The Boring PartsFederalLocal · USLocal · Canada
Nantucket County, MA

Nantucket County public meetings in 2021

1239 substantive meetings from 2021, with official agendas or minutes and plain-English summaries.

Thu Dec 30, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to discuss and decide on a variety of new and old business applications for property modifications. The agenda includes requests for new dwellings, additions, and exterior changes across multiple Nantucket addresses.

zoninghistoric-preservationhousingconstruction
Tue Dec 28, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to vote on golf course management contract

The Nantucket Islands Land Bank Commission will review monthly reports for Sconset and Miacomet golf courses. The body will consider a contract award for golf course management services and a request to ease restrictions for Daily’s Dogs.

golf-coursescontractsreal-estateproperty-management
Tue Dec 28, 2021 · 00:00

Historic District Commission

HDC to vote on Section 106 Representative and review 44 new property applications

The Historic District Commission will vote on a Certified Local Government Section 106 Representative. The body will also review numerous applications for residential and commercial alterations, including new dwellings, sheds, and fences.

zoninghistoric-preservationhousingsolarconstruction
Mon Dec 27, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review residential property alterations

The Historic Structures Advisory Board is meeting to review applications for exterior changes to various properties. The board will discuss new and old business regarding renovations, additions, and hardscaping.

historic-preservationzoningresidential-constructionnantucket
Mon Dec 27, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential projects and zoning amendments

The Sconset Advisory Board is meeting to review preliminary and ongoing design applications for residential properties. The board will also discuss zoning amendments specifically for the Sconset Area.

zoningresidential-developmentsconsetland-use
Thu Dec 23, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new dwellings

The Historic District Commission is meeting to discuss a high volume of applications for residential and commercial property modifications. The body will review requests for new dwellings, sheds, solar arrays, and exterior renovations across various Nantucket addresses.

zoninghistoric-preservationhousingsolarconstruction
Wed Dec 22, 2021 · 00:00

Conservation Commission

Conservation Commission to discuss Siasconset Beach litigation strategy

The Nantucket Conservation Commission will meet via Zoom to enter an executive session. The body will discuss legal strategy regarding a litigation matter with the Siasconset Beach Preservation Fund.

litigationbeach-preservationconservation
Tue Dec 21, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on a variety of requests including new dwellings, sheds, garages, and fenestration revisions.

zoninghistoric-preservationhousingsolarsigns
Tue Dec 21, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board prepares for oyster lease revocation and discusses fertilizer bans

The Harbor & Shellfish Advisory Board will discuss the revocation of Ted Lambrecht’s oyster lease in preparation for a Select Board meeting. The board will also review fertilizer use on Nantucket and dredging plans to address excessive sand in scallops.

shellfishenvironmentdredgingfertilizerharbor-management
Tue Dec 21, 2021 · 00:00

Community Preservation Committee

The December 21, 2021, Community Preservation Committee meeting is cancelled

The scheduled meeting for the Community Preservation Committee on December 21, 2021, has been cancelled.

cancellation
Tue Dec 21, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on athletic and newspaper donations

The Nantucket School Committee will review budget development for FY’23 regarding technology, English Language Learners, and special services. The body will also receive updates on COVID vaccine clinics and social emotional learning.

educationbudgetdonationspublic-healthstaffing
Tue Dec 21, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss road, sidewalk, and mapping projects

The committee will receive updates on road and sidewalk projects and discuss the Chapter 91 Public Access map. Members will also review plans for installing new Public Way monuments and a draft statement for state representatives regarding Chapter 91.

roadssidewalksmappingpublic-accessinfrastructure
Tue Dec 21, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review five sign applications

The Sign Advisory Council is meeting to discuss new business regarding sign installations and renovations. The council will review applications for various properties across Nantucket.

signszoningland-usenantucket
Mon Dec 20, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review pool and pergola projects on Baxter Rd

The Sconset Advisory Board will conduct preliminary reviews for two projects at 28 and 32 Baxter Rd. The board will also discuss zoning amendments for the Sconset Area.

zoningsconsetland-useresidential-development
Mon Dec 20, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 20 property modification requests

The Historic Structures Advisory Board is meeting to review old and new business regarding property alterations. The board will discuss various requests for new dwellings, renovations, and hardscaping across the town.

historic-preservationzoningbuilding-permitshousing
Mon Dec 20, 2021 · 00:00

Council for Human Services

Council for Human Services to discuss food security and local programs

The Council for Human Services will receive updates from the Director of Human Services and a representative from the Artists Association of Nantucket. The body will also discuss food security and potential future agenda topics, including the publishing of the police blotter.

human-servicesfood-securityartspolice-blotter
Mon Dec 20, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The meeting scheduled for December 20, 2021, was cancelled due to administrative issues.

administrative
Fri Dec 17, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission discusses surveys and historic tax credits

The Commission is reviewing updates on the Historic Sidewalk Project, an island-wide survey of historic resources, and a memorandum of understanding with the Historic District Commission. Members also discussed rehabilitation standards for property applications and state tax credit programs.

historic-preservationzoningtax-creditsgovernment-administrationsurveys
Fri Dec 17, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission discusses sidewalk projects and historic resource surveys

The Commission will discuss updates on the Historic Sidewalk Project, including a survey study and Main Street project. Members will also review the Massachusetts Preservation Project grant program and potential collaboration with the HDC.

historic-preservationinfrastructuregrantszoningenvironment
Thu Dec 16, 2021 · 00:00

Board of Health

Board of Health to discuss COVID emergency order and nitrogen loading variances

The Nantucket Board of Health will review loan requests and releases for specific properties. The board is also scheduled to discuss a COVID emergency order and a nitrogen aggregation plan for 47 Millbrook Road.

public-healthcovid-19nitrogen-loadingenvironmental-regulationsloans
Thu Dec 16, 2021 · 00:00

Zoning Board of Appeals

ZBA discusses solar ground array setbacks at Woodbine Street and S. Valley Road

The Zoning Board of Appeals will consider two requests for variance relief regarding solar ground arrays. These requests involve validating the location of solar equipment within side, rear, or front yard setbacks.

zoningsolarsetbacksland-use
Thu Dec 16, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council discusses award ceremony and logo

The Council will review plans for a grant recipient awards ceremony scheduled for April 2022. Members will also discuss potential logos and future meeting dates.

grantscommunity-eventsadministration
Thu Dec 16, 2021 · 00:00

Cannabis Advisory Committee

Cannabis Advisory Committee to discuss ACK Natural and marijuana establishment types

The Cannabis Advisory Committee will meet to elect officers and discuss the status of ACK Natural. The committee will also review the focus and direction of future meetings regarding marijuana establishments and host agreements.

cannabisbusiness-licensingzoninggovernment-administration
Thu Dec 16, 2021 · 00:00

Capital Program Committee

Capital Program Committee to vote on preliminary RORI recommendations

The committee will discuss Group RORIs and related matters. Members are expected to vote on preliminary current year and out year recommendations and discuss report recommendations.

capital-programbudgetrori
Thu Dec 16, 2021 · 00:00

Board of Health

Board of Health reviews septic applications and loan releases

The Board of Health is reviewing septic system applications and variance requests for specific properties. The body is also considering loan release requests for two addresses.

health-boardseptic-systemsvariancespermits
Thu Dec 16, 2021 · 00:00

Conservation Commission

Conservation Commission holds public hearings on several property intents

The Nantucket Conservation Commission is reviewing notices of intent and amended conditions for various properties. The body will also discuss litigation strategy regarding the Siasconset Beach Preservation Fund Geotextile Tube Project Removal Order in executive session.

conservationpublic-hearingszoninglitigationenvironmental-protection
Thu Dec 16, 2021 · 00:00

One Time Event

Contract Review Committee to discuss grants and establish reporting schedule

The Contract Review Committee is meeting to discuss received grants, including a cannabis grant, and first quarter reports. The body will also follow up on the food pantry and set a schedule for interviews and final recommendations.

grantscannabisfood-pantrygovernment-oversight
Thu Dec 16, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for property modifications, new dwellings, and signage. The body will decide on consent items and hear new and old business regarding historic preservation and land use.

historic-preservationzoninghousingdemolitionsignage
Thu Dec 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations and structure moves

The Historic District Commission is meeting to review several consent items regarding property modifications. The agenda includes requests for alterations, hardscaping, and the moving of dwellings and outbuildings.

historic-districtzoningproperty-alterationsnantucket
Thu Dec 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential construction and demolition requests

The Historic District Commission is reviewing several Certificates of Appropriateness for residential projects. These include requests for new dwellings, additions, and demolition.

historic-districtszoningconstructiondemolition
Thu Dec 16, 2021 · 00:00

Conservation Commission

Conservation Commission reviews multiple property filings and permits

The Conservation Commission is meeting to review various Notices of Intent (NOI), Certificates of Compliance (COC), and other filings for specific properties. The body will also review the minutes from the December 2, 2021 meeting and a monitoring report for 24 Almanack Pond.

conservationland-usepermitsenvironmental-protection
Wed Dec 15, 2021 · 00:00

Select Board

Select Board to hold public hearing on annual licensing renewals

The Select Board will conduct a public hearing to consider renewing various annual licensing categories. The board will also review real estate subdivision requests for Auriga Street and discuss the FY 2023 General Fund Budget.

licensingreal-estatebudgetpublic-hearingzoning
Wed Dec 15, 2021 · 00:00

Select Board

Select Board to hold public hearing on annual business license renewals

The Select Board will conduct a public hearing regarding the renewal of various annual licensing categories. The board will also review real estate subdivisions on Auriga Street and consider several town contracts.

licensingreal-estatesewercontractsbudget
Wed Dec 15, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to tour proposed Sconset Golf Course improvements

The Nantucket Islands Land Bank Commission is meeting to conduct a site tour. The session focuses on proposed improvements to the Sconset Golf Course.

land-banksconset-golf-coursepublic-works
Wed Dec 15, 2021 · 00:00

Nantucket Housing Authority

Nantucket Housing Authority to review 2022 Miacomet Village I budget

The Nantucket Housing Authority will meet to approve vouchers and the FY 2022 Annual Operating Budget for the 4001 Program at Miacomet Village I. The board will also discuss a building envelope project and accounting service contracts.

housingbudgetcontractsmaintenance
Wed Dec 15, 2021 · 00:00

County Commission

Commission to appoint Nantucket member to Steamship Authority Governing Board

The County Commissioners will review applications and appoint a representative to the Steamship Authority Governing Board for a three-year term. The body will also appoint a new county representative to the Nantucket Planning and Economic Development Commission for 2021-2022.

appointmentssteamship-authorityeconomic-developmentplanningbudget
Wed Dec 15, 2021 · 00:00

