The Boring PartsFederalLocal · USLocal · Canada

Auburn, AL

Recent Auburn City Council topics include planning & zoning, public safety, roads & infrastructure, contracts & procurement, resolutions & ordinances, budget & taxes.

Topics found in recent meetings

Recent Auburn meeting summaries, agendas, and minutes

Get Auburn meeting alerts

One email when Auburn posts a new agenda or minutes. Free, unsubscribe anytime.

We have no upcoming meetings on file for Auburn. The most recent record we hold is from Wed Aug 19, 2026. Newer meetings may not have been published to the official portal yet, or may not have been collected by us yet — this is a statement about our record, not about whether the city council has met.
AuburnAL averageUS Census ACS
Population
78,738
Per-capita income
$35,416
Median home value
$342,400
Bachelor's or higher
63%
Typical home value $423,354 +4.2% yr/yr · +31.6% 5-yr
Home-value trend 2000–2026 (Zillow ZHVI)
Jump to meetings ↓

Municipal budget

US Census Annual Survey of Local Government Finances
Total revenue$179.2M (FY2023)
Total spending$149.2M (FY2023)
Taxes$111.4M (FY2023)
Debt outstanding$113.6M (FY2023)
Spending per resident$1,899 (FY2023)

Development activity

Housing units permitted — US Census Building Permits Survey
2025689 housing units ($230.8M)

Recent meetings

Wed Aug 19, 2026

Planning Commission Study Session

Mon Aug 17, 2026

Greater Auburn Area Fire Safe Council

Fire Safe Council to hear EV and lithium battery safety briefing

The Greater Auburn Area Fire Safe Council is meeting to discuss fire safety coordination, hear agency reports, and receive a guest presentation on electric vehicle and lithium battery safety. The agenda includes routine approvals, updates on council membership and a potential merger, and planning for community events.

fire-safetyelectric-vehicleslithium-batteriescommunity-eventscouncil-meeting
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
GREATER AUBURN AREA FIRE SAFE COUNCIL MEETING AGENDA Date: July 17th, 2026, Time: 9:00 a.m. Location: Auburn City Hall, Rm 10, 1275 Lincoln Way, Auburn, CA Virtual via ZOOM: https://us02web.zoom.us/j/4647233700 1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC meeting minutes, June 19th, 2026 4. Agency and Stakeholder Reports a. Penryn Fire/Newcastle Fire/Placer Hills Fire b. Auburn Fire c. American Red Cross d. U.S. Bureau of Reclamation (BOR) e. Placer Resource Conservation District (RCD) f. Regional Forest Health g. OES, Placer County/Fire Alliance/Firewise Community Report h. CAL FIRE/Placer County Fire 5. Guest Speaker a. Electric Vehicle and Lithium Battery Safety- • Placer Hills Battalion Chief Eric Reams • Cal Fire Battalion Chief Nick Salas 6. Old Business a. Status of Placer County Board Appointed council members b. Status of North Auburn/Ophir Fire Safe Council merger c. CAL FIRE NEU OPEN HOUSE July 11, 2026, at 9:00AM, Bowman Station 10, at 13760 Lincoln Way, Auburn, CA 95603 d. UPRR communication 7. New Business a. Financial Report b. UCANR Walking Tour Hidden Valley Firewise Community, Granite Bay CA., August 11th, 2026 c. PCWA Fire and Water 2026 d. First Responders Fair Event scheduled for October 3, 2026, at 10:00AM-1:30PM, Granite Bay Park, 6010 Douglas Blvd., Granite Bay 8. Public Comment a. Any member of …
Excerpt truncated on this listing page. Full text →
Thu Aug 13, 2026

Planning Commission - Study Session

Planning Commission reviews draft Auburn 2045 General Plan and EIR

The Planning Commission will hold a study session to receive an informational report on the Draft Auburn 2045 General Plan and its Draft Environmental Impact Report (DEIR). No formal action will be taken; the session is for commissioners to ask questions and receive public comment before public hearings scheduled for October 2026. The DEIR comment period closes September 21, 2026.

general-planenvironmental-impact-reportplanning-commissionpublic-hearingland-use
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN PLANNING COMMISSION MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 August 18, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. APPROVAL OF MINUTES By MOTION, approve the meeting minutes of July 21, 2026. 4. STUDY SESSION ON THE DRAFT AUBURN 2045 GENERAL PLAN AND ENVIRONMENTAL IMPACT REPORT (EIR) Receive an informational report on the Draft General Plan and EIR from Barry Miller, General Plan Consultant Project Manager. This is informational only - no authoritative action will be taken. 5. STAFF FOLLOW-UP REPORTS a. Future Commission Meetings b. City Council Meetings 6. COMMISSION DISCUSSION AND REPORTS / FUTURE COMMISSION AGENDA ITEMS Planning Commissioners will discuss and agree on items and/or projects to be placed on future Commission agendas for the purpose of updating the Commission on the progress of items and/or projects. ADJOURNMENT The Planning Commission welcomes your interest and participation. If you want to sp …
Excerpt truncated on this listing page. Full text →
Wed Aug 12, 2026

EDC Town Hall - Small Town Talk

Auburn EDC town hall features local business speakers and community Q&A

The Auburn Economic Development Commission is hosting a town hall event on August 11, 2026, from 5:30-8:00 PM at City Hall Council Chamber. The agenda includes a speaker lineup of local business owners discussing what makes businesses successful in Auburn, how they grow, and how the community can support entrepreneurs. The event is facilitated by Natalie Otis and includes a welcome and community questions segment.

economic-developmentsmall-businesstown-hallcommunity-engagement
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
_{ pV Y\_ GINY OF AUBURN& ECONOMIC DEVELOPMENT COMMISSION THE SPEAKER LINEUP Reese Browning Old Town Pizza Heather Mauel 8 Dutch B Explore what makes businesses mes successful in Auburn, what helps them grow, and how the community can better support local entrepreneurs and small business owners. Dmitriy Sergeyev Serg Supply August 11", 2026 © 5:30-8:00 PM Ken McGuire @ CITY HALL COUNCIL CHAMBER if Tin Latern and McGuire's WELCOME & COMMUNITYQUESTIONS Melissa Johnson Chamber Board , Planning Commission, Economic Development FACILITATED BY Natalie Otis City of Auburn Economic Development Commission & Auburn Gymnastics Register now at :
Mon Aug 10, 2026

City Council Meeting

Council to consider $231K CHP grant for DUI enforcement, fire captain funding

The Auburn City Council is meeting to decide on a consent calendar of routine items, including accepting a $231,013.84 California Highway Patrol grant for DUI enforcement equipment and overtime, funding a fire captain position, and purchasing a hybrid truck for the airport. The council will also hold a first reading of a zoning ordinance amendment on mobile food vendors and hear a presentation on the Surplus Land Act. The agenda includes several standard administrative approvals and reports.

policebudgetzoningpublic-safetyairportcontractsfire
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 August 10, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet (large file) Consent Calendar: 1. Funding of One Fire Captain Position and Updated Position Allocation By Resolution, approve the funding of one Fire Captain position. Staff Report 2. Vehicle Purchase and Surplus for the Auburn Airport By Resolution, approve a FY 2026-27 budget adjustment of $40,000 and authorize the Public Works Director to purchase a hybrid pick-up truck for Auburn Airport operations, and surplus vehicle AIR-2 in accordance …
Excerpt truncated on this listing page. Full text →
Thu Aug 6, 2026

City Council Meeting

Council to vote on $231K CHP grant for DUI enforcement

The Auburn City Council will consider consent calendar items including funding a fire captain position, purchasing a hybrid truck for the airport, accepting a $231,013.84 California Highway Patrol grant for DUI enforcement, and appointing Youth Advisory Commission members. A public hearing will introduce an ordinance amending mobile food vendor regulations. Council business includes a Surplus Land Act presentation and adoption of revised council rules.

