chairperson. No votes or public hearings are scheduled; the meeting is focused on review and discussion.

building-codesproperty-maintenancecode-reviewcommissioncolumbia-mo
Conference Room-Housing & Neighborhood Services, 11 N Seventh St
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ADJOURNMENT — Approved a Motion
3 yea · 2 present
Robert Jackson present · Richard Shanker yea · David Weber present · Kyle Saunders yea · Robert Schreiber yea
1) Selection of committee chairperson — Approved a Motion
3 yea · 2 present
Robert Jackson present · Richard Shanker yea · David Weber present · Kyle Saunders yea · Robert Schreiber yea
Thu Jan 9, 2025 · 5:30 PM

Board of Health

Board of Health to discuss city ordinances regarding animals and fowl

The Board of Health is meeting to review Chapter 5 of the City of Columbia Code of Ordinances. The session includes a board discussion on animals and fowl and a report from Director Rebecca Roesslet.

public-healthcity-ordinancesanimals
Training Room 1 Public Health & Human Services 1005 W. Worley St. Columbia, MO 65203
Thu Jan 9, 2025 · 12:00 PM

Columbia Sports Commission

Sports Commission to hear update on Sports Development Fund and NAIA Cross Country report

The Columbia Sports Commission will receive updates on Sports Development Fund applications and a report on the NAIA Cross Country National Championships. Staff will present the January Sports Commission report and sports sales activities. The meeting also includes approval of November minutes and scheduling the next meeting for February 13, 2025.

sports-commissionsports-development-fundnaia-cross-countrystaff-reportsmeeting-minutes
300 S. Providence Road - Thomas G. Walton Building
Thu Jan 9, 2025 · 4:30 PM

Mayor's Council on Physical Fitness and Health

Council to elect officers, discuss mini-grant program and Winter Well-Being Expo

The Columbia Mayor's Council on Physical Fitness and Health meets for routine business including approval of minutes, treasurer's report, and election of officers. They will also discuss updates on the Winter Well-Being Expo, Mayor's Awards, and development of a mini-grant program. Public comment is invited and the next meeting is set for Feb. 6, 2025.

physical-fitnesshealthcolumbia-mopublic-meetingmini-grantwinter-well-being-expomayors-awards
ARC Meeting Room 1701 W Ash
Thu Jan 9, 2025 · 5:30 PM

Planning and Zoning Commission

Commission reviews Complete Streets guidelines and residential lot analysis

The Planning and Zoning Commission will hear a presentation from Crawford, Murphy & Tilly on revisions to the Complete Streets design and policy guidelines. Staff will provide a follow‑up report on a residential lot analysis. The commission will also discuss follow‑up items related to PZC recommendations and authority.

planningzoningcomplete-streetsresidential-lotpolicy
CONFERENCE RM 1A/1B CITY HALL 701 E BROADWAY
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky present
TMP-29219 — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky present
ADJOURNMENT — Approved a Motion
7 yea · 2 present
Sara Loe yea · Anthony Stanton yea · Sharon Geuea Jones yea · Peggy Placier yea · Shannon Wilson yea · Thomas Williams yea · Robert Walters yea · McKenzie Ortiz present · David Brodsky present
Thu Jan 9, 2025 · 7:00 PM

Planning and Zoning Commission

Planning & Zoning to consider 40-lot 'Cottages at Bristol Lake' development

The Planning and Zoning Commission will hold public hearings on a proposed site-specific development plan for 'The Cottages at Bristol Lake' (40 single-family lots, 2 common lots on 6.2 acres near East Gans Road and Bristol Lake Parkway) and a conditional use permit for a short-term rental at 1003 Sunset Drive (max 8 guests, 120 nights/year). The commission will also approve minutes from the December 5, 2024 meeting and take public comments.

planning-and-zoningpublic-hearingdevelopmentshort-term-rentalhousingzoning
Columbia City Hall Council Chambers 701 E Broadway
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
TMP-29225 — Approved a Motion
6 nay · 2 present · 1 yea
Sara Loe nay · Anthony Stanton nay · Sharon Geuea Jones nay · Peggy Placier nay · Shannon Wilson yea · Thomas Williams nay · Robert Walters nay · McKenzie Ortiz present · David Brodsky present
The other 3 items passed by unanimous or near-unanimous consent.
Wed Jan 8, 2025 · 4:00 PM