County Commission

Commission to appoint members to Steamship Authority and Planning Commission

The County Commissioners are meeting to review applications and appoint a Nantucket member to the Steamship Authority Governing Board. The body will also appoint a new County representative to the Nantucket Planning and Economic Development Commission for 2021-2022.

appointmentssteamship-authorityeconomic-developmentplanningbudget
Tue Dec 14, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to ratify $2.1 million FAA Rescue Grant Agreement

The Nantucket Memorial Airport Commission will discuss the FY23 final operating budget and a PFAS investigation update. The body is also reviewing a declaration of surplus property for a concession space at 14 Airport Road.

airportbudgetgrantsreal-estateenvironment
Remote Participation Via Zoom
Tue Dec 14, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to acquire land at 8 White Street for $1.2 million

The Town of Nantucket Affordable Housing Trust Fund is processing the acceptance of a deed for a parcel of vacant land. The property is restricted to year-round residential affordable housing purposes.

affordable-housingreal-estateland-acquisition
Tue Dec 14, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a large volume of applications for residential modifications. The body will decide on a variety of requests including new dwellings, solar installations, and structural renovations.

zoninghistoric-preservationsolarhousingconstruction
Tue Dec 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations and new constructions

The Historic District Commission is reviewing a large volume of applications for new dwellings, additions, and exterior modifications. The meeting covers new and old business regarding residential property changes across the district.

historic-districtzoninghousingsolarconstruction
Tue Dec 14, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses property purchases and project updates

The Affordable Housing Trust will meet to discuss building permit statuses for 31 Fairgrounds and Richmond Wildflower Acceleration. The board is scheduled to take action on the purchase of properties at 12 & 12R Bartlett Road and 8 White Street.

affordable-housingreal-estateproperty-purchasebuilding-permits
Tue Dec 14, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses property purchases and funding requests

The Affordable Housing Trust will review several real estate transactions, including potential land and building purchases on Bartlett Road and White Street. The board will also receive a presentation regarding a request for $2.266 million in additional grant funding for the 31 Fairgrounds development.

affordable housingreal estategrantsconstructionzoning
Tue Dec 14, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to award golf management contract and review 2022 rates

The Nantucket Islands Land Bank Commission will meet to discuss golf management, property planning for specific addresses, and financial authorizations. The body will also adopt the annual "M" exemption amount and hold an executive session regarding real estate acquisitions.

golfreal-estateproperty-managementfinanceexemptions
Tue Dec 14, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss stranded passengers

The Visitor Services Advisory Committee is meeting to review reports from the Director and Coordinator. The committee will also discuss the issue of stranded passengers.

visitor-servicestransportationtourism
Mon Dec 13, 2021 · 00:00

Planning Board

Planning Board to review dwelling applications and hold public hearings

The Planning Board will discuss applications for secondary and tertiary dwellings and review several After Neighborhood Review (ANR) items. The board will also hold public hearings for various property requests and elect a Vice-Chair.

zoninghousingpublic-hearingsland-use
Mon Dec 13, 2021 · 00:00

Planning Board

Planning Board to review secondary dwelling and subdivision requests

The Planning Board is meeting to review applications for secondary and tertiary dwellings and After the Neighborhood Record (ANR) plans. The board will also hold public hearings for several specific properties and review previous subdivision plans.

zoninghousingland-usesubdivisions
Mon Dec 13, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee to review 5 & 9 Auriga Yard Sale

The Real Estate Assessment Committee is meeting to continue its review of a situation regarding 5 & 9 Auriga Yard Sale. The meeting also includes standard procedural items such as public comment and agenda approval.

real-estateassessmentproperty-review
Fri Dec 10, 2021 · 00:00

Certified Local Government Commission

HDC and NHC to discuss and vote on a draft Memorandum of Understanding

The Historic District Commission and Nantucket Historical Commission are holding a joint special meeting. The body will discuss individual and mutual goals and consider a motion regarding a draft Memorandum of Understanding (MOU).

historic preservationgovernmentmou
Thu Dec 9, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review solar variances and pool permits

The Zoning Board of Appeals will hold public hearings to decide on variance requests for solar arrays and special permits for residential swimming pools and cabanas. The board will also hear appeals regarding the classification of a structure as a hot tub and a dispute over a commercial laundry use.

zoningsolarswimming-poolsvariancesland-use
Thu Dec 9, 2021 · 00:00

Zoning Board of Appeals

Zoning Board to review solar variances and swimming pool permits

The Zoning Board of Appeals will hold hearings on several variance requests for solar arrays and swimming pools. The board will also consider an appeal regarding the definition of a hot tub/spa and a request for a home addition at 8 Bank Street.

zoningvariancessolar-energyswimming-poolsresidential-construction
Thu Dec 9, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss Group RORIs

The Capital Program Committee will meet to discuss Group RORIs and related matters. Other agenda items are procedural.

capital-programfinance
Thu Dec 9, 2021 · 00:00

Finance Committee

Finance Committee to hold public hearing on Citizen Warrant Articles

The Finance Committee will conduct a public hearing and hold discussions regarding Citizen Warrant Articles. The meeting also includes the approval of minutes from September 13, 2021.

financepublic-hearingwarrant-articles
Thu Dec 9, 2021 · 00:00

Historic District Commission

Historic District Commission to review over 100 property alteration requests

The Historic District Commission is meeting to discuss a large volume of new and old business applications for property modifications. The body will review requests for new dwellings, demolitions, and solar installations across various Nantucket addresses.

zoninghistoric-preservationsolardemolitionhousing
Thu Dec 9, 2021 · 00:00

Nantucket Water Commissioners

Water Commissioners to review FY 2023 budget and PFAS project

The Nantucket Water Commissioners will meet to review production, billing, and rainfall reports. The board will discuss the FY 2023 budget, a solar project, and a new well location.

water-infrastructurebudgetpfassolar-energy
Thu Dec 9, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee to review 5 & 9 Auriga Yard Sale

The Real Estate Assessment Committee will meet to discuss real estate matters. The primary item for review is the situation regarding 5 & 9 Auriga Yard Sale.

real-estateassessment
Thu Dec 9, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review variances and special permits for residential and commercial sites

The Zoning Board of Appeals will hold public hearings to decide on variance requests and special permits. Discussions include residential additions, swimming pools, solar arrays, and a commercial use appeal.

zoningvariancesspecial-permitssolar-energyresidential-construction
Wed Dec 8, 2021 · 00:00

Cemetery Commission

Cemetery Commission to review lot sales and monument restoration

The Nantucket Cemetery Commission will discuss lot sales, including a sale to Joseph Chmielewski and the release of lots for Madden. The board will also review updates on the Polpis Cemetery and the Monument Restoration Project.

cemeteriesland-usepublic-worksmonuments
Wed Dec 8, 2021 · 00:00

Select Board

Select Board to review FY 2023 budget and shellfish license revocation

The Select Board will receive a presentation on the FY 2023 General Fund Budget and hold a public hearing regarding the revocation of private shellfish aquaculture licenses. The board will also consider requests for liquor license manager changes and sewer fee waivers.

budgetlicensinghousingshellfishingsewer
Wed Dec 8, 2021 · 00:00

Select Board

Select Board to review FY 2023 budget and sewer fee waivers

The Select Board will receive a presentation on the FY 2023 General Fund Budget and consider requests regarding business licensing and sewer fees. The meeting also includes a continued public hearing on the revocation of shellfish aquaculture licenses.

budgetsewerhousinglicensingaquaculture
Tue Dec 7, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee discusses grant planning and road projects

The committee is meeting to review updates on coastal resilience activities and plan grant applications. Discussions include specific infrastructure projects and a review of a recent presentation to the Select Board.

coastal-resilienceinfrastructuregrantszoningbudget
Tue Dec 7, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss dredging and water quality

The board will review reports from the Marine and Natural Resources departments. Discussions will focus on harbor health, including fertilizer use and shellfish prohibitions in mooring fields.

shellfishwater-qualitydredgingenvironmentharbor-management
Tue Dec 7, 2021 · 00:00

Historic District Commission

Historic District Commission to review dozens of property alterations

The Historic District Commission is meeting to review applications for new dwellings, demolitions, and renovations. The body will also discuss the Sunrise Wind Farm Project and policies regarding house moves and demolitions.

zoninghistoric-preservationdemolitionsolarhousing
Tue Dec 7, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission discusses golf course management and real estate acquisition

The Commission will interview a proposal for Golf Course Management Services and discuss scheduling a special meeting regarding Sconset Golf Course proposed improvements. An executive session is scheduled to discuss a real estate acquisition.

golfreal-estateland-usegovernment-business
Tue Dec 7, 2021 · 00:00

Nantucket Public School Committee

School Committee to discuss FY23 budget development and federal grants

The Nantucket School Committee will discuss budget development for FY23 regarding facilities, athletics, and the community school. The body will also review federal grants, enrollment, and food services updates.

educationbudgetfederal-grantsdonations
Tue Dec 7, 2021 · 00:00

NPEDC Work Group

Town Area Plan Workgroup to discuss Master Plan components

The Town Area Plan Workgroup is meeting to discuss the nine components of the Master Plan. The meeting includes a guest presentation by Deputy Director of Planning Leslie Woodson Snell.

planningmaster-planeconomic-development
Tue Dec 7, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review five sign requests for 1 Miacomet Road

The Sign Advisory Council is meeting to discuss new business regarding sign installations. The council will review five specific sign requests for a property owned by the Nantucket Land Bank.

signsnantucket-land-bankland-use
Mon Dec 6, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 12 property modification requests

The Historic Structures Advisory Board is meeting to review old and new business regarding property alterations. The board will discuss specific structural changes, including additions, roof replacements, and hardscaping, at various Nantucket addresses.

historic-preservationzoningbuilding-permitshousing
Mon Dec 6, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review seven property projects and zoning amendments

The Sconset Advisory Board is meeting to conduct preliminary reviews of several construction projects. The board will also discuss zoning amendments for the Sconset Area.

zoningconstructionsconsetland-use
Mon Dec 6, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee meeting cancelled

The meeting scheduled for December 6, 2021, has been cancelled.

real-estateassessment
Thu Dec 2, 2021 · 00:00

Select Board

Select Board to discuss opioid litigation and union bargaining strategy

The Select Board and County Commissioners will meet via Zoom to conduct executive sessions. The board will discuss legal strategies regarding national opioid distributors and collective bargaining with Public Employees Local Union 1249.

litigationopioidslabor-relationscollective-bargaining
Thu Dec 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss Planning Board housing articles

The Affordable Housing Trust will discuss proposed housing-related articles from the Planning Board. The body will also receive an update on the Transfer Fee Strategy Funding.

affordable-housingzoningworkforce-housingreal-estate
Thu Dec 2, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The Capital Program Committee meeting scheduled for December 2, 2021, was cancelled due to administrative issues.

procedural
Thu Dec 2, 2021 · 00:00

Conservation Commission

Nantucket Conservation Commission reviews multiple Notices of Intent and Orders of Conditions