budgetpolicezoningpublic-safetyairportyouthlegal-services
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 August 10, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet (large file) Consent Calendar: 1. Funding of One Fire Captain Position and Updated Position Allocation  By Resolution, approve the funding of one Fire Captain position. Staff Report 2. Vehicle Purchase and Surplus for the Auburn Airport  By Resolution, approve a FY 2026-27 budget adjustment of $40,000 and authorize the Public Works Director to purchase a hybrid pick-up truck for Auburn Airport operations, and surplus vehicle AIR-2 in …
Excerpt truncated on this listing page. Full text →
Fri Jul 31, 2026

Arts Commission Meeting

Arts Commission reviews public art projects and upcoming events

The Auburn Arts Commission is discussing updates on several public art installations and community events. The body will review proposals for a 2027 Art Retreat sponsorship and a September 5 fundraiser.

public-artcommunity-eventsarts-commissioncity-beautification
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN ARTS COMMISSION MEETING Monday , August 3 , 2026, 5:30pm Room 10 City Hall 1225 Lincoln Way, Auburn CA AGENDA Call to Order Roll Call Declaration of a Quorum Minutes for approval: July 2026 Public Comment: This for anyone to speak on any item not on the agenda. Commissioners cannot act on item that is not on this agenda; items presented may be placed on a future meeting agenda. Comments should be brief. Agenda Approval Commissioners and/or the public may ask to remove, postpone or change sequence of agenda items. Ongoing Business - Committee and Project Reports 1. Repair/upgrade of Peter Hazel fish statue in Central Square + “fence” update 2. Wind Phone project update 3. Art Walk – Downtown/City Hall August 7 4. City Hall Gallery 5. SPP summer movie series – August 8, 15, 29; Sept 5 6. A.R.T. Artist Resources and Training Workshop 7. City Hall back entrance improvement ideas; plants 8. Mosaic Project Ideas: Carnegie tiles; Downtown sidewalk repair 9. OT/High Street underpass path project update 10. Roundabout Public Art update 11. New Art Park signage update; Lee Buckingham tile fund 12. Recruitment ideas for two AAC vacancies New Business 1. Request for AAC sponsorship of 2027 Art Retreat 2. Proposal for Fundraiser at Armed Forces Pavilion and Community Garden on Sept 5 3. Review of mural process Other Projects 1. School Park Preserve activities – mosaic mural 2. Freestanding 4x8 frames for public art for OT/High St path 3. …
Excerpt truncated on this listing page. Full text →
Fri Jul 17, 2026

Greater Auburn Area Fire Safe Council

First Responders Fair scheduled for Oct 3, 2026 at Granite Bay Park

The Greater Auburn Area Fire Safe Council will approve the agenda and the June 19, 2026 meeting minutes. Council members will hear reports from local fire agencies, the American Red Cross, and other stakeholders, followed by a guest speaker on electric‑vehicle and lithium‑battery safety. New business includes a financial report and discussion of the First Responders Fair planned for October 3, 2026 at Granite Bay Park.

fire-safetycommunity-eventsemergency-servicesbudgetpublic-safetymeeting
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
GREATER AUBURN AREA FIRE SAFE COUNCIL MEETING AGENDA Date: July 17th, 2026, Time: 9:00 a.m. Location: Auburn City Hall, Rm 10, 1275 Lincoln Way, Auburn, CA Virtual via ZOOM: https://us02web.zoom.us/j/4647233700 1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC meeting minutes, June 19th, 2026 4. Agency and Stakeholder Reports a. Penryn Fire/Newcastle Fire/Placer Hills Fire b. Auburn Fire c. American Red Cross d. U.S. Bureau of Reclamation (BOR) e. Placer Resource Conservation District (RCD) f. Regional Forest Health g. OES, Placer County/Fire Alliance/Firewise Community Report h. CAL FIRE/Placer County Fire 5. Guest Speaker a. Electric Vehicle and Lithium Battery Safety- • Placer Hills Battalion Chief Eric Reams • Cal Fire Battalion Chief Nick Salas 6. Old Business a. Status of Placer County Board Appointed council members b. Status of North Auburn/Ophir Fire Safe Council merger c. CAL FIRE NEU OPEN HOUSE July 11, 2026, at 9:00AM, Bowman Station 10, at 13760 Lincoln Way, Auburn, CA 95603 d. UPRR communication 7. New Business a. Financial Report b. UCANR Walking Tour Hidden Valley Firewise Community, Granite Bay CA., August 11th, 2026 c. PCWA Fire and Water 2026 d. First Responders Fair Event scheduled for October 3, 2026, at 10:00AM-1:30PM, Granite Bay Park, 6010 Douglas Blvd., Granite Bay 8. Public Comment a. Any member of the public may address the council on any matter that …
Excerpt truncated on this listing page. Full text →
Thu Jul 16, 2026

Planning Commission/HDRC Joint Meeting

Auburn commissions to consider mobile food vendor rules and cafe signage

The Planning Commission and Historic Design Review Commission are meeting to discuss updates to mobile food vendor regulations. The body will also review a permit for new illuminated signage at a downtown cafe.

zoningmobile-food-vendorssignagehistoric-preservationplanning
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN PLANNING COMMISSION AND HISTORIC DESIGN REVIEW COMMISSION JOINT MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 July 21, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE *Introduction of new Associate Planner, Kelly Mumper 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. APPROVAL OF MINUTES By MOTION, approve the meeting minutes of May 5, 2026. 4. PUBLIC HEARING A. HISTORIC DESIGN REVIEW PERMIT – 958 LINCOLN WAY – NEW ILLUMINATED LED WALL SIGNAGE (BAKED & BREWED CAFÉ & BISTRO) - FILE HDRP 26-02 B. ADOPT A RESOLUTION RECOMMENDING THAT THE CITY COUNCIL APPROVE AN ORDINANCE AMENDING SECTION 159.180 OF CHAPTER 159 (ZONING) OF THE AUBURN MUNCIPAL CODE RELATING TO MOBILE FOOD VENDORS *Adjourn Planning Commission and Historic Design Review Commission Joint Meeting and Reconvene Planning Commission for action of item 4.B. *CALL TO ORDER Planning Commission 5. STAFF FOLLOW-UP REPORTS A. Economic Development Updates B. City Council Meetings C. Future Planning Commission Meetings D. Reports 6. COM …
Excerpt truncated on this listing page. Full text →
Mon Jul 13, 2026

City Council Meeting

Council to appoint James Lindsay as Interim City Manager

The Auburn City Council will consider approving an employment agreement with James Lindsay as Interim City Manager and discuss the process for filling a City Council vacancy. The consent calendar includes approval of a successor MOU with the Auburn Firefighters IAFF Local 4110, a contract for the 2026 ADA Curb Ramp Upgrade Project ($195,215.90), and a contract for the Pacific Avenue and Pleasant Avenue Bicycle Improvement Project ($85,734.00). The council will also consider designating a census tract as a Qualified Opportunity Zone and adopt revised council rules and procedures.

city-councilappointmentscontractspublic-worksfire-departmentadaroadseconomic-development
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 July 13, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. July 13, 2026 Agenda Agenda (with closed session) Agenda Packet (large file) Consent Calendar: 1. Minutes  By Motion, approve the City Council minutes of 5/11/2026, 5/18/2026, 6/1/2026 and 6/22/2026. PDF copy 2. Report of Investment Transactions - June 2026  Receive, review, and file the City of Auburn Monthly Report of Investment Transactions for the month ending June 30, 2026. Staff Report 3. Amended Appropriation (GANN) Limits  By Resolu …
Excerpt truncated on this listing page. Full text →
Fri Jul 10, 2026

Endurance Capital Committee

Endurance Capital Committee meeting on July 15, 2026

The Committee will review the FY2026–27 budget update and several project updates. Discussion items include the Brick Pillar Refresh Project, cycling reports, and trail and equestrian updates.

budgeteventsinfrastructurecyclingtrails
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN AUBURN ENDURANCE CAPITAL OF THE WORLD ® COMMITTEE MEETING AGENDA Wednesday, July 15, 2026 • 6:00 PM • Room 10, Auburn City Hall Hybrid Meeting – In Person & Zoom • https://us02web.zoom.us/j/4647233700 CALL TO ORDER / PUBLIC COMMENT This is an opportunity for any member of the public, including Committee members, to address the Committee on a matter not on this agenda. The Committee may not take action on said item(s) but can schedule them for consideration at a future meeting. Comments may be limited in time by the Chair. This is also an opportunity for the ECC Chair to adjust the order of Action and Informational items as needed. CONSENT ITEMS Require a vote — All I. Approve July 15, 2026 Meeting Agenda – (All) II. Approve June 17, 2026 Meeting Minutes – (All) ACTION ITEMS Require a vote I. Treasurer’s Report (Larry Grilli) INFORMATIONAL ITEMS I. FY2026–27 Budget Update (Larry Grilli, Bob Peterson) II. Brick Pillar Refresh Project (Cynci Calvin) III. 2026 Events – Review, Attendance & Representation • Western States Endurance Run (June 27–28) – Post-Event Report • December 5 – Festival of Lights Parade • December 16 – ECC Holiday Dinner • Other events to support - open question • Volunteer Outreach Plan IV. Swag Update (Cynci Calvin) V. Cycling Report (Bob Peterson) VI. Trail & Equestrian Updates (Lori Stewart, Shannon Weil) VII. Website …
Excerpt truncated on this listing page. Full text →
Fri Jul 10, 2026

Arts Commission Meeting

Auburn Arts Commission discusses various public art and park projects

The commission is reviewing updates on several ongoing initiatives, including the Peter Hazel fish statue and the OT/High Street underpass path. Members will also discuss potential mosaic projects and a $3,000 grant from AFTA/Carnegie.

public-artparksgrantscommunity-projectsinfrastructure
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN ARTS COMMISSION MEETING Thursday, Ju ly 16, 2026, 5:30pm Room 10 City Hall 1225 Lincoln Way, Auburn CA AGENDA Call to Order Roll Call Declaration of a Quorum Minutes for approval: June 2026 Public Comment: This for anyone to speak on any item not on the agenda. Commissioners cannot act on item that is not on this agenda; items presented may be placed on a future meeting agenda. Comments should be brief. Agenda Approval Commissioners and/or the public may ask to remove, postpone or change sequence of agenda items. Ongoing Business - Committee and Project Reports 1. Repair/upgrade of Peter Hazel fish statue in Central Square + “fence” update 2. Wind Phone project update 3. New Art Park signage update; Lee Buckingham tile fund 4. Leadership Auburn debrief 5. OT/High Street underpass path project update 6. Consider meeting time back to Monday; recruit for vacant seat 7. Art Walk – Downtown August 7 8. City Hall back entrance improvement ideas – need renderings 9. Roundabout Public Art update 10. SPP summer movie series with State Theatre – update 11. A.R.T. Artist Resources and Training Workshop 12. Arts and Culture focus discussion/grants New Business 1. Mosaic Project Ideas a. AFTA/Carnegie has $3k grant for mosaic project b. Downtown sidewalk mosaic idea Other Projects 1. School Park Preserve activities – mosaic mural 2. Freestanding 4x8 frames for public art for OT/High St path 3. Native plant garden in School Park Preserve …
Excerpt truncated on this listing page. Full text →
Thu Jul 9, 2026

City Council Meeting

City Council to approve major ADA curb ramp contract and other key items

The Auburn City Council will consider a consent calendar that includes approvals for minutes, investment reports, amended appropriation limits, an airport ground lease assignment, and several contracts. Major items include a construction agreement for the 2026 ADA Curb Ramp Upgrade Project up to $195,215.90 and a bicycle improvement contract up to $85,734.00. Council business will address the appointment of an interim city manager, a vacancy discussion, a fire department sub‑joint operations review, and a recommendation for Opportunity Zone designation. The meeting will also adopt revised council rules and receive various reports.

public-workscontractsbudgetcity-councilinfrastructureopportunity-zonefire-department
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 July 13, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. July 13, 2026 Agenda Agenda (with closed session) Agenda Packet (large file) Consent Calendar: 1. Minutes  By Motion, approve the City Council minutes of 5/11/2026, 5/18/2026, 6/1/2026 and 6/22/2026. PDF copy 2. Report of Investment Transactions - June 2026  Receive, review, and file the City of Auburn Monthly Report of Investment Transactions for the month ending June 30, 2026. Staff Report 3. Amended Appropriation (GANN) Limits  By Resolu …
Excerpt truncated on this listing page. Full text →
Mon Jun 22, 2026

City Council Meeting

City Council to adopt $33.6M FY 2026-27 budget

The Auburn City Council will consider adopting the Fiscal Year 2026-27 final budget of $33,607,027, which sets General Fund Reserves at $5,375,542. The consent calendar includes multiple ordinances, contracts, and employee agreements, including a new entertainment zone in downtown Auburn, a sewer lift station improvement project, and renewal of the police military equipment policy. Public hearings are scheduled for the annual Business Improvement District assessment levy and sewer service charges.

budgetpublic-safetyinfrastructureelectionsemployee-relationszoningpolicefire
✓ Decided: Council adopts $33.6M budget, new downtown entertainment zone

The Auburn City Council approved the FY 2026-27 final budget of $33,607,027, which sets General Fund Reserves at $5,375,542 and the Appropriation Limit at $28,351,238. The Council also adopted ordinances creating an additional Entertainment Zone in Downtown Auburn and amending Historical Design Review Permit requirements for exterior painting. The consent calendar, which included these items, was approved unanimously by the four present members, with Council Member Mike Holmes absent.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 June 22, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (with closed session) Agenda Packet (large file) Consent Calendar: 1. Report of Investment Transactions - May 2026 Receive, review, and file the City of Auburn Monthly Report of Investment Transactions for the month ending May 30, 2026. Staff Report 2. Fiscal Year 2026-27 Final Budget Adoption By Resolution, approve the City of Auburn FY 2026-27 Final Budget in the total amount of $33,607,027, which sets General Fund Reserves at $5,375,542, the Appropriation Limit at $28,351,238, and updates the City's Pay Schedule. Staff Repor …
Excerpt truncated on this listing page. Full text →
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
CITY COUNCIL MINUTES June 22, 2026 REGULAR SESSION A Regular Meeting of the Auburn City Council was held at Auburn City Hall, 1225 Lincoln Way, Auburn, CA on Monday, June 22, 2026 at 6:00 p.m. with Mayor Kelley Davis presiding and City Clerk Amy Lind recording the minutes. CALL TO ORDER/ ROLL CALL Council Members Present: Sandra Amara, Alice Dowdin Calvillo, Rachel Radell-Harris, Kelley Davis Council Members Absent: Mike Holmes Staff Members Present: City Manager Sean Rabé, City Attorney Gary Bell, Public Works Director Mengil Deane, Economic Development Director Jonathan Wright, Building Official Michael Pinola, Fire Chief John Rogers, Finance Director Gretchen Hoskins, Finance Analyst Cristina Shafer, Human Resources Analyst Justin Orton, Human Resources Technician Kim Wilson, City Treasurer Donna Silva and Police Lt. Ranier Neri CLOSED SESSION: By consensus of the Council without objection, adjourn to a Closed Session: 1. PUBLIC EMPLOYEE APPOINTMENT/PUBLIC EMPLOYMENT (Gov. Code, § 54957.) Title: Interim City Manager; City Manager Report Out of Closed Session: City Manager Rabé reported he will be leaving the City to take a position with Placer County. He said a contract for an interim City Manager will come back to the Council at the next meeting. CALL TO ORDER /ROLL CALL PLEDGE OF ALLEGIANCE ADOPTION OF THE AGENDA The agenda was approved as presented by consensus of the Council. CONSENT CALENDAR: 1. Report of Investment Transactions — May 2026 Receive, revie …
Excerpt truncated on this listing page. Full text →
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
motion was made by Council Member Dowdin Calvillo and seconded by Council Member Amara and approved by the following roll call vote:
4 yea
Amara yea · Dowdin Calvillo yea · Radell-Harris yea · Davis yea
motion was made by Council Member Amara and seconded by Mayor Davis and approved by the following roll call vote:
4 yea
Amara yea · Dowdin Calvillo yea · Radell-Harris yea · Davis yea
motion was made by Council Member Dowdin Calvillo and seconded by Mayor Davis and approved by the following roll call vote:
4 yea
Amara yea · Dowdin Calvillo yea · Radell-Harris yea · Davis yea
motion was made by Council Member Dowdin Calvillo and seconded by Council Member Radell-Harris and approved by the following roll call vote:
4 yea
Amara yea · Dowdin Calvillo yea · Radell-Harris yea · Davis yea
Fri Jun 12, 2026

Greater Auburn Area Fire Safe Council

CWPP recommendations and wildfire workshop planned

The joint North Auburn/Ophir and Greater Auburn Area Fire Safe Councils will hold a special workshop on the Community Wildfire Protection Plan (CWPP) and discuss recommended updates. The councils will also review the status of the proposed merger between the two groups and Placer County board appointments.

fire-safe-councilwildfirecommunity-wildfire-protection-planjoint-meetingauburnplacer-county
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Fire Safe Council Meeting JOINT MEETING North Auburn/Ophir & Greater Auburn Area MEETING AGENDA Note: New Location for special workshop Date: April 17th, 2026, Time: 9:00 a.m. Location: Health & Human Services Building, HHSC Cordova Room, 11434 B Avenue, Auburn, CA 95603 Virtual via ZOOM: https://placer-ca-gov.zoom.us/j/91766765984?pwd=2anH1JuJwjlP8j9AlYuCDUFzloX4oT.1 Meeting ID: 917 6676 5984 Passcode: 235774 1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC month’s meeting minutes, March 20, 2026 b. North Auburn/Ophir meeting minutes, March 24, 2026 4. Agency and Stakeholder Reports a. CAL FIRE/Placer County Fire b. Auburn Fire c. Penryn Fire/Newcastle Fire/Placer Hills Fire d. U.S. Bureau of Reclamation (BOR) e. Placer Resource Conservation District (RCD) f. Regional Forest Health g. OES, Placer County/Fire Alliance/Firewise Community Report 5. Old Business a. Status of Placer County Board Appointments b. Status of North Auburn/Ophir Fire Safe Council merger 6. New Business a. GAAFSC CWPP recommendations b. NAOFSC CWPP recommendations c. Placer County Office of Emergency Services and Dudek • (CWPP) Community Wildfire Protection Plan Workshop 7. Public Comment a. Any member of the public may address the council on any matter that is NOT listed on the agenda. Please limit comments to 5 minutes b. Discussion of items of mutual interest, introduction of new issues, and propose …
Excerpt truncated on this listing page. Full text →
Fri Jun 12, 2026

Greater Auburn Area Fire Safe Council

Council to vote on funding refreshments for CAL FIRE open house

The Greater Auburn Area Fire Safe Council will hear agency reports from local fire departments, CAL FIRE, Red Cross, and others. A guest speaker from the Insurance Institute for Business & Home Safety will discuss wildfire safety. The council will vote on donating funding for food and refreshments at the CAL FIRE NEU Open House on July 11, 2026. Old business includes updates on council member appointments and a potential merger with the North Auburn/Ophir Fire Safe Council.

firefire-safe-councilwildfireemergency-servicesfundingpublic-safetycal-fire
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
GREATER AUBURN AREA FIRE SAFE COUNCIL MEETING AGENDA Date: May 15th, 2026, Time: 9:00 a.m. Location: Auburn City Hall, Room 10, Auburn, CA 95603 Virtual via ZOOM: https://us02web.zoom.us/j/4647233700 1. Call to Order: a. Pledge of Allegiance b. Introduction of Council Members 2. Approval of today’s Agenda 3. Approval of Meeting Minutes a. GAAFSC last month’s meeting minutes, April 17, 2026 4. Agency and Stakeholder Reports a. Penryn Fire/Newcastle Fire/Placer Hills Fire b. Auburn Fire c. CAL FIRE/Placer County Fire d. American Red Cross e. U.S. Bureau of Reclamation (BOR) f. Placer Resource Conservation District (RCD) g. Regional Forest Health h. OES, Placer County/Fire Alliance/Firewise Community Report 5. Guest Speaker a. Steve Hawks, Senior Director for Wildfire, (IBHS) Insurance Institute for Business and Home safety 6. Old Business a. Status of Placer County Board Appointed council members b. Status of North Auburn/Ophir Fire Safe Council merger 7. New Business a. CAL FIRE NEU OPEN HOUSE scheduled for July 11, 2026, at 9:00AM, Bowman Station 10, at 13760 Lincoln Way, Auburn, CA 95603 b. Vote to donate funding for food and refreshments at CAL FIRE event 8. Public Comment a. Any member of the public may address the council on any matter that is NOT listed on the agenda. Please limit comments to 5 minutes b. Discussion of items of mutual interest, introduction of new issues, and proposed future Agenda items 9. Next Meeting Date and Adjourn a. Next GAAFSC meeting; June 19 …
Excerpt truncated on this listing page. Full text →
Wed Jun 3, 2026

City Council Special Session

Council to consider approving $33.5M FY 2026-27 proposed budget

The Auburn City Council will consider approving the FY 2026-27 proposed budget totaling $33,456,954. The consent calendar includes a lease amendment with Almost Free to All (AFTA) for the Carnegie Library, a sewer project budget adjustment, and a dispatcher pay correction. A public hearing will be held on amending historic design review permit requirements for exterior painting. The council will also receive reports on workforce vacancies, the Public Works annual report, and a pipeline construction project from Placer County Water Agency.

budgethistoric-preservationhousingpublic-safetyinfrastructurefinanceworkforce
✓ Decided: Auburn City Council approves $33.4 million proposed budget for fiscal year 2026-27

The City Council approved the Fiscal Year 2026-27 Proposed Budget totaling $33,456,954. Additional actions included approving a series of consent calendar items and conducting a first reading of an ordinance regarding historic design review requirements.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Special Session 1225 Lincoln Way, Auburn, CA 95603 June 1, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (with closed session) Agenda Packet (large file) Mayor’s Proclamations/ Commendations/ Acknowledgements Consent Calendar: 1. Fiscal Year 2026-27 SHAAC Workplan Request By motion, approve the Fiscal Year 2026-27 Streetscape History and Art Advisory Committee (SHAAC) Committee workplan and fundraising request. Staff Report 2. Report of Investment - Quarter Ending March 31, 2026  Receive, review, and file the City of Auburn Investment Report for the …
Excerpt truncated on this listing page. Full text →
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
CITY COUNCIL MINUTES June 1, 2026 SPECIAL SESSION A Special Meeting of the Auburn City Council was held at Auburn City Hall, 1225 Lincoln Way, Auburn, CA on Monday, June 1, 2026 at 6:00 p.m. with Mayor Kelley Davis presiding and City Clerk Amy Lind recording the minutes. CALL TO ORDER/ ROLL CALL Council Members Present: Sandra Amara, Alice Dowdin Calvillo, Rachel Radell-Harris, Mike Holmes (arrived at 6:58 p.m.), Kelley Davis Council Members Absent: None Staff Members Present: City Manager Sean Rabé, Asst. City Attorney Mackenzie Anderson, Public Works Director Mengil Deane, Planning Director Tia Klumpp, Finance Director Gretchen Hoskins, Human Resources Director Jen Leal, Economic Development Director Jonathan Wright, Treasurer Donna Silva, Building Official Michael Pinola and Police Chief Bryan Morrison. CLOSED SESSION: By consensus of the Council without objection, adjourn to a Closed Session: (Council Member Holmes was not in attendance) 1. CONFERENCE WITH LABOR NEGOTIATOR (Gov. Code, 8 54957.6.) Name of City Negotiator Attending Closed Session: Gage Dungy, Jennifer Leal, and Sean Rabé Employee Organization: All Bargaining Units Report Out of Closed Session: The Mayor stated there was no reportable action. CALL TO ORDER /ROLL CALL PLEDGE OF ALLEGIANCE MAYOR’S COMMENDATIONS/ PROCLAMATIONS/ ACKNOWLEDGEMENTS County Supervisor Cindy Gustafson presented 175" Anniversary coins to the Council from the County. Proclamation for Pride Month Recognition of Steve Galya …
Excerpt truncated on this listing page. Full text →
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
motion was made by Council Member Amara and seconded by Council Member Dowdin Calvillo and approved by the following roll call vote:
8 yea
Amara yea · Dowdin Calvillo yea · Davis yea · Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
motion was made by Council Member Amara and seconded by Council Member Dowdin Calvillo and approved by the following roll call vote: mo Roop
5 yea
Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
Tue May 12, 2026

City Council Special Session

City Council to evaluate City Manager in closed session

This special session of the Auburn City Council consists solely of a closed session to conduct a performance evaluation of the City Manager. No public hearings or open-session business items are scheduled. The Council will report any action taken in closed session upon returning to open session.

city-councilclosed-sessioncity-managerperformance-evaluationspecial-sessionauburn
✓ Decided: Council approved motion to enter closed session (3‑0)

The council voted to adjourn to a closed session. The motion was made by Council Member Radell‑Harris, seconded by Council Member Amara, and approved by roll‑call vote with three members voting aye and no noes. No other actions were taken.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 | P a g e Auburn City Council City Hall – City Council Chambers 1225 Lincoln Way, Auburn, CA 95603 May 18, 2026 Special Session 6:00 p.m. Sandy Amara, Mayor Kelley Davis, Vice Mayor Alice Dowdin Calvillo, Council Member Mike Holmes, Council Member Rachel Radell-Harris, Council Member The public is encouraged to participate or observe this meeting by: 1. Participate: Attend this meeting in person at the City of Auburn City Council Chambers located at 1225 Lincoln Way, Auburn, California. Public comments may be made: 1. In person: Live at the meeting. Members of the public desiring to speak on a matter appearing on the agenda should ask the Mayor for the opportunity to be heard when the item comes up for Council consideration. Comments for all agenda items are limited to a speaking time of three minutes. 2. In writing: Email your comments to [email protected] Comments will be accepted until 5pm on the Friday prior to the meeting date. Comments will not be read during the City Council meeting but will be forwarded to all Council Members prior to the City Council Meeting. In compliance with the Americans with Disabilities Act of 1990, if you need special assistance to participate in this meeting, please contact the City Clerk at 530 -823-4211 Extension 112. Notification at least 48 hours prior to the meeting will enable the City to make reasonable arrangements to ensure accessibility to this meeting. [28 CFR 3 …
Excerpt truncated on this listing page. Full text →
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Auburn City Council Minutes 5/18/2026 CITY COUNCIL MINUTES May 18, 2026 SPECIAL SESSION A Special Session of the Auburn City Council was held at Auburn City Hall, 1225 Lincoln Way, Auburn, CA 95603 on Monday, May 18, 2026 at 6:00 p.m. with Mayor Kelley Davis presiding and City Clerk Amy Lind recording the minutes. CALL TO ORDER/ ROLL CALL Council Members Present: Sandra Amara, Alice Dowdin Calvillo, (joined at 6:10 p.m.), Rachel Radell- Harris, Kelley Davis Council Members Absent: Mike Holmes Staff Members Present: City Manager Sean Rabé, City Attorney Gary Bell. PUBLIC COMMENT: None CLOSED SESSION: By motion, adjourn to a Closed Session: The motion was made by Council Member Radell-Harris and seconded by Council Member Amara and approved by the following roll call vote: Ayes: Amara, Radell-Harris, Davis Noes: Absent: Dowdin Calvillo, Holmes Council Member Dowdin Calvillo joined the closed session at 6:10 p.m. Public Employee Performance Evaluation (Gov. Code § 54957) Title: City Manager Report Out of Closed Session: The Council returned from closed session at 7:49 p.m. There was no reportable action. ADJOURNMENT Auburn City Council Minutes 5/18/2026 Mayor Davis adjourned the meeting, without vote and by consensus at 7:50 p.m. wy Drol | Kelley Davis, Mayor Amy Ling, Gity Clerk
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
motion was made by Council Member Radell-Harris and seconded by Council Member Amara and approved by the following roll call vote:
3 yea
Amara yea · Radell-Harris yea · Davis yea
Mon May 11, 2026

City Council Meeting

Council to consider new downtown Entertainment Zone

The City Council will hold a public hearing on an ordinance creating a new Entertainment Zone in downtown Auburn. Consent calendar items include a 3.21% rate increase for solid waste collection with Recology Auburn Placer, a three-year animal control contract with Placer County, and a grant application for the High Street Pavement Overlay Project. Council business includes adopting the Active Transportation Plan and receiving a budget update for FY 2026-27.

entertainment-zonesolid-wasteanimal-controltransportationbudgetdowntownstreetsplanning
✓ Decided: Council approves solid waste rate increase, new entertainment zone, and transit plan

The council approved the consent calendar, appointed Melissa Johnson to the Planning Commission, and authorized a 3.21% solid‑waste rate increase. It waived the first reading of an ordinance creating an additional entertainment zone downtown and approved the intention to levy annual assessment fees for the Old Town and Downtown Business Improvement Districts, setting a public hearing for June 22. The Active Transportation Plan and Comprehensive Safety Action Plan were adopted, and the city authorized a three‑year animal‑control services agreement and a grant application for the High Street pavement project.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 May 11, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet (large file) Mayor’s Proclamations and Commendations Consent Calendar: 1. Minutes By Motion, approve the City Council minutes of 4/13/2026 and 4/27/2026. PDF Copy 2. Appointment to the Planning Commission By Resolution, appoint Melissa Johnson to the Planning Commission. Staff Report 3. SACOG Surface Transportation Block Grant System Preservation Funding Program Application By Resolu …
Excerpt truncated on this listing page. Full text →
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Auburn City Council Minutes 5/11/2026 CITY COUNCIL MINUTES May 11, 2026 REGULAR SESSION A Regular Meeting of the Auburn City Council was held at Auburn City Hall, 1225 Lincoln Way, Auburn, CA on Monday, May 11, 2026 at 6:00 p.m. with Mayor Kelley Davis presiding and City Clerk Amy Lind recording the minutes. CALL TO ORDER/ ROLL CALL Council Members Present: Sandra Amara, Alice Dowdin Calvillo, Mike Holmes (arrived at 6:19 p.m.) Rachel Radell-Harris (left the meeting at 8:35 p.m.), Kelley Davis Council Members Absent: None Staff Members Present: City Manager Sean Rabé, City Attorney Gary Bell, Public Works Director Mengil Deane, Economic Development Director Jonathan Wright, Finance Director Gretchen Hoskins, Human Resources Director Jen Leal, Planning Director Tia Klumpp, Building Official Michael Pinola, Permit Technician Amy Franklin, Finance Analyst Cristina Shafer, Airport Manager Tyghe Richardson, Fire Chief John Rogers, Asst Fire Chief Tony D’Ambrogi, and Police Chief Bryan Morrison. CLOSED SESSION: By consensus of the Council without objection, adjourn to a Closed Session: 1. CONFERENCE WITH LABOR NEGOTIATOR (Gov. Code, 8 54957.6.) Name of City Negotiator Attending Closed Session: Gage Dungy, Jennifer Leal, and Sean Rabé Employee Organization: All Bargaining Units Report Out of Closed Session: The Mayor stated there was no reportable action. CALL TO ORDER /ROLL CALL PLEDGE OF ALLEGIANCE MAYOR’S COMMENDATIONS/ PROCLAMATIONS/ ACKNOWLEDGEMENTS Commendation fo …
Excerpt truncated on this listing page. Full text →
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
motion was made by Council Member Amara and seconded by Council Member Radell-Harris and approved by the following roll call vote:
4 yea
Amara yea · Dowdin Calvillo yea · Radell-Harris yea · Davis yea
motion was made by Mayor Davis and seconded by Council Member Dowdin Calvillo and approved by the following roll call vote:
10 yea
Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea · Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
motion was made by Council Member Dowdin Calvillo and seconded by Council Member Amara and approved by the following roll call vote:
20 yea
Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea · Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea · Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea · Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
motion was made by Council Member Radell-Harris and seconded by Council Member Dowdin Calvillo and approved by the following roll call vote:
5 yea
Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
motion was made by Council Member Amara and seconded by Council Member Dowdin Calvillo and approved by the following roll call vote:
5 yea
Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
motion was made by Council Member Amara and seconded by Mayor Davis and approved by the following roll call vote:
10 yea
Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea · Amara yea · Dowdin Calvillo yea · Holmes yea · Radell-Harris yea · Davis yea
Wed May 6, 2026

Historic Design Review Commission

Commission considers exemptions for painting and maintenance in historic districts

The Commission will consider a recommendation to the City Council to amend the Auburn Municipal Code. The proposed changes would establish exemptions from historical design review for certain exterior painting and minor maintenance activities. Additionally, the commission is considering a resolution to allow preapproved paint color collections within the Historic Design Review District.

zoninghistoric-preservationbusinesseconomic-developmentpainting
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN HISTORIC DESIGN REVIEW COMMISSION MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 May 5, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. PUBLIC HEARING AN ORDINANCE AMENDING SECTION 159.497 (HISTORICAL DESIGN REVIEW PERMIT) OF CHAPTER 159 (ZONING) OF THE AUBURN MUNICIPAL CODE TO ESTABLISH EXEMPTIONS FOR CERTAIN EXTERIOR PAINTING AND MINOR MAIN TENANCE ACTIVITIE S FROM HISTORICAL DESIGN REVIEW, AND CON SIDERATION OF A RESOLUTION AUT HORIZING THE USE OF PREAPPROVED HISTORIC PAINT COLOR COLLECTIONS WITHIN THE HISTORIC DESIGN REVIEW DISTRICT. 4. STAFF FOLLOW-UP REPORTS A. Economic Development Updates B. City Council Meetings C. Future Planning Commission Meetings D. Reports 5. COMMISSION DISCUSSION AND REPORTS 6. FUTURE COMMISSION AGENDA ITEMS Planning Commissioners will discuss and agree on items and/or projects to be placed on future Commission agendas for the purpose of updating the Commission on the progress of items and/or projects. ADJ …
Excerpt truncated on this listing page. Full text →
Mon Apr 27, 2026

City Council Meeting

City Council to consider contracts for Fourth of July fireworks

The City Council will discuss authorizing contracts for the July 4th fireworks event and reviewing the 2025 Police Department Annual Report. The body will also consider appointments to the Sustainability Advisory Committee and a lease amendment at the municipal airport.

public-safetyairporteventsenvironmentcontracts
✓ Decided: Council authorizes Fourth of July fireworks contract, fundraising

The Auburn City Council authorized the city manager to contract with Pyro Spectacular and the Gold Country Fairgrounds for July 4 fireworks and to begin fundraising to offset city costs. The consent calendar was approved, appointing Bill Pennington to the Sustainability Advisory Committee and amending a ground lease at the municipal airport. The police department annual report was presented for information only, with no action taken.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 April 27, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet Mayor’s Proclamations and Commendations Consent Calendar: 1. Appointment of Sustainability Advisory Committee Member By Resolution, appoint Bill Pennington to the Sustainability Advisory Committee as the member representing an environmental protection organization within the Auburn community. Staff Report 2. Amendment of Ground Lease at the Auburn Municipal Airport By Resolution, consent to and approve an amendment of groun …
Excerpt truncated on this listing page. Full text →
Wed Apr 22, 2026

Planning Commission/ HDRC Joint Meeting

Auburn Planning Commission to review mobile food vendor zoning and cafe signage

The Planning Commission and Historic Design Review Commission will meet to discuss updates to mobile food vendor regulations. The body will also consider a permit for new illuminated signage at a downtown cafe.

zoningmobile-food-vendorssignagehistoric-preservationplanning
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN PLANNING COMMISSION AND HISTORIC DESIGN REVIEW COMMISSION JOINT MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 July 21, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE *Introduction of new Associate Planner, Kelly Mumper 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. APPROVAL OF MINUTES By MOTION, approve the meeting minutes of May 5, 2026. 4. PUBLIC HEARING A. HISTORIC DESIGN REVIEW PERMIT – 958 LINCOLN WAY – NEW ILLUMINATED LED WALL SIGNAGE (BAKED & BREWED CAFÉ & BISTRO) - FILE HDRP 26-02 B. ADOPT A RESOLUTION RECOMMENDING THAT THE CITY COUNCIL APPROVE AN ORDINANCE AMENDING SECTION 159.180 OF CHAPTER 159 (ZONING) OF THE AUBURN MUNCIPAL CODE RELATING TO MOBILE FOOD VENDORS *Adjourn Planning Commission and Historic Design Review Commission Joint Meeting and Reconvene Planning Commission for action of item 4.B. *CALL TO ORDER Planning Commission 5. STAFF FOLLOW-UP REPORTS A. Economic Development Updates B. City Council Meetings C. Future Planning Commission Meetings D. Reports …
Excerpt truncated on this listing page. Full text →
Wed Apr 22, 2026

Planning Commission/ HDRC

Planning Commission to vote on wine shop permit

The Auburn Planning Commission will decide on a Use Permit for Cloud Fine Wine & Spirits to sell alcohol off-site at 884 Lincoln Way. The meeting also includes a public hearing on historical design review exemptions and an informational presentation on transportation safety.

planningzoningalcoholretailpublic-hearingtransportation
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN PLANNING COMMISSION AND HISTORIC DESIGN REVIEW COMMISSION JOINT MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 April 21, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER/ ROLL CALL / PLEDGE OF ALLEGIANCE 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. PUBLIC HEARINGS A. AN ORDINANCE AMENDING SECTION 159.497 (HISTORICAL DESIGN REVIEW PERMIT) OF CHAPTER 159 (ZONING) OF THE AUBURN MUNICIPAL CODE REGARDING EXEMPTIONS TO CERTAIN EXTERIOR PAINTING AND MINOR MAINTENANCE ACTIVITIES FROM HISTORICAL DESIGN REVIEW By MOTION, continue this public hearing to May 5, 2026. B. USE PERMIT - Cloud Fine Wine & Spirit – 884 Lincoln Way, Suite 23 - FILE UP 26-01 The applicant requests approval of a Use Permit to allow for off-sale alcoholic beverages in association with the proposed retail shop. *Adjourn Planning Commission and Reconvene with Historic Design Review Commission *CALL TO ORDER Planning Commission and Historic Design Review Commission/ROLL CALL 4. PRESENTATION Receive an Informational Presentation on the Active Transportation Plan ( …
Excerpt truncated on this listing page. Full text →
Wed Apr 22, 2026

Planning Commission/ HDRC Joint Meeting

Planning Commission considers zoning amendment for mobile food vendors

The Planning Commission and Historic Design Review Commission will hold a joint public hearing to recommend an ordinance amending Section 159.180 of the Auburn Municipal Code relating to mobile food vendors. The commission will also approve meeting minutes from March 17 and April 21, 2026, and introduce new Planning Commissioner Melissa Johnson. Staff follow-up reports and future agenda items will be discussed.

zoningmobile-food-vendorspublic-hearingplanning-commissionhistoric-design-reviewcommission-members
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN PLANNING COMMISSION AND HISTORIC DESIGN REVIEW COMMISSION JOINT MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 June 16, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER / ROLL CALL / PLEDGE OF ALLEGIANCE *Introduction of new Planning Commissioner, Melissa Johnson 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. APPROVAL OF MINUTES By MOTION, approve the meeting minutes of March 17 and April 21, 2026. 4. PUBLIC HEARING ADOPT A RESOLUTION RECOMMENDING THAT THE CITY COUNCIL APPROVE AN ORDINANCE AMENDING SECTION 159.180 OF CHAPTER 159 (ZONING) OF THE AUBURN MUNCIPAL CODE RELATING TO MOBILE FOOD VENDORS. *Adjourn Planning Commission and Historic Design Review Commission Joint Meeting and Reconvene Planning Commission for action *CALL TO ORDER Planning Commission 5. STAFF FOLLOW-UP REPORTS A. Economic Development Updates B. City Council Meetings C. Future Planning Commission Meetings D. Reports 6. COMMISSION DISCUSSION AND REPORTS 7. FUTURE COMMISSION AGENDA ITEMS Planning Commissioners will discuss and agree on items and/ …
Excerpt truncated on this listing page. Full text →
Tue Apr 14, 2026

City Council Meeting

Council to decide on emergency sewer repair contract and multiple infrastructure projects

The City Council will vote on a consent calendar including contracts for sewer replacement, clarifier replacement, and a fuel break project. Under Council Business, they will consider an emergency contract for sewer repair requiring a four-fifths vote and an amendment for business license tax collection services. The meeting also includes reports from the city manager and discussion of future agenda items.

sewerwater-treatmentinfrastructurecontractsfire-preventionbusiness-licenseemergency-repair
✓ Decided: Council approves new post-employment benefits trust, multiple contracts

The council unanimously approved Resolution 26-34 to establish a PARS Section 115 Trust for post-employment benefits, allowing the city to set aside funds for future retiree obligations. The consent calendar, approved together, included contracts for the Auburn Ravine Sewer Replacement (up to $185,570), WWTP Clarifier 2 Replacement (up to $306,031), and the Baltimore Ravine Shaded Fuel Break Project ($66,205). Separately, the council authorized emergency contracting for a sewer repair with LeFleur Excavating and found it CEQA-exempt. All votes were 4-0 with Council Member Amara absent.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 April 13, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet (large file) Mayor’s Proclamations/ Commendations/ Acknowledgements Consent Calendar: 1. Minutes By Motion, approve the City Council minutes of 3/9/2026 and 3/23/2026. PDF Copy 2. Approval of Warrants Paid By Resolution, approve accounts payable warrants paid from January 2026 to March 2026. Staff Report 3. Establish PARS Public Agencies Post-Employment Benefits Trust (Section 115 Trust) …
Excerpt truncated on this listing page. Full text →
Mon Mar 23, 2026

City Council Meeting

Auburn City Council to consider AI use policy and various lease amendments

The City Council will vote on an Artificial Intelligence Acceptable Use Policy for city employees and several commercial lease amendments. The body will also receive updates on vacant commercial buildings and the 2025 Fire Department year-end report.

ai-policycommercial-leaseseconomic-developmentpublic-safetyzoning
✓ Decided: Council adopts AI policy, approves airport lease amendment

The Auburn City Council adopted a new Artificial Intelligence Acceptable Use Policy for city employees, approved a ground lease amendment for Hangar Row Alpha at the airport, and appointed Rebecca Kosinski to the Historic Design Review Commission. All consent items passed unanimously, including contract amendments and a subdivision improvement agreement. No substantive decisions were made in closed session.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 March 23, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet (large file) Mayor Proclamations: Consent Calendar: 1. Minutes By Motion, approve the City Council minutes of 2/23/2026 and 3/2/2026. PDF Copy 2. Amendment No. 1 to Commercial Office Lease with Almost Free to All (AFTA)  By Resolution, approve Amendment No. 1 to the Commercial Office Lease between the City of Auburn and Almost Free to All (AFTA) for the use of the Carnegie Library building located at 175 Almond Street, an …
Excerpt truncated on this listing page. Full text →
Thu Mar 19, 2026

Planning Commission/ HDRC

Planning Commission to consider 1-year extension for 65-lot Collins Drive subdivision

The joint meeting will consider a Historic Design Review Permit for exterior paint and reroof of the Hink Block at 818-846 Lincoln Way, and a 1-year time extension for the Collins Drive Subdivision to subdivide 27.9 acres into 65 single-family lots at 975 & 1055 Collins Drive. The commission will also approve minutes from previous meetings and receive staff updates.

zoninghistoric preservationsubdivisionpublic-hearingplanning-commissionhousing
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CITY OF AUBURN PLANNING COMMISSION AND HISTORIC DESIGN REVIEW COMMISSION JOINT MEETING AGENDA City Hall, Council Chambers 1225 Lincoln Way, Auburn, CA 95603 March 17, 2026 Regular Session 6:00 p.m. To watch a meeting being streamed live, please visit https://www.youtube.com/channel/UCmZkDGdt8ce1ckCRgcX-15A/live 1. CALL TO ORDER/ ROLL CALL / PLEDGE OF ALLEGIANCE 2. PUBLIC COMMENT This is the time provided so that persons may speak to the Commission on any item not on this agenda. Please make your comments as brief as possible. The Commission cannot act on items not included on this agenda; however, the items will be referred to City staff automatically. 3. APPROVAL OF MINUTES By MOTION, approve the meeting minutes of January 20 and February 17, 2026. 4. PUBLIC HEARING Historic Design Review Commission: A. HISTORIC DESIGN REVIEW PERMIT – Hink Block – 818-846 Lincoln Way – File HDRP 26-01 The applicant requests Historic Design Review Commission approval of a Historic Design Review Permit (HDRP 26- 01) for exterior building façade paint and reroof of existing wood shake awning with metal standing seam associated with Hink Block located at 818-846 Lincoln Way in Downtown Auburn. *Adjourn HDRC and reconvene as Planning Commission *CALL TO ORDER Planning Commission/ROLL CALL 5. PUBLIC HEARING A. VESTING TENTATIVE SUBDIVISION MAP EXTENSION – 975 & 1055 Collins Drive (Collins Drive Subdivision) -- FILE SUB EXT 16-02 (Ext.4) The app …
Excerpt truncated on this listing page. Full text →
Tue Mar 17, 2026

Traffic Committee Meeting

Diagonal parking proposal for High Street Downtown

The Auburn Traffic Committee will discuss a proposal to introduce diagonal parking on High Street in Downtown. Public comment is permitted on non-agenda items. No other business items are listed on the agenda.

trafficparkingdowntownpublic-worksplanningpolice
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
TRAFFIC COMMITTEE March 17, 2026 8:30 a.m. Auburn City Hall, 1225 Lincoln Way, Auburn Room 10 https://us02web.zoom.us/j/4647233700 Traffic Committee Members Bryan Morrison, Police Chief Sandy Amara, Council Member Mengil Deane, Public Works Director Mike Lehmberg, Planning Commissioner Staff: Amy Lind, City Clerk AGENDA • Call to Order • Public Comment This is the time provided so that persons may speak to the Committee on any item not on this agenda. The Committee cannot act on items not included on this agenda. The Traffic Committee reserves the right to hear items in a different order to accomplish business in the most efficient manner. Committee Business: 1. High Street in Downtown – Proposal for Diagonal Parking Adjourn
Thu Mar 12, 2026

City Council Special Session

City Council holds strategic planning workshop

The Auburn City Council will hold a strategic planning session workshop. No action is scheduled to be taken during this meeting.

strategic-planninggovernment-operations
✓ Decided: Auburn City Council held a strategic planning workshop

The City Council held a special session for a strategic planning workshop. No formal actions or decisions were taken during the meeting.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 | P a g e Auburn City Council Special Meeting Canyon View Community Center 471 Maidu Drive Auburn, CA 95603 March 2, 2026 at 9a.m. Kelley Davis, Mayor Rachel Radell-Harris, Vice Mayor Alice Dowdin Calvillo, Council Member Mike Holmes, Council Member Sandra Amara, Council Member The public is encouraged to participate or observe this meeting by: Attend this meeting in person at the Canyon View Community Center, 471 Maidu Drive, Auburn, CA 95603. CALL TO ORDER /ROLL CALL PLEDGE OF ALLEGIANCE PUBLIC COMMENT: This is the time provided so that the public may speak to the Council on any item not on this agenda. Please make your comments as brief as possible (not to exceed 3 minutes). The Council cannot act on items not included on this agenda; items may be referred to staff or placed on a future agenda. 1. Strategic Planning Session Workshop; no action to be taken. ADJOURNMENT 2 | P a g e Certification of Posting of Agenda I, Amy Lind, City Clerk for the City of Auburn, declare that the foregoing agenda for the March 2, 2026 , Special Session of the Auburn City Council was posted February 25 , 2026 at the entrance of City Hall and at Canyon View Community Center 471 Maidu Drive, Auburn. The agenda, along with staff reports, are also posted on the City’s website. Signed February 25, 2026 at Auburn, California ____________________________________________________________ Amy Lind, City Clerk …
Excerpt truncated on this listing page. Full text →
Mon Mar 9, 2026

City Council Meeting

Council considers $1.39 million emergency storm drain project on Grass Valley Hwy

The City Council will discuss cost management strategies for unfunded pension liabilities and review a proposal for Highway 49 Roundabout artwork. The body is also deciding on several infrastructure contracts and budget adjustments for city services.

infrastructurebudgetpensionsstorm-drainspublic-worksarts
✓ Decided: Auburn City Council approves $1.39M for emergency storm drain rehabilitation

The Council approved a budget adjustment of $1,392,109 for emergency storm drain work at 414 Grass Valley Hwy. Other actions included awarding a road maintenance contract and accepting grant funds for vegetation management. The Council also approved the concept for Highway 49 Roundabout artwork.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
AUBURN CITY COUNCIL City Council Meeting 1225 Lincoln Way, Auburn, CA 95603 March 9, 2026 It is the intention of the City of Auburn to comply with the Americans with Disabilities Act (ADA) in all respects. If, as an attendee or a participant at this meeting, or in meetings on a regular basis, you will need special assistance beyond what is normally provided, the City will attempt to accommodate you in every reasonable manner. Individuals who need auxiliary aids or services for effective communication or to participate in programs and services of the City of Auburn are invited to make their needs and preferences known by contacting the City Clerk, (530) 823-4211 Ext. 112, at least 72 hours prior to the meeting. This notice is available in accessible alternate formats from the ADA Coordinator. Agenda: Agenda (incl closed session) Agenda Packet Mayor’s Proclamations: Consent Calendar: 1. FY 2025-26 Mid-Year Position Allocation List Correction By Resolution, approve a correction to the FY 2025-26 Mid-Year Position Allocation List. Staff Report 2. Acceptance of Donation from the Rotary Club of Auburn By Resolution, accept a $15,000 unsolicited donation from the Rotary Club of Auburn to be used for amenities for the patio in front of City Hall, and approve a FY 2025 …
Excerpt truncated on this listing page. Full text →

Showing the 30 most recent meetings of 39 on record. See the yearly meeting archives below for the full history.

💰 Federal awards (top 10 by amount)
Largest recent federal contract/grant awards to recipients in this city (2023–present), via USAspending.gov.
$39.5MMDT ARMOR CORP
Department of Defense · CONTRACT W56HAV-23-C-0047 IS FOR THE PRODUCTION OF THE DAVID LIGHT ARM
$22.6MTSS-JCC LLC
Department of Health and Human Services · WESTERN OREGON SERVICE UNIT (WOSU) SCHOOL BASED HEALTH CENTER (SBHC) D
$21.9MAUBURN UNIVERSITY
Department of Homeland Security · NEW PROJECT THAT INCORPORATES APPLIED RESEARCH AND DEVELOPMENT ACTIVIT
$16.5MAUBURN UNIVERSITY
National Aeronautics and Space Administr · RAPID ANALYSIS AND MANUFACTURING TECHNOLOGY PROPULSION (RAMPT) PROJECT
$11.4MAUBURN UNIVERSITY
Department of Defense · RADIATION HARDENED MICROELECTRONICS TESTING FACILITY
$10.1MMDT ARMOR CORP
Department of Defense · QUANTITY OF 61 EACH DAVID URBAN LIGHT ARMORED COMBAT VEHICLES AND 1 LO
$7.6MINTRAMICRON, INC
Department of Defense · 873AUTHORITY
$6.8MMDT ARMOR CORP
Department of Defense · DELIVERY ORDER FOR 41 EACH DAVID VEHICLES AND SPARE PARTS UNDER FMS DI
$4.9MCSP TECHNOLOGIES, INC.
Department of Defense · DEVELOPMENT OF ACTIVSHIELD STERILIZATION TECHNOLOGY RESEARCH
$4.5MINTRAMICRON, INC
Department of Defense · ENGINEERING&TECHNICAL SERVICES.

Source: USAspending.gov (U.S. Treasury) — federal awards only, not city budgets.

🌐 County-level context (Lee County)
County-level context — from BLS, IRS, FEMA, HUD, Census. These figures cover the whole county this city sits in, not just the city itself.
Net migration+463 people (+$73.0M net AGI · 2023)
Federal disasters (10 yr)6 ({"Hurricane": 8, "Severe Storm": 7, "Tornado": 2, "Biologica · last Thu Sep 26, 2024)
Traffic fatalities4 (2024)
Business establishments3,377 (51,454 employees · 2023)
Fair Market Rent (2BR)$1,168/mo (559 assisted households · 2025)
Adults with low literacy19.8% (low numeracy 32% · 2017)

Sources: BLS LAUS, IRS SOI, FEMA, NHTSA FARS, Census CBP, HUD, NCES PIAAC

City profile

Everything below is drawn from this city’s own public record and primary-source government data. AI-written summaries are a finding aid, not a citable quote.

86
Recorded votes
$179.2M
Annual budget
$113.6M
Debt outstanding
689
Permitted housing units

The money — in

source: Census gov-finance & state comptroller

Budget

Revenue$179.2M
Spending$149.2M
Revenue ran ahead of operating spending this year.

Debt load LOW

Outstanding debt$113.6M
Debt-to-revenue0.63×
Debt-load index39 / 100
A debt-load indicator (national percentile of debt, deficit & aid-reliance) — not a solvency verdict. Cross-checked against official state fiscal-stress scores where they exist.

Outcomes — economic mobility

source: Opportunity Atlas (Harvard) · research use

For kids who grew up here in low-income households, their adult household-income rank (0–1). The average hides a gap by race:

White kids
0.417
All kids
0.364
Black kids
0.328

Research-only layer, shown here for context — not included in the CC BY 4.0 bulk download.

Where it’s happening

geocoded land-use decisions
🗺 Interactive map
Every rezoning, development approval, and permit — explore the geocoded records in the research explorer.

Meeting archives

🔗 Embed this city · use the data

Free to reuse under CC BY 4.0 — a link back is appreciated. Paste this into your site:

<iframe src="https://mytown.theboringparts.com/city/gr-auburn/embed/" width="100%" height="640" loading="lazy" style="border:1px solid #ddd;border-radius:8px" title="Auburn government meetings"></iframe>
<p>Local government meetings via <a href="https://mytown.theboringparts.com/city/gr-auburn/">MyTown</a></p>

The credit line under the iframe is a real link back — keep it and you help others find us (and it satisfies the CC BY attribution). Prefer JSON? meetings.json · full embed & API guide.