Building Construction Codes Commission

Commission continues International Fire Code review

The Building Construction Codes Commission will continue its chapter-by-chapter review of the International Fire Code, building on the subcommittee's December meeting. The agenda includes approval of prior minutes and general public comment, but no new ordinances or contracts are up for decision.

fire-codebuilding-codescommission-meetingcolumbia-missouri
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 2 present
Brian Connell yea · Fred Malicoat yea · Richard Shanker yea · Jonathan Trunk yea · Kyle Saunders present · Jim Dove yea · Brock Biggerstaff present
APPROVAL OF MINUTES — Approved a Motion
5 yea · 2 present
Brian Connell yea · Fred Malicoat yea · Richard Shanker yea · Jonathan Trunk yea · Kyle Saunders present · Jim Dove yea · Brock Biggerstaff present
ADJOURNMENT — Approved a Motion
5 yea · 2 present
Brian Connell yea · Fred Malicoat yea · Richard Shanker yea · Jonathan Trunk yea · Kyle Saunders present · Jim Dove yea · Brock Biggerstaff present
Wed Jan 8, 2025 · 6:30 PM

Community Land Trust Organization Board

Board to consider realtor proposals and 6 Fourth Ave development

The board will approve minutes from December 4, 2024, and discuss old business including banking services, external marketing materials, ARPA fund expenditures, fundraising operations, and a bylaw attendance policy revision. Under new business, they will review realtor proposals submitted by Jennifer Austin, Mariah Carmichael, and JoAnn Dekrell. The agenda includes development of 6 Fourth Ave. There will be public comment and a next meeting date set for February 5, 2025.

community-land-trusthousingfinancebylawsrealtordevelopmentcolumbia-mo
City Conference Room 1C, City Hall, 701 E Broadway
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani yea · Valerie Carroll present
TMP-29228 — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani yea · Valerie Carroll present
TMP-29233 — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani yea · Valerie Carroll present
TMP-29234 — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani yea · Valerie Carroll present
ADJOURNMENT — Approved a Motion
5 yea · 4 present
Shirley Rhoades present · Anthony Stanton yea · Alexander LaBrunerie yea · Linda Head present · Jeremy Trotter yea · Tracey Bush-Cook yea · Douglas Hunt present · Rikki Ascani yea · Valerie Carroll present
Wed Jan 8, 2025 · 6:00 PM

Citizens Police Review Board

CPRB to elect chair and review 2024 annual report

The Citizens Police Review Board will meet to elect a chair, review the draft 2024 annual report, and discuss future plans for complaint reviews. The board will also review the Fiscal Year 2026 budget and update its brochure.

cprbpolicebudgetreporttrainingcolumbia-mo
City Council Chambers 701 East Broadway Columbia, Missouri
Wed Jan 8, 2025 · 3:00 PM

Parking Advisory Commission

Parking Advisory Commission to discuss street parking overhaul and revenue

The Parking Advisory Commission will meet to discuss updates regarding the Plaza Garage and parking operations. The body will also address a proposed on-street parking layout overhaul and revenue.

parkinginfrastructurerevenuetransportation
Room 1A/1B City Hall
Tue Jan 7, 2025 · 7:00 PM

Historic Preservation Commission

Historic Preservation Commission reviews FY 2026 budget request and property applications

The commission will consider demolition permit applications and staff reports, including SHPO comments on the draft preservation plan. It will review the FY 2026 budget request and discuss scheduling a public input session for the preservation plan grant. The meeting also includes discussion of the most notable property applications listed on the agenda.

historic-preservationbudgetproperty-applicationspreservation-planpublic-input
Conference Room 1B City Hall 701 E. Broadway
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 present · 2 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross present · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
APPROVAL OF MINUTES — Approved a Motion
5 present · 2 absent
Melissa Hagen present · Stephen Bybee present · Meg Ross present · Tanner Ott absent · Tyler Travers absent · Carrie Gartner present · Josh Parshall present
Tue Jan 7, 2025 · 4:00 PM

Building Construction Codes Commission

Commission to review International Building Code changes

The Building Construction Codes Commission will meet to conduct a subcommittee review of the International Building Code. The group intends to begin their review starting at chapter 4 of the ICC Significant Changes book.