The Commission will conduct public hearings for several Notices of Intent and review various orders, including amended orders and certificates of compliance. The meeting also includes an executive session to discuss litigation strategy regarding the Siasconset Beach Preservation Fund Geotextile Tube Project Removal Order.

conservationzoningland-usepublic-hearingslitigation
Thu Dec 2, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new dwellings

The Historic District Commission is meeting to discuss a wide range of residential and commercial modifications, including new dwellings, demolitions, and solar installations. The body will also discuss the appointment of a new Section 106 representative and the Sunrise Wind Farm Project.

zoninghistoric-preservationdemolitionsolarhousing
Thu Dec 2, 2021 · 00:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council to discuss family communication

The School Council will meet to discuss communication with families and how to communicate the NIS story. The meeting includes a period for public comment.

educationschool-councilcommunication
Wed Dec 1, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The Capital Program Committee meeting scheduled for December 1, 2021, was cancelled due to administrative issues.

administrative
Wed Dec 1, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to discuss Coastal Resilience Plan with Select Board

The Coastal Resilience Advisory Committee will attend a Select Board meeting in open session. The committee will discuss and answer questions regarding the Coastal Resilience Plan for the Select Board and the public.

coastal-resilienceplanningenvironment
Wed Dec 1, 2021 · 00:00

Council on Aging

Council on Aging to critique home modifications grant implementation plan

The Council on Aging will review a draft implementation plan for a home modifications grant. The body will also receive reports on COVID-19 human services, Saltmarsh programs, and dementia-friendly initiatives.

seniorsgrantshealth-servicescovid-19human-services
Wed Dec 1, 2021 · 00:00

Select Board

Select Board to hold public hearing on FY2022 residential tax exemptions

The Select Board will conduct a continued public hearing regarding tax allocation by classification and residential exemptions for Fiscal Year 2022. The board will also review 2022 Annual Town Meeting warrant articles and a Coastal Resilience Plan.

taxesconservationcontractscoastal-resiliencezoning
Wed Dec 1, 2021 · 00:00

Select Board

Select Board to hold public hearing on FY2022 residential tax exemptions

The Select Board will conduct a continued public hearing regarding tax allocation by classification and residential exemptions for Fiscal Year 2022. The board will also review short-term rental reports and the Coastal Resilience Plan.

taxeszoningenvironmentliquor-licensespublic-safety
Tue Nov 30, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on a variety of requests including new dwellings, demolitions, and solar installations.

zoninghistoric-preservationdemolitionsolarhousing
Tue Nov 30, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council to review and award grants

The Nantucket Cultural Council will meet to review and award grants. The council will also plan an awards ceremony for April 2022 and review a possible logo.

grantsarts-and-culturecommunity-funding
Mon Nov 29, 2021 · 00:00

Council for Human Services

Council for Human Services to review Behavioral Health Assessment report

The Council for Human Services will meet to receive a presentation on a Behavioral Health Assessment from Government Performance Solutions. The meeting also includes updates from the Director of Human Services and a presentation from the Artists Association of Nantucket.

behavioral-healthmental-healthhuman-servicespublic-health
Mon Nov 29, 2021 · 00:00

Planning Board

Planning Board to discuss affordable housing and zoning articles

The Planning Board is discussing sponsored articles regarding affordable housing and finalizing a concept list for drafting articles. The board is also reviewing several citizen-sponsored zoning and bylaw change requests, with public hearings to be scheduled later.

zoningaffordable-housingland-usebylaws
Tue Nov 23, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on consents, new business, and old business regarding structural modifications and new constructions.

zoninghistoric-preservationconstructionsolardemolition
Tue Nov 23, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review golf course updates and property planning

The Nantucket Islands Land Bank Commission will discuss management and planning for Sconset and Miacomet golf courses. The body will also review landscaping policies and specific property discussions for 113 Madaket Road and 49 Somerset Road.

land-managementgolf-coursesreal-estatepublic-policy
Mon Nov 22, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to hear appeals and variance requests

The Zoning Board of Appeals will conduct public hearings on several new applications and review old business. The board is considering appeals regarding driveway violations, short-term rental uses, and building occupancy certificates, as well as requests for zoning variances and special permit modifications.

zoningpublic-hearingsland-useshort-term-rentalsvariances
Mon Nov 22, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review appeals and special permits for various properties

The Zoning Board of Appeals will hear appeals regarding zoning enforcement determinations and requests for special permits or variances. Discussions include property use disputes, solar array placements, and residential construction modifications.

zoningshort-term-rentalsspecial-permitsvariancesresidential-construction
Mon Nov 22, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review residential permits and zoning appeals

The Zoning Board of Appeals will hold public hearings to decide on special permits for swimming pools, solar arrays, and home additions. The board will also hear appeals regarding short-term rental use and zoning enforcement determinations.

zoningspecial-permitsshort-term-rentalssolar-energyresidential-construction
Fri Nov 19, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to vote on 2005 ATM vote amendment

The Nantucket Historical Commission will meet to discuss historical resource surveys and tax credit applications. The body is scheduled to vote on a request to amend a 2005 Annual Town Meeting vote.

historic-preservationtax-creditsbudgettown-meeting
Fri Nov 19, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss tax credits and historic surveys

The commission will review a request for State Historic Preservation Tax Credits for 3 Beaver Street and discuss budgets for historic surveys. The body will also address a request to amend a 2005 vote regarding commission membership.

historic-preservationtax-creditsgovernmentsurveyszoning
Thu Nov 18, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential and commercial property changes. The body will decide on consent items, new business applications for new dwellings, and old business regarding house moves and additions.

zoninghistoric-preservationhousingsolardemolition
Thu Nov 18, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 19 property alteration requests

The Commission is meeting to review and potentially grant consent or consent with conditions for various residential modifications. These items include structural additions, roof replacements, and landscaping changes.

historic-districtzoningbuilding-permitsresidential
Thu Nov 18, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations on Wauwinet and Low Beach Roads

The Historic District Commission is reviewing applications for building moves, additions, and hardscaping. The meeting includes requests to move barns and sheds and to modify residential structures.

historic-districtszoningbuilding-permitsresidential
Thu Nov 18, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals meeting to continue all items to November 22

The sole purpose of this meeting is to continue all listed agenda items to a public meeting scheduled for November 22 at noon via Zoom.

zoningspecial-permitsvarianceshousingsolar
Thu Nov 18, 2021 · 00:00

Board of Health

Board of Health to discuss PFAS-contaminated well abandonment

The Nantucket Board of Health will meet to review minutes from October 21, 2021, and hold a discussion regarding the abandonment of wells contaminated with PFAS.

public-healthwater-qualitypfaswells
Thu Nov 18, 2021 · 00:00

Cannabis Advisory Committee

Cannabis Advisory Committee to discuss marijuana establishment types and host agreements

The Cannabis Advisory Committee will meet to elect officers and discuss the future direction of the committee. The body will review various types of marijuana establishments under MGL c. 94G, including limitations and host agreements.

cannabislicensingregulationsgovernment
Thu Nov 18, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss FY23 capital requests

The committee is meeting to discuss FY23 capital requests and outyear planning for specific departments. The agenda also includes a review of RORI to resolve outstanding issues.

budgetdpwtransportationwaste-managementcapital-planning
Thu Nov 18, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple Notices of Intent

The Nantucket Conservation Commission will conduct public hearings for 14 Notices of Intent and 6 Amended Orders of Conditions. The body will also review requests for determination of applicability and certificates of compliance for various properties.

conservationpublic-hearingland-uselitigationenvironmental-regulation
Thu Nov 18, 2021 · 00:00

Cyrus Peirce Middle School

CPS School Council to discuss parent-teacher conferences

The Cyrus Peirce School Council is meeting to discuss parent-teacher conferences scheduled for December 15, 2021. The agenda also includes a placeholder for new business.

educationschool-councilparent-teacher-conferences
Wed Nov 17, 2021 · 00:00

Select Board

Select Board to hold public hearings on tax allocation and utility petitions

The Select Board will discuss sewer fee waivers, real estate transfers, and COVID-19 updates. The body is also reviewing funding for private road repaving in the Surfside area and 2022 Annual Town Meeting warrant articles.

taxesutilitiessewerreal-estateroadspublic-health
Wed Nov 17, 2021 · 00:00

Select Board

Select Board to consider sewer fee waivers for affordable housing

The Select Board will review requests to waive sewer connection and capacity fees for affordable housing projects. The board is also holding public hearings regarding tax allocation and utility installations.

seweraffordable-housingtaxesutilitiesreal-estate
Tue Nov 16, 2021 · 00:00

Nantucket Public School Committee

School Committee to review FY23 budget forecast and school improvement plans

The Nantucket School Committee will discuss preliminary budget forecasts and calendars for FY23. The body will also review school improvement plans for NHS, CPS, NIS, and NES. A vote is scheduled regarding the amended JJF Policy for Student Activity Accounts.

educationbudgetschool-policypublic-schools
Tue Nov 16, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss public access and map projects

The committee will discuss the public access role of Roads and Right of Way under Chapter 91 and a map project for access to ponds, harbors, tidelands, and the ocean. Members will also review the project list and discuss roundabouts and rotaries.

roadspublic-accessmappingsidewalksinfrastructure
Tue Nov 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The Historic District Commission is reviewing old business regarding property alterations. The meeting focuses on revisions to dwellings, hardscaping, and color changes.

historic-districtzoningresidentialproperty-modifications
Tue Nov 16, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews four fund requisitions

The Community Preservation Committee is meeting to approve fund requisitions for four local organizations. The committee will also review a final report from the Nantucket Preservation Trust and the University of Florida Preservation Institute Nantucket.

budgetgrantspreservationhousing
Tue Nov 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews exterior modifications for 10 properties

The Historic District Commission is meeting to review consent items regarding exterior changes to residential properties. The body will consider requests for new structures, roof changes, and fenestration updates.

historic-districtzoningbuilding-permitsresidential
Tue Nov 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 22 property modification requests

The Commission is reviewing applications for new dwellings, additions, and exterior renovations. The agenda includes requests for pools, hardscaping, and the relocation of a barn.

historic-districtzoningbuilding-permitsresidential-construction
Tue Nov 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property applications and historic determinations

The Historic District Commission is reviewing numerous applications for new dwellings, additions, and renovations. The meeting also includes discussions regarding advisory board reviews, house moves, and the Sunrise Wind Farm Project.

zoninghistoric-preservationhousingconstruction
Tue Nov 16, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss dredging and water quality

The board will review reports from the Marine and Natural Resources departments. Discussions include dredging plans for scallops, lawn fertilizer use, and a potential Town Meeting article.

shellfishwater-qualitydredgingenvironmentharbor-management
Tue Nov 16, 2021 · 00:00

Finance Committee

Finance Committee to hold joint meeting on FY23 Capital Projects

The Finance Committee is holding a joint meeting with the Select Board and Capital Program Committee. The body will receive an update regarding FY23 Capital Projects.

budgetcapital-projectsfinance
Tue Nov 16, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss transfer fee strategy and property updates

The Affordable Housing Trust will meet to discuss and take action on a transfer fee strategy for funding. The board will also review applications for the Closing Cost Assistance Program and discuss properties at 135 and 137 Orange Street.

affordable-housingreal-estatefunding-strategyhousing-trust
Tue Nov 16, 2021 · 00:00

Select Board

Select Board to hold joint meeting on FY 2023 capital projects

The Select Board is holding a joint meeting with the Finance Committee and Capital Program Committee. The body will discuss updates regarding FY 2023 capital projects.

budgetcapital-projectsfinance
Tue Nov 16, 2021 · 00:00

Select Board

Select Board reviews preliminary FY 2023 Capital Improvement Plan

The Select Board is holding a joint meeting with the Finance and Capital Program Committees to discuss the preliminary FY 2023 Capital Improvement Plan. The body is reviewing General Fund and Enterprise Fund requests, as well as a 10-year capital outlook.

budgetcapital-improvementschoolshousinginfrastructure
Tue Nov 16, 2021 · 00:00

Capital Program Committee

Capital Program Committee to hold joint meeting on FY23 projects

The Capital Program Committee is holding a joint meeting with the Select Board and Finance Committee. The body will discuss an update regarding FY23 Capital Projects.

budgetcapital-projectsfinance
Tue Nov 16, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee discusses approval of Coastal Resilience Plan

The Coastal Resilience Advisory Committee is meeting to discuss a revised draft letter for the Coastal Resilience Plan. The body will consider a motion to approve the plan and recommend its adoption to the Select Board.

coastal-resiliencefloodingerosionsea-level-riseplanning
Mon Nov 15, 2021 · 00:00

Planning Board

Nantucket Planning Board discusses dwellings, ANRs, and subdivisions

The Planning Board will review several applications regarding secondary, tertiary, and garage dwellings. The agenda also includes several Approval of Name on Registry (ANR) items and multiple public hearings.

zoninghousingresidentialland-usesubdivision
Mon Nov 15, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 11 property modification requests

The Historic Structures Advisory Board is reviewing applications for exterior modifications to residential and commercial properties. The board will consider requests ranging from roof replacements to full building renovations.

historic-preservationzoningbuilding-permitsnantucket
Mon Nov 15, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 15 property modification requests

The Historic Structures Advisory Board is reviewing applications for exterior work on 15 different properties. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationzoningbuilding-permitsnantucket
Mon Nov 15, 2021 · 00:00

Select Board

Select Board to hold long-term solid waste planning workshop

The Select Board will conduct a workshop focused on long-term solid waste planning. No other business items are listed on the agenda.

waste-managementplanning
Mon Nov 15, 2021 · 00:00

Select Board

Select Board holds workshop on long-term solid waste planning

The Select Board is conducting a workshop to discuss the future of solid waste management on Nantucket Island. The body is seeking guidance on waste reduction goals and the management of facilities at the Madaket Road site as the current Waste Services Agreement ends November 30, 2025.

waste-managementrecyclingenvironmentinfrastructuremadaket-road
Mon Nov 15, 2021 · 00:00

Planning Board

Planning Board to review dwelling applications and public hearings

The Planning Board is meeting to review applications for secondary, tertiary, and garage apartments. The board will also conduct public hearings for several properties and review After Neighborhood Review (ANR) filings.

zoninghousingland-usepublic-hearings
Mon Nov 15, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review property projects and zoning amendments

The Sconset Advisory Board is meeting to conduct preliminary reviews of three property projects. The board will also discuss zoning amendments specifically for the Sconset Area.

zoningland-usesconsetbuilding-permits
Mon Nov 15, 2021 · 00:00

Real Estate Assessment Committee

Committee to review land transfer for Lot 5 on Auriga and Curve Streets

The Real Estate Assessment Committee is meeting to discuss the approval and execution of documents for a Town-owned yard sale parcel. This includes a purchase and sale agreement and a release deed for a specific lot.

real-estateland-transfertown-property
Mon Nov 15, 2021 · 00:00

Real Estate Assessment Committee

Committee to review sale of Town-owned lot to IAM Investments, LLC

The Real Estate Assessment Committee is meeting to discuss the approval and execution of a purchase and sale agreement for a Town-owned parcel. The proposed sale involves a non-conforming lot to be merged with an existing residential property.

real-estateland-salezoningmunicipal-property
Fri Nov 12, 2021 · 00:00

Nantucket Water Commissioners

Water Commissioners to review PFAS projects and Harris Computer Support contract

The Nantucket Water Commissioners will review production, billing, and rainfall reports. The board will discuss updates on the Airport PFAS project and water mains west of the airport. The meeting includes a review of the Harris Computer Support contract.

water-infrastructurepfascontractssolarpublic-works
Fri Nov 12, 2021 · 00:00

Certified Local Government Commission

Town of Nantucket certified as a Local Government for historic preservation

The National Park Service has certified the Town of Nantucket as a Certified Local Government (CLG). This partnership allows the town to access expert technical advice and federal funding for historic preservation projects.

historic-preservationcertificationfederal-funding
Fri Nov 12, 2021 · 00:00

Certified Local Government Commission

Historic commissions hold joint meeting to develop preservation vision

The Historic District Commission and Nantucket Historical Commission are meeting to review their mutual roles as a Certified Local Government. The bodies will discuss a joint five-year vision and initiatives to coordinate historic preservation efforts.

historic-preservationzoninggovernment-coordinationplanning
Wed Nov 10, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss Polpis developments and record keeping

The Nantucket Cemetery Commission is meeting to approve lot sales and minutes. The body will discuss record keeping procedures, monument restoration, and updates to cemetery regulations.

cemeteriespublic-recordsland-managementregulations
Wed Nov 10, 2021 · 00:00

Select Board

Select Board reviews $23.2 million sewer pump station contract

The Select Board is meeting to approve treasury warrants and pending contracts, including a major sewer project. The board will also discuss traffic safety recommendations and funding for private road repaving in the Surfside area.

sewercontractstraffic-safetyroadstown-meeting
Wed Nov 10, 2021 · 00:00

Select Board

Select Board considers $23.3 million sewer contract and road paving funding

The Select Board is reviewing a construction agreement for a sewer pump station and discussing funding for curb-to-curb repaving of private roads near the airport. The board is also considering traffic safety recommendations regarding parking and curb cuts.

sewerroadsbudgetparkingenvironment
Tue Nov 9, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission discusses FY23 budget and surplus property at 10 Sun Island Road

The Nantucket Memorial Airport Commission is meeting to discuss the FY23 draft operating budget and the declaration of surplus property at 10 Sun Island Road. The body will also review PFAS investigation updates and propose a date for a public hearing on rates and charges.

airportbudgetreal-estateenvironmentalpublic-hearing
Remote Participation Via Zoom
Tue Nov 9, 2021 · 00:00

Historic District Commission

Historic District Commission meeting on November 9, 2021

The Historic District Commission will review various property applications including new dwellings, additions, and hardscape alterations. The agenda includes consent items, sign requests, and several categories of new and old business.

zoninghistoric-preservationhousingland-useconstruction
Tue Nov 9, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property planning and real estate acquisitions

The Nantucket Islands Land Bank Commission will meet to discuss property management and transfer business. The body will review specific property planning and a revised escrow agreement. An executive session is scheduled to discuss real estate acquisitions.

real-estateland-bankproperty-managementfinance
Tue Nov 9, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on handbooks and three donations

The Nantucket School Committee will discuss budget forecasts, COVID-19 updates, and vocational presentations. The body is scheduled to vote on school handbooks and policies regarding student activity and extracurricular accounts.

educationbudgetdonationsschool-policy
Tue Nov 9, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee discusses draft letters for the Coastal Resilience Plan

The Coastal Resilience Advisory Committee is meeting to present and discuss draft letters regarding the Coastal Resilience Plan, including a letter to the Select Board. The committee will also review a report on a presentation made to the Nantucket Planning and Economic Development Commission.

coastal-resilienceplanningenvironmentpublic-works
Tue Nov 9, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign move at 59 Milk St Ext.

The Sign Advisory Council is meeting to discuss new business. The primary item on the agenda is a request regarding a sign at 59 Milk St Ext.

signageland-usenantucket
Tue Nov 9, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss 2022 outdoor dining

The Visitor Services Advisory Committee is meeting to review reports and discuss outdoor dining for 2022 with Town Licensing Administrator Amy Baxter.

visitor-servicesoutdoor-dininglicensing
Mon Nov 8, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 20 property modification requests

The Historic Structures Advisory Board is reviewing applications for building modifications, including roof replacements, additions, and window changes. The board will also consider historic determinations for three specific properties.

historic-preservationzoningbuilding-permitsnantucket
Mon Nov 8, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to discuss fiber-optic internet and Steamship Authority project

The Nantucket Planning & Economic Development Commission will discuss high-speed internet cabling and the CRAC/CRP Plan. The body is proposing to release a TIP Amendment for public comment regarding Steamship Authority vehicle transfer bridges and gallows.

internettransportationplanningbudgetinfrastructure
Mon Nov 8, 2021 · 00:00

Nantucket Planning & Economic Development Commission

NP&EDC reviews municipal broadband and regional planning updates

The Nantucket Planning & Economic Development Commission is reviewing updates regarding municipal broadband and the Nantucket CRP. The body is also considering a proposed TIP amendment and the Monomoy Area Plan.

broadbandplanningtransportationbudgeteconomic-development
Mon Nov 8, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review seven property projects and zoning amendments

The Sconset Advisory Board will review several residential project proposals, including a new dwelling and garage. The board is also scheduled to discuss zoning amendments for the Sconset Area.

zoninghousingconstructionsconset
Fri Nov 5, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust considers $1.2 million land purchase

The Town of Nantucket Affordable Housing Trust Fund is meeting to discuss real estate acquisitions and mortgage adjustments. The body will consider a purchase agreement for vacant land and requests from Richmond Meadows Two P2A, LLC regarding mortgage releases and subordinations.

affordable-housingreal-estatemortgagesland-purchase
Fri Nov 5, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to consider mortgage releases and property purchase

The Affordable Housing Trust is meeting to review mortgage requests from Richmond Meadows Two P2A, LLC and a purchase agreement for 8 White Street. The board will also continue discussions and take action regarding Transfer Fee Strategy Funding.

affordable-housingreal-estatemortgagesproperty-purchase
Thu Nov 4, 2021 · 00:00

Select Board

Select Board to discuss collective bargaining and litigation in executive session

The Select Board and County Commissioners will meet via Zoom to conduct business in executive session. Discussions will focus on labor grievances, legal strategies regarding beach preservation, and real property at 10-12 Washington Street.

labor-relationslitigationbeach-preservationreal-estate
Thu Nov 4, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review 2021 season and field security

The commission will receive a recap of the 2021 season from Events Coordinator Marina Dzvonik. The meeting includes updates on field security and winter field preparation by the Department of Public Works.

parks-and-recreationpublic-safetymaintenance
Thu Nov 4, 2021 · 00:00

Nantucket Elementary School Council

Nantucket Elementary School Council meeting cancelled

The meeting scheduled for November 4, 2021, has been cancelled. The original agenda included a review of minutes and the SIP.

educationschool-council
Thu Nov 4, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council meeting cancelled

The meeting scheduled for November 4, 2021, was cancelled. The original agenda included reviewing grant awards and planning an awards ceremony.

cultural-councilgrantscancelled-meeting
Thu Nov 4, 2021 · 00:00

Historic District Commission

Historic District Commission to review over 70 property and construction applications

The Historic District Commission is meeting to discuss a high volume of new and old business applications for property modifications. The body will review requests ranging from small hardscape changes to the construction of new dwellings and the demolition of existing structures.

historic-preservationzoningdemolitionconstructionpublic-works
Thu Nov 4, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The meeting scheduled for November 4, 2021, was cancelled due to a lack of quorum.

proceduralcancelled-meeting
Wed Nov 3, 2021 · 00:00

Council on Aging

Council on Aging discusses senior services and federal grant implementation

The Council on Aging will review several reports regarding human services, COVID-19, and elder affairs. Discussion topics include the status of the 2021 Seniors of the Year and updates on Saltmarsh programs.

senior-servicesgrantshuman-serviceshealth
Wed Nov 3, 2021 · 00:00

Select Board

Select Board discusses town government structure and sewer projects

The Select Board will discuss the establishment of a special commission to review alternative forms of town government. The meeting also includes reviews of proposed sewer regulation revisions and several pending service contracts.

government-structuresewerwaterhousinginfrastructure
Wed Nov 3, 2021 · 00:00

Select Board

Select Board reviews sewer fee waivers and multi-million dollar infrastructure contracts

The Select Board is considering a sewer connection fee waiver for affordable housing units at the Meadows II rental community. The board is also reviewing several professional service and construction contracts for sewer and water projects.

sewerwateraffordable-housingcontractsinfrastructure
Tue Nov 2, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign move at 59 Milk St

The Sign Advisory Council is meeting to discuss new business regarding a specific property. The council will consider a request to move an existing sign.

signsland-usezoning
Tue Nov 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss budget, zoning, and property developments

The Affordable Housing Trust will meet to review applications for closing cost assistance and covenant formation. The body will also discuss the FY23 budget, transfer fee funding strategies, and specific development opportunities on Clay Street and Orange Street.

affordable-housingzoningbudgetreal-estatemunicipal-funding
Tue Nov 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review closing cost assistance and land court subdivision

The Affordable Housing Trust will discuss housing assistance applications and the FY23 budget. The body is also considering an assent to a Land Court subdivision plan for a property on Wildflower Drive.

affordable-housingzoningbudgetreal-estatesubdivision
Tue Nov 2, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to review final Coastal Resilience Plan

The Coastal Resilience Advisory Committee will receive a presentation and discuss the final Coastal Resilience Plan. This plan includes recommendations for Downtown, Brant Point, Madaket, Sconset, and other areas of Nantucket County. The body will also receive updates on related engineering and access projects.

coastal-resiliencefloodingerosioninfrastructureplanning
Tue Nov 2, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to vote on FY22 report

The board will review and vote on the FY22 HSAB report. Members will also discuss harbor health, including water quality testing and shellfish taking prohibitions in mooring fields.

shellfishwater-qualityharbor-managementenvironment
Tue Nov 2, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property modifications

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will discuss new construction, renovations, and the movement of sheds and barns across various Nantucket locations.

zoninghistoric-preservationhousingconstructionwind-energy
Tue Nov 2, 2021 · 00:00

NPEDC Work Group

NP&EDC Workgroup to discuss Area Plans and Master Plan components

The Town Area Plan Workgroup sub-committee of the NP&EDC is meeting to elect officers. The group will also discuss Area Plans and the nine components of the Master Plan.

planningmaster-planland-use
Mon Nov 1, 2021 · 00:00

Conservation Commission

Conservation Commission to discuss Siasconset Beach geotube project

The Conservation Commission is holding a joint meeting with the Select Board. The body will discuss the Siasconset Beach Preservation Fund (SBPF) geotube project at Sconset Bluff.

conservationbeach-preservationsconset-bluffinfrastructure
Mon Nov 1, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Board reviews historic renovations for properties on Fair and Orange Streets

The Historic Structures Advisory Board is reviewing renovation plans for several properties. The meeting includes discussions on mixed-use and historic renovations at specific addresses.

historic-preservationrenovationzoningbuilding-permits
Mon Nov 1, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews five renovation projects

The Historic Structures Advisory Board is meeting to discuss old business regarding five specific property renovations. The board will also address lighting provisions for the HDC general checklist.

historic-preservationrenovationzoning
Mon Nov 1, 2021 · 00:00

Select Board

Select Board and Conservation Commission to discuss Sconset Bluff geotube project

The Select Board is holding a joint meeting with the Conservation Commission. The body will discuss the Siasconset Beach Preservation Fund (SBPF) geotube project at Sconset Bluff.

conservationbeach-preservationsconset-bluff
Thu Oct 28, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss FY23 Hazard Mitigation and Natural Resources requests

The Capital Program Committee will review FY23 capital requests and outyear discussions specifically regarding Hazard Mitigation and Natural Resources. The body will also review RORI and resolve outstanding issues.

budgethazard-mitigationnatural-resourcescapital-program
Thu Oct 28, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 14 Notices of Intent

The Nantucket Conservation Commission will conduct public hearings for 14 Notices of Intent and one Amended Order of Conditions. The board will also consider Certificates of Compliance and Orders of Conditions for various properties. An executive session is scheduled to discuss litigation strategy regarding the Siasconset Beach Preservation Fund Geotextile Tube Project.

conservationpublic-hearingsland-uselitigationenvironmental-regulation
Thu Oct 28, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a high volume of applications for new dwellings, additions, and exterior renovations. The body will also discuss the Sunrise Wind Farm Project and policies regarding house moves and demolitions.

zoninghistoric-preservationdemolitionhousingwind-energy
Wed Oct 27, 2021 · 00:00

Select Board

Select Board considers noise bylaw waiver for airport water project

The Select Board is meeting to discuss town management reports and preliminary 2022 Town Meeting Warrant articles. The board will also review pending contracts and a request for a noise bylaw waiver for water infrastructure installation.

infrastructurecontractsnoise-bylawutilitiestown-meeting
Wed Oct 27, 2021 · 00:00

Commission on Disability

Commission reviews accessibility variance for 2 Chestnut Street

The Commission on Disability will review a variance request for the Hawthorne House hotel at 2 Chestnut Street. The applicant proposes a three-story addition and renovations to increase guest units from 9 to 18.

accessibilityzoninghospitalitybuilding-codes
Wed Oct 27, 2021 · 00:00

County Commission

Commission to hold public hearing on Young’s Way public highway layout

The County Commission will hold a public hearing regarding the layout of a portion of Young’s Way as a public highway and the taking of easements. The body will also consider the approval of minutes and payroll warrants.

roadspublic-hearingeasementsbudget
Wed Oct 27, 2021 · 00:00

County Commission

County Commission to consider making Young’s Way a public highway

The County Commissioners are holding a public hearing to discuss the layout of a portion of Young’s Way as a public highway. This proposal includes the taking of easements over four specific parcels of land via eminent domain to improve road connectivity and safety.

roadseminent-domainpublic-worksinfrastructure
Wed Oct 27, 2021 · 00:00

Select Board

Select Board to review 2022 Town Meeting warrant and pending contracts

The Select Board is meeting to conduct a preliminary review of 2022 Annual Town Meeting warrant articles and approve treasury warrants. The board will also consider a noise bylaw waiver for water infrastructure work and review several professional service agreements.

town-meetingcontractsinfrastructurezoningbudget
Tue Oct 26, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new dwellings

The Historic District Commission will review a large volume of applications for new dwellings, pool installations, and structural alterations. The body will also discuss a citizen article to redefine terms for pools, water features, and spas on Nantucket.

zoninghistoric-preservationhousingdemolitionwind-energy
Tue Oct 26, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various residential property alterations

The commission is reviewing several dozen applications for residential changes including additions, new dwellings, and exterior modifications. Items include roof changes, pool installations, and garage construction across multiple locations.

zoningresidentialconstructionhistoric-preservation
Tue Oct 26, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission reviews golf course reports and property management

The Commission will review monthly manager updates for Sconset Golf Course and Miacomet Golf Course. The agenda includes a Planning Board application for 23 Broad St. and an executive session regarding real estate acquisition.

golfreal-estateproperty-managementfinance
Tue Oct 26, 2021 · 00:00

Nantucket Public School Committee

Nantucket School Committee to hold workshop session

The School Committee will meet for a workshop session. The agenda includes a discussion on COVID-19 for FY’22 and a review of committee protocols and sub-committee roles.

educationcovid-19governance
Mon Oct 25, 2021 · 00:00

Planning Board

Planning Board to review secondary dwellings and public hearings

The Planning Board will discuss applications for secondary dwellings and garage apartments. The body will also hold public hearings for several property modifications and a review of the Planning Board Fee Schedule.

zoninghousingpublic-hearingsfeesland-use
Mon Oct 25, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 14 property projects

The Historic Structures Advisory Board is meeting to review new business applications for various property modifications. The board will consider requests ranging from hardscape and driveway work to new house construction and porch additions.

historic-preservationzoningbuilding-permitsnantucket
Mon Oct 25, 2021 · 00:00

Planning Board

Planning Board to hold public hearing on fee schedule

The Planning Board will review several applications for secondary dwellings and garage apartments. The meeting includes multiple After-the-Fact (ANR) plan reviews and previous plan considerations. A public hearing is scheduled regarding the board's fee schedule.

zoninghousingfeesland-usepublic-hearings
Mon Oct 25, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review garage relocation at 30 Main St

The Sconset Advisory Board will conduct a preliminary review of a project at 30 Main St. The board will also discuss zoning amendments for the Sconset Area.

zoningsconsetland-usebuilding-permits
Thu Oct 21, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review parking and speeding issues

The Traffic Safety Work Group is meeting to review specific parking and speeding concerns. The group will discuss requests regarding on-street parking and follow up on previous traffic issues.

traffic-safetyparkingroad-safety
Thu Oct 21, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review parking and speeding issues

The Traffic Safety Work Group is meeting to discuss parking restrictions on Commercial Street and Starbuck Road, as well as speeding concerns on Madaket Road.

traffic-safetyparkingspeedingroads
Thu Oct 21, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee to discuss tree removals and planting schedules

The Tree Advisory Committee is meeting to review updates on specific tree projects and plan seasonal maintenance. The body will discuss tree removals and planting activities coordinated by the Town Arborist.

treeslandscapingpublic-worksenvironment
Thu Oct 21, 2021 · 00:00

Board of Health

Board of Health to review loan requests and COVID emergency orders

The Nantucket Board of Health will discuss loan requests for wastewater system upgrades and a variance for a tight tank. The board will also hold discussions regarding PFAS-contaminated well abandonment and COVID emergency orders.

public-healthwastewatercovid-19environmental-safetyzoning
Thu Oct 21, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The meeting scheduled for October 21, 2021, was cancelled. No items were decided or discussed.

procedural
Thu Oct 21, 2021 · 00:00

Cannabis Advisory Committee

Cannabis Advisory Committee to discuss marijuana establishment types and host agreements

The Cannabis Advisory Committee will meet to elect officers and discuss the future focus of the committee. The agenda includes a review of various marijuana establishment types and host agreements under MGL c. 94G.

cannabislicensingregulationsgovernment
Thu Oct 21, 2021 · 00:00

Cyrus Peirce Middle School

Cyrus Peirce Middle School Council to discuss school improvement plan

The CPS School Council is meeting to discuss the school improvement plan and other new business.

educationschool-improvementmiddle-school
Thu Oct 21, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property applications

The Historic District Commission is reviewing several dozen applications for residential work, including new dwellings, additions, and demolitions. The agenda includes discussions on solar installations, pool construction, and various structural alterations across Nantucket.

zoninghousingconstructionhistoric-preservationsolar
Wed Oct 20, 2021 · 00:00

Nantucket Housing Authority

Nantucket Housing Authority to hold virtual meeting on October 20

The Nantucket Housing Authority scheduled a virtual meeting for October 20, 2021. The provided agenda contains only procedural information regarding meeting access and public comment.

housingprocedural
Wed Oct 20, 2021 · 00:00

Select Board

Select Board to review Sconset Bluff erosion control and tax rate shift options

The Select Board will discuss a position statement on the Sconset Bluff Erosion Control Project and review tax rate shift options. The board will also consider several contracts and a public health grant for COVID-19 contact tracing.

erosion-controltaxespublic-healthsewercontracts
Wed Oct 20, 2021 · 00:00

Select Board

Select Board to review Sconset Bluff erosion control and tax rate shift options

The Select Board is meeting to discuss a position statement on the Sconset Bluff Erosion Control Project and review tax rate shift options. The body will also consider several contracts and receive an update from the Nantucket Historical Commission.

erosion-controltaxespublic-healthcontractshistoric-preservation
Tue Oct 19, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review wall sign at 58B Main Street

The Sign Advisory Council is meeting to conduct business and hear public comment. The council will discuss a sign application for a property on Main Street.

signszoningmain-street
Tue Oct 19, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss FY23 budget and housing projects

The Affordable Housing Trust will meet to discuss the FY23 budget and allowable expenses for the Covenant Formation Assistance Program. The board will receive updates on several housing projects and the Housing Production Plan.

affordable-housingbudgetreal-estatecommunity-land-trust
Tue Oct 19, 2021 · 00:00

Community Preservation Committee

CPC reviews draft language for FY'23 articles and a $5 million bond

The Community Preservation Committee is meeting to review draft language for FY'23 articles and a five million dollar bond. The committee will also discuss procedures for returning second warrant funds to the CPC.

budgetbondscommunity-preservationpublic-funds
Tue Oct 19, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board to discuss dredging plans and harbor health

The Harbor & Shellfish Advisory Board will review reports from the Marine and Natural Resources departments. The meeting includes discussions on dredging plans to address sand in scallops and updates on water quality and shellfish prohibitions.

shellfishdredgingwater-qualityharbor-managementenvironment
Tue Oct 19, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential and commercial property changes. The body will discuss new dwellings, demolitions, solar installations, and historic renovations across the town.

zoninghistoric-preservationdemolitionsolarhousing
Tue Oct 19, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on campus food trucks and student policies

The Nantucket Public School Committee will vote on allowing independent food trucks on campus and approving seven student-related policies. The meeting includes a first quarter budget update and presentations on MCAS and the NIS Band Program.

schoolsbudgetstudent-policydonationsfood-trucks
Tue Oct 19, 2021 · 00:00

Parks and Recreation Commission

Commission reviews Parks Master Plan and playing field options

The Parks and Recreation Commission will receive presentations on campus planning and the Parks Master Plan. Members will discuss the possibility of shared playing fields with Nantucket Public Schools and review an alternative site analysis for a DPW facility.

parks-and-recreationplaying-fieldsmaster-planpublic-schoolsinfrastructure
Tue Oct 19, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission reviews $17.5 million school athletic plan

The commission is discussing campus planning and playing field improvements for Nantucket Public Schools. The meeting includes a review of the Parks Master Plan and an analysis of alternative sites for a DPW facility near Delta Playing Fields.

parks-and-recreationschool-facilitiesbudgetathletic-fieldsdpw
Tue Oct 19, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss Chapter 91 amendment and public access

The committee will discuss adding the word "recreation" to the Chapter 91 Act and a map project for public access to ponds, harbors, tidelands, and the ocean. Members will also receive updates on road and sidewalk projects and discuss roundabouts and rotaries.

roadspublic-accesssidewalkschapter-91infrastructure
Mon Oct 18, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews five property modification requests

The Historic Structures Advisory Board is meeting to review preliminary applications for property alterations. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationzoningbuilding-permitsnantucket
Mon Oct 18, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews five property modifications

The board is reviewing applications for exterior changes to five different properties. These requests include structural additions, material changes, and hardscaping.

historic-preservationzoningbuilding-permitsnantucket
Mon Oct 18, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review property projects and zoning amendments

The Sconset Advisory Board will conduct preliminary reviews for three property projects in Sconset. The board is also scheduled to discuss zoning amendments for the Sconset Area.

zoningsconsetland-useproperty-review
Fri Oct 15, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss 2022 workplan and town resources

The Nantucket Historical Commission is meeting to review administrative updates and develop its 2022 workplan. Discussions include potential projects regarding town-owned historic resources, archaeology, and the NHC bylaws.

historic-preservationgrantstown-recordsplanninginfrastructure
Thu Oct 14, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review residential permits and solar array variances

The Zoning Board of Appeals is meeting to discuss several special permits for residential construction and solar installations. The board will consider requests for swimming pools, dwelling replacements, and modifications to existing land-use permits.

zoningsolarresidentialspecial-permitsvariances
Thu Oct 14, 2021 · 00:00

Zoning Board of Appeals

Zoning Board to review driveway appeal and residential construction permits

The Zoning Board of Appeals will consider an appeal regarding a driveway violation at 40 Warren’s Landing Road. The board will also review special permit requests for residential swimming pools and the demolition and replacement of a dwelling.

zoningspecial-permitsresidential-constructionswimming-poolsdriveways
Thu Oct 14, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss FY23 Sewer Department requests

The committee will review FY23 capital requests and outyear discussions specifically for the Sewer Department. The meeting also includes a review of RORI to resolve outstanding issues.

capital-programsewerbudgetinfrastructure
Thu Oct 14, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to discuss a high volume of applications for new dwellings, demolitions, and property renovations. The body will also vote on a response to an Open Meeting Law complaint filed by the Lili Pond Neighborhood Association.

zoninghistoric-preservationdemolitionhousingsolaropen-meeting-law
Thu Oct 14, 2021 · 00:00

Nantucket Water Commissioners

Nantucket Water Commissioners to review airport PFAS project and water mains

The Nantucket Water Commissioners will meet to review production, billing, and rainfall reports. The board will receive updates on several infrastructure projects, including PFAS mitigation at the airport and water mains west of the airport.

water-infrastructurepfassolar-powerpublic-works
Thu Oct 14, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review residential permits and variance requests

The Zoning Board of Appeals will hold public hearings to decide on special permits and variances for residential properties. Discussions include requests for swimming pools, solar arrays, and the demolition or modification of existing dwellings.

zoningresidentialspecial-permitsvariancessolarhousing
Wed Oct 13, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss Polpis Cemetery lots and regulation updates

The Nantucket Cemetery Commission is meeting to review lot sales and specific inurnment details at Polpis Cemetery. The body will discuss policy for consolidating adjacent lots and updating cemetery regulations, including green burials.

cemeteriesland-useregulationspublic-works
Wed Oct 13, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee holds 2nd round deliberations on funding requests

The Community Preservation Committee is conducting second round deliberations for various funding requests. The agenda includes proposals for historic preservation, affordable housing, and open space or recreational projects.

historic-preservationaffordable-housingopen-spacegrantsbudget
Wed Oct 13, 2021 · 00:00

Select Board

Select Board to hold hearing on spa appeal for 38 Prospect St

The Select Board will conduct a public hearing regarding a Historic District Commission appeal for a spa at 38 Prospect St. The board will also consider a noise bylaw waiver request from Toscana Corp. and receive a strategic plan implementation update.

zoningpublic-hearingsnoise-bylawshistoric-districtinfrastructure
Wed Oct 13, 2021 · 00:00

Select Board

Select Board to hold public hearing on 38 Prospect St spa appeal

The Select Board will conduct a public hearing regarding a Historic District Commission disapproval for a spa at 38 Prospect St. The board will also discuss the Town Administration's strategic plan implementation and consider a noise bylaw waiver for Toscana Corp.

zoningpublic-hearingnoise-bylawstrategic-planninghistoric-district
Tue Oct 12, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee to deliberate on funding requests

The Committee is conducting first round deliberations for various funding requests. These proposals cover historic preservation, affordable housing, and open space or recreational projects.

historic-preservationaffordable-housingopen-spacebudget
Tue Oct 12, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review FY2021 annual report

The committee is meeting to adopt its fiscal year 2021 annual report and discuss coastal resilience plans. The session includes updates on specific road engineering and conservation projects and a discussion with the Nantucket Yacht Club.

coastal-resilienceinfrastructureconservationenvironmental-planning
Tue Oct 12, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on a variety of requests including new dwellings, solar panel installations, and structural demolitions.

zoninghistoric-preservationhousingsolardemolition
Tue Oct 12, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations

The Historic District Commission is reviewing a large volume of applications for residential modifications. The body will discuss new construction, solar installations, and various exterior renovations.

zoninghistoric-districtssolarhousingconstruction
Tue Oct 12, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property management and real estate acquisitions

The Nantucket Islands Land Bank Commission will review property management requests and transfer business. The meeting includes a scheduled executive session to discuss real estate acquisitions.

land-bankreal-estateproperty-managementconservationfinance
Tue Oct 12, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss 2022 outdoor dining

The Visitor Services Advisory Committee will meet to review reports and discuss outdoor dining for 2022 with Town Licensing Administrator Amy Baxter.

visitor-servicesoutdoor-dininglicensing
Tue Oct 12, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to discuss PFAS water policy and surplus property

The Nantucket Memorial Airport Commission will review updates to the PFAS related water service policy and a pending declaration of surplus property at 10 Sun Island Road. The body will also discuss the FY22 budget schedule and airport operations, including fuel supply issues.

airportenvironmentreal-estatebudgetpublic-safety
Remote Participation Via Zoom
Thu Oct 7, 2021 · 00:00

Select Board

Select Board to hold executive session on real estate and labor strategy

The Select Board/County Commissioners will meet via Zoom to conduct an executive session. The board will discuss collective bargaining strategy and several real estate transactions.

real-estatelabor-relationspolicelitigation
Thu Oct 7, 2021 · 00:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council to discuss school improvement plan

The Nantucket Intermediate School Council will meet to review communication survey results and the School Improvement Plan.

educationschool-improvementschool-council
Thu Oct 7, 2021 · 00:00

Nantucket Elementary School Council

Nantucket Elementary School Council meeting scheduled for October 7, 2021

The council will discuss the School Improvement Plan (SIP) and items for the good of the order. The meeting is scheduled to take place at the NES Library.

educationschool-improvement
Thu Oct 7, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council to discuss grant cycle marketing and awards

The Nantucket Cultural Council will meet to discuss the marketing strategy for an upcoming grant cycle. The body will also discuss the schedule for future meetings and the awards ceremony for grant recipients.

grantsarts-and-culturemarketing
Thu Oct 7, 2021 · 00:00

Historic District Commission

Historic District Commission to review Open Meeting Law complaint and property permits

The Historic District Commission will discuss and potentially vote on an Open Meeting Law complaint filed by the Lili Pond Neighborhood Association. The board will also review numerous new and old business applications for residential and commercial property modifications.

historic-districtzoningopen-meeting-lawsolarconstruction
Thu Oct 7, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple Notices of Intent

The Nantucket Conservation Commission will conduct public hearings for various Notices of Intent and requests for amended orders of conditions. The body will also discuss the issuance of Orders of Conditions for several properties. An executive session is scheduled to discuss litigation strategy regarding the Siasconse Beach Preservation Fund Geotextile Tube Project Removal Order.

conservationpublic-hearingzoninglitigationenvironment
Thu Oct 7, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The meeting scheduled for October 7, 2021, was cancelled due to a lack of quorum.

proceduralcancelled
Wed Oct 6, 2021 · 00:00

Select Board

Select Board to consider $56 million in bond sales and anticipation notes

The Select Board is meeting to review significant financing requests from the Finance Department and a presentation on long-term planning for Baxter Road. The board will also hold a continued public hearing regarding harbor and town pier regulations.

financebondsinfrastructureharbor-regulationspublic-worksfire-department
Wed Oct 6, 2021 · 00:00

Select Board

Select Board to consider over $56 million in bonds and notes

The Select Board will review requests for the sale of general obligation bonds and bond anticipation notes. The board will also hold a public hearing on harbor and town pier regulations and receive a planning summary for Baxter Road.

financebondsharborsinfrastructurepublic-worksfire-department
Wed Oct 6, 2021 · 00:00

Council on Aging

Council on Aging to discuss federal grants and senior services

The Council on Aging will meet to review reports on senior services and community programs. Discussions include federal grant funding and updates on COVID-19 impacts on human services.

seniorsfederal-grantspublic-healthhuman-services
Tue Oct 5, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous residential and sign permits

The Historic District Commission is reviewing a large volume of applications for residential renovations, new dwellings, and signage. The body is also considering historic renovations for properties on Fair Street and a relocation project on Low Beach Road.

zoninghistoric-preservationresidential-constructiondemolitionsignage
Tue Oct 5, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property and signage applications

The Historic District Commission is meeting to discuss a high volume of applications for residential renovations, new dwellings, and signage. The body will review consent items, new business, and old business regarding property modifications and demolitions.

zoninghistoric-preservationdemolitionsolarsignage
Tue Oct 5, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications for Vesper Lane and Tomahawk Lane

The Sign Advisory Council is meeting to discuss new sign applications and enforcement. The body will review requests for wall signs at two locations and one old business item regarding a wall sign on Main Street.

signszoningland-usepublic-hearings
Tue Oct 5, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on substitute pay rates and policy amendments

The Nantucket School Committee will discuss student discipline, absences, and educational opportunities for specific student populations. The body will vote on daily substitute pay rates for the 2022 fiscal year and a donation to Nantucket Elementary School.

educationschool-budgetstudent-policypersonnel-pay
Tue Oct 5, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board discusses boat Airbnb rules and shellfish dredging plans

The Harbor & Shellfish Advisory Board is meeting to prepare for a Select Board meeting regarding boat Airbnb and liveaboard regulations. The board will also discuss dredging plans to address excessive sand in scallops and review harbor water quality.

shellfishharbor-regulationswater-qualitydredgingboating
Tue Oct 5, 2021 · 00:00

Community Preservation Committee

Committee reviews funding requests for historic preservation projects

The Community Preservation Committee is meeting to discuss funding requests for four historic preservation projects. The committee will hear from representatives of the First Congregational Church, Nantucket Community Service, and the Nantucket Historical Commission.

historic-preservationgrantscommunity-preservationnantucket
Tue Oct 5, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee discusses draft Coastal Resilience Plan recommendations

The Coastal Resilience Advisory Committee is continuing a discussion on the draft Coastal Resilience Plan. The body is reviewing recommendations for specific areas of Nantucket County and initiating a discussion to select a focus for the committee's official statement on the plan.

coastal-resilienceenvironmental-planningpublic-worksnantucket
Mon Oct 4, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review shed addition at 101 Low Beach Road

The Sconset Advisory Board is meeting to conduct a preliminary review of new business. The board will discuss a specific property modification request.

zoningbuilding-permitssconset
Mon Oct 4, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review solar panels and property revisions

The Madaket Advisory Board is meeting to discuss new business items regarding two specific properties. The board will review a proposal for solar panels and a request for revisions.

solar-energyland-usemadaket
Mon Oct 4, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Board reviews historic renovation proposals for 27 and 29 Fair Street

The Historic Structures Advisory Board is reviewing historic renovation proposals for the front and back buildings of 27 and 29 Fair Street. The board will also consider several letters of concern regarding these properties. Additionally, the meeting includes reviews for a pool and hardscape at 30 Crooked Lane and a driveway replacement at 9 Cabot Lane.

historic-preservationrenovationzoningpublic-comment
Mon Oct 4, 2021 · 00:00

Council for Human Services

Council for Human Services to discuss school bullying initiative

The Council for Human Services will hold a conversation with Mike Horton from NPS regarding a school bullying initiative. The body will also elect a Chair and Vice Chair and select two representatives for the Contract Review Committee.

human-serviceseducationbullyinggovernance
Mon Oct 4, 2021 · 00:00

Historic Structures Advisory Board (HDC)

HDC reviews historic renovations for Fair Street and residential projects

The Historic Structures Advisory Board is reviewing several historic renovation applications and residential property changes. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationzoningresidential-construction
Fri Oct 1, 2021 · 00:00

Commission on Disability

Commission reviews housing variance and sidewalk restoration grant

The Commission on Disability will review a variance request for an affordable housing project and discuss a grant application for sidewalk restoration. The body will also vote on the approval of meeting minutes from April 30, 2021.

disability-accessaffordable-housingsidewalksgrant-applicationzoning-variance
Thu Sep 30, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss $5 million bonding application

The Affordable Housing Trust will meet to review a presentation and discuss the FY23 Community Preservation Committee (CPC) application. This application seeks $5,000,000 in bonding.

affordable-housingbudgetbondingcpc
Thu Sep 30, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The meeting scheduled for September 30, 2021, was cancelled. The original agenda included a review of RORI and a vehicle/equipment request for Nantucket Memorial Airport.

capital-programairportcancelled
Thu Sep 30, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews over $6.5 million in funding requests

The Committee is discussing funding allocations for historic preservation and affordable housing. Requests include support for specific residential properties and housing trust funds.

historic-preservationaffordable-housingbudgetcommunity-preservation
Thu Sep 30, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council to discuss upcoming grant cycle and awards reception

The Nantucket Cultural Council is meeting to determine dates and public notice information for its next grant cycle. Members will also delegate roles for the upcoming Awards Reception and establish a future meeting schedule.

grantsarts-and-culturepublic-notices
Thu Sep 30, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to decide on a large volume of applications for residential and commercial property changes. The body will review requests for new dwellings, pool installations, solar arrays, and demolitions across the town.

zoninghistoric-preservationdemolitionsolarhousing
Wed Sep 29, 2021 · 00:00

Select Board

Select Board to review Waitt Drive and Our Island Home contracts

The Select Board will discuss the Town Government Study Committee Report and review pending contracts. The board is also considering street blocking permit extensions for the Farmers and Artists Market.

contractsroadsgovernmentpermitspublic-works
Wed Sep 29, 2021 · 00:00

Select Board

Select Board to consider street blocking permits and government study report

The Select Board will discuss a Town Government Study Committee report and review requests for street blocking permits for the Farmers and Artists Market. The board will also consider treasury warrants and pending contracts.

permitscontractsgovernment-studypublic-worksethics
Wed Sep 29, 2021 · 00:00

Community Preservation Committee

Committee reviews funding requests for sports, farming, and historic preservation

The Community Preservation Committee is meeting to discuss funding requests for four projects. These include expansions for sports and farming facilities and preservation work for a lighthouse and art center.

community-preservationhistoric-preservationopen-spacerecreationgrants
Tue Sep 28, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications for Vesper Lane and Tomahawk Lane

The Sign Advisory Council is meeting to discuss new sign applications and one item of old business. The body will review requests for wall signs at three different properties and discuss enforcement.

signsland-usezoning
Tue Sep 28, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to review draft Coastal Resilience Plan

The Coastal Resilience Advisory Committee will receive a presentation from the CRP Project Team regarding the draft Coastal Resilience Plan. The plan includes recommendations for several specific areas of Nantucket County and general recommendations for the entire region.

coastal-resiliencefloodingerosionsea-level-riseplanning
Tue Sep 28, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to discuss and decide on a large volume of Certificates of Appropriateness for residential and commercial properties. The agenda includes requests for new dwellings, demolitions, solar panel installations, and historic renovations.

zoninghistoric-preservationsolardemolitionhousing
Tue Sep 28, 2021 · 00:00

Historic District Commission

Commission reviews proposals for 316 Polpis Road

The Historic District Commission is meeting to review applications regarding 316 Polpis Road. The items include a comprehensive application to rectify a failed inspection and an as-built retaining wall.

historic-districtbuilding-inspectionzoningnantucket
Tue Sep 28, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review golf course management and FY 2021 financials

The Nantucket Islands Land Bank Commission will discuss management services for golf courses and property use requests. The body is also scheduled to approve the FY 2021 financial statements and review grant applications for FY23.

golf-coursesfinancereal-estategrantsproperty-management
Tue Sep 28, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to receive update on Manager position

The Commission is meeting to receive an update from the Town Administration regarding the Park and Recreation Manager position.

personneladministrationparks-and-recreation
Mon Sep 27, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Board reviews historic renovations and alterations for multiple properties

The Historic Structures Advisory Board is reviewing applications for historic renovations and exterior changes. The meeting includes discussions on properties at Fair Street and various other locations across the district.

historic-preservationzoningrenovationsbuilding-permits
Mon Sep 27, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to discuss solar panels and property revisions

The Madaket Advisory Board will review two new business items regarding property work. The board will also discuss the use of in-person versus Zoom meetings.

zoningsolarhousingmadaket
Mon Sep 27, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review nine property project applications

The Sconset Advisory Board is meeting to conduct preliminary reviews of new business items. The board will discuss various property modifications, including additions, demolitions, and roof changes.

zoninghousingbuilding-permitssconset
Mon Sep 27, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential alterations and additions

The Sconset Advisory Board is reviewing several applications for residential property changes. The board will consider requests for additions, demolitions, and exterior modifications.

zoningresidentialconstructionsconset
Mon Sep 27, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 17 property renovation requests

The Historic Structures Advisory Board is meeting to review new business applications for historic renovations, alterations, and demolitions. The board will consider requests ranging from window replacements and color changes to full building renovations.

historic-preservationzoningrenovationsbuilding-permits
Thu Sep 23, 2021 · 00:00

Capital Program Committee

Capital Program Committee discusses FY23 requests and airport planning

The committee will review the September 2, 2021 minutes and discuss fiscal year 2023 capital requests. Discussion includes outyear planning for the Nantucket Memorial Airport and a review of RORI issues.

capital-budgetairportinfrastructuregovernment-operations
Thu Sep 23, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple Notices of Intent

The Nantucket Conservation Commission is meeting to conduct public hearings for several Notices of Intent and requests for Amended Orders of Conditions. The body will also review requests for Determination of Applicability and Certificates of Compliance.

conservationpublic-hearingland-useenvironmental-permits
Thu Sep 23, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new dwellings

The Historic District Commission is meeting to review a high volume of applications for property renovations, new construction, and demolitions. The body will also discuss the Sunrise Wind Farm Project and policies regarding move/demo hearings.

historic-preservationzoningdemolitionhousingwind-energy
Wed Sep 22, 2021 · 00:00

Capital Program Committee

Capital Program Committee to review FY 23 budget projections and project requests

The Capital Program Committee is attending a Select Board meeting. The discussion will focus on preliminary FY 23 General Fund Budget Projections and preliminary Capital Project Requests for FY 23.

budgetcapital-projectsfinance
Wed Sep 22, 2021 · 00:00

Finance Committee

Finance Committee to review FY 23 budget projections and capital requests

The Finance Committee is attending a Select Board meeting. The discussion will focus on preliminary FY 23 General Fund Budget projections and preliminary FY 23 Capital Project requests.

budgetcapital-projectsfinance
Wed Sep 22, 2021 · 00:00

Select Board

Select Board to review FY 2023 budget projections and capital project requests

The Select Board will review preliminary FY 2023 General Fund budget projections and capital project requests. The board is also considering several contracts and a liquor license manager change.

budgetcontractsenvironmentliquor-licensepublic-works
Wed Sep 22, 2021 · 00:00

Select Board

Select Board to review FY 2023 budget projections and capital project requests

The Select Board will review preliminary FY 2023 General Fund budget projections and capital project requests. The board is also considering a liquor license manager change for the Whaling Museum and receiving an update on the island-wide PFAS assessment.

budgetenvironmentliquor-licensecontractspublic-health
Tue Sep 21, 2021 · 00:00

Community Preservation Committee

CPC to consider 2021-2022 administrative budget and fund requisition

The Community Preservation Committee is meeting to discuss a fund requisition and the committee's administrative budget for 2021-2022. The body will also determine calendar dates for an interview session.

budgetfund-requisitionadministration
Tue Sep 21, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board discusses boat Airbnb rules and oyster lease revocation

The Harbor & Shellfish Advisory Board is meeting to prepare for upcoming Select Board reviews regarding boat Airbnb and liveaboard regulations. The board will also discuss a recommended oyster lease revocation and harbor health issues.

shellfishharbor-regulationswater-qualityzoningenvironment
Tue Sep 21, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential modifications, new dwellings, and demolitions. The body will also discuss policies regarding move/demo hearings, hardscaping, and the salvaging of demolished structures.

zoninghistoric-preservationdemolitionsolarhousing
Tue Sep 21, 2021 · 00:00

Nantucket Public School Committee

Nantucket School Committee discusses mask policies and campus master plan

The committee will discuss upcoming mask policies and COVID testing updates. The meeting also includes updates on the Campus Wide Master Plan, summer school programs, and transportation numbers.

educationhealthschool-facilitiestransportationpublic-policy
Tue Sep 21, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss road and sidewalk projects

The committee will receive updates on road projects and sidewalk repairs. Members will also discuss the need for a map regarding public access to ponds, harbors, tidelands, and the ocean.

roadssidewalkspublic-accessinfrastructurepedestrian-safety
Tue Sep 21, 2021 · 00:00

Select Board

Select Board to discuss Siasconset Beach litigation and 49 Union Street property

The Select Board and County Commissioners will meet via Zoom to hold executive sessions. Discussions will focus on legal strategies regarding beach preservation and a real property matter.

litigationreal-estatebeach-preservationexecutive-session
Tue Sep 21, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review CCAP applications and FY 2023 budget

The Affordable Housing Trust will review and potentially approve CCAP applications for two properties. The board will also discuss the FY 2023 budget and review zoning by-laws with the Planning Director.

affordable-housingzoningbudgetreal-estate
Mon Sep 20, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews cottage addition on Orange Street

The Historic Structures Advisory Board will conduct a preliminary review of a proposed cottage addition at 20 Orange Street. The board will also discuss lighting provisions for the HDC general checklist.

zoninghousinghistoric-preservation
Mon Sep 20, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to hold public hearing on Sconset Area Plan

The Nantucket Planning & Economic Development Commission will conduct a public hearing regarding the Sconset Area Plan. The body will also discuss a proposed TIP amendment for Steamship Authority vehicle transfer bridges and gallows.

planningtransportationinfrastructureeconomic-developmentpublic-hearing
Mon Sep 20, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Nantucket Planning & Economic Development Commission reviews area plans and data

The commission is meeting to review updates on the Sconset Area Plan and appointments for the Town Area Plan workgroup. The agenda includes discussions on carrying capacity concepts, census data, and a proposed TIP amendment.

planningeconomic-developmentland-usetransportation
Mon Sep 20, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews property work at Low Beach Road and Baxter Road

The Sconset Advisory Board is meeting to conduct preliminary reviews of new business items. The board will discuss proposed work for two specific properties in Sconset.

zoningdemolitionproperty-reviewsconset
Fri Sep 17, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss historic pavement and 2021 ATM topics

The Nantucket Historical Commission is meeting to review staff updates and project progress. The body will discuss a CPC grant application for historic pavement and potential actions for the 2021 Annual Town Meeting.

historic-preservationbudgetpavementaccessibilitytown-meeting
Thu Sep 16, 2021 · 00:00

Board of Health

Board of Health to review variance requests and COVID emergency order

The Nantucket Board of Health will discuss a COVID emergency order and hear appeals and variance requests. The board will also review compliance documents for a property at 115 Surfside.

public-healthzoninghousingcovid-19variances
Thu Sep 16, 2021 · 00:00

Board of Health

Board of Health reviews variance requests and non-compliance issues

The Board of Health is reviewing several property-specific applications and compliance matters. The agenda includes variance submissions and a referral regarding a non-compliant property.

health-boardvariancescompliancepermits
Thu Sep 16, 2021 · 00:00

Capital Program Committee

Capital Program Committee discusses FY23 requests and RORI review

The committee will discuss FY23 capital requests and outyear discussions for the Town Administration. The agenda also includes a review of RORI to resolve outstanding issues.

budgettown-administrationcapital-requests
Thu Sep 16, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to review applications for new dwellings, additions, and exterior modifications. The body will also discuss policies regarding demolition, salvaging, and the use of the consent agenda.

zoninghistoric-preservationhousingsolardemolition
Thu Sep 16, 2021 · 00:00

Quad-Council

Nantucket Quad-School Council to discuss busing and school improvement plans

The joint council for NHS, CPS, NIS, and NES will meet to discuss school operations. The agenda includes discussions on the bus situation and improvement plans.

educationschool-transportationschool-planning
Wed Sep 15, 2021 · 00:00

Select Board

Select Board to consider alcohol license transfer and noise bylaw waivers

The Select Board will review requests for noise bylaw waivers and a sewer permit fee waiver. The board is also considering funding for a house move to create subsidized housing and a liquor license transfer. Additionally, the board will receive an update on the school campus-wide master plan.

liquor-licensesnoise-bylawsaffordable-housingsewerschools
Wed Sep 15, 2021 · 00:00

Select Board

Select Board reviews $17.5 million school athletic master plan

The Select Board is discussing a campus-wide master plan for Nantucket Public Schools and reviewing several noise bylaw waivers. The body is also considering a liquor license transfer and funding for a subsidized housing unit.

schoolsbudgetnoise-bylawshousingliquor-license
Tue Sep 14, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee reviews stormwater and resilience plans

The committee is meeting to review stormwater management plans for Children’s Beach and the Lily Pond property. Members will also discuss the draft FY2021 annual report and provide updates on various coastal resilience projects.

coastal-resiliencestormwater-managementfloodinginfrastructureenvironment
Tue Sep 14, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to attend Baxter Road long-term planning workshop

The Coastal Resilience Advisory Committee is attending a workshop with the Select Board, town staff, and stakeholders. The meeting focuses on long-term planning for Baxter Road led by the consulting team at Arcadis.

coastal-resilienceinfrastructurebaxter-roadplanning
Tue Sep 14, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to elect officers and plan 2022 July 4th activities

The Visitor Services Advisory Committee is meeting to elect officers for the 2021-22 term and review the annual report. Members will also discuss updates for July 4th activities in 2022 and identify topics for the 2021-2022 period.

visitor-servicestourismpublic-eventsadministration
Tue