building-codesinternational-building-codeconstruction
Conference Room 1C, Columbia City Hall, 701 E. Broadway
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
APPROVAL OF AGENDA — Approved a Motion
5 yea
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
ADJOURNMENT — Approved a Motion
5 yea
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
TMP-29172 — Approved a Motion
5 yea
Brian Connell yea · David Weber yea · Jonathan Trunk yea · Kyle Saunders yea · Robert Schreiber yea
Tue Jan 7, 2025 · 5:30 PM

Commission on Human Rights

Commission to discuss workshop at Food Bank, then closed session on pending cases

The Columbia Commission on Human Rights will meet to approve minutes from December 3, 2024, and discuss new business including a brainstorm workshop at the Food Bank and distribution of rack cards to local organizations. The meeting will then move into closed session to discuss multiple pending cases (2024-00020 through 2024-00030) under state law exemption for legal actions. The next meeting is scheduled for February 4, 2025.

human-rightsclosed-sessionpending-casesworkshopfood-bankrack-cardscolumbia-mo
Conference Room 1A 701 E Broadway Columbia, MO
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
TMP-29166 — Approved a Motion
6 yea · 1 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
MOTION TO GO INTO CLOSED SESSION — Approved a Motion
6 yea · 1 present
Amanda Hinnant yea · Meera Sood yea · Astrid Villamil present · Stephanie Yoakum yea · Paige Lubbering yea · Penny Kuhns-Knarr yea · Liz Townsend Bird yea
Mon Jan 6, 2025 · 4:45 PM

Building Construction Codes Commission

Review of energy efficiency amendments to residential building code

The Building Construction Codes Commission will continue its subcommittee review of the International Residential Code, focusing on completing amendment review for Chapter 11 Energy Efficiency. The commission will also consider approval of the December 16, 2024 meeting minutes.

building-codesenergy-efficiencyresidential-codecolumbia-mosubcommittee-review
Conference Room 1C, Columbia City Hall, 701 E. Broadway
Mon Jan 6, 2025 · 4:00 PM

Building Construction Codes Commission

Building Construction Codes Commission to continue International Electric Code review

The Building Construction Codes Commission is meeting to continue a code review of the International Electric Code. The meeting includes the approval of minutes from December 16, 2024.

building-codeselectric-codepublic-safety
Regional Economic Development (REDI), 500 E Walnut ST #102, Columbia, MO.65201
Mon Jan 6, 2025 · 5:00 PM

City Council

Council to discuss Project Frontier, legislative overview, budget priorities

This pre-council conference is a discussion session with no formal votes. The council will cover Project Frontier, a legislative overview, and council budget priorities. No specific proposals or dollar amounts are listed on the agenda.

councilbudgetlegislationproject-frontierpre-council
Conference Room 1A/1B Columbia City Hall 701 E. Broadway
Mon Jan 6, 2025 · 7:00 PM

City Council

Council to consider annexation of Prathersville Road property and Gans Creek trail expansion

The Columbia City Council will hold public hearings on a proposed annexation of 1591 E. Prathersville Road with Industrial zoning and on an increase in the natural surface trail length at Gans Creek Recreation Area. The council will also vote on second readings of ordinances amending the business license fee, authorizing a Juneteenth sponsorship MOU, and a physician services agreement with the University of Missouri. The consent agenda includes rezoning for Legacy Woods, short-term rental conditional use permits, sidewalk projects, and budget amendments for capital improvements.

annexationzoningtrailsbudgetshort-term-rentalssidewalkspublic-hearingselections
Council Chamber Columbia City Hall 701 E. Broadway
🗳️ How they voted (28 roll-call votes)
Named votes as recorded in the official record.
B317-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B310-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B308-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B307-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B318-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B312-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B314-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B311-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B316-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B302-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B315-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B309-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B303-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B320-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B304-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B301-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B319-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B305-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
B306-24 — Passed
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea
R6-25 — Adopted
6 yea · 1 absent
Barbara Buffaloe yea · Nick Foster yea · Roy Lovelady yea · Don Waterman yea · Lisa Meyer yea · Betsy Peters absent · Valerie Carroll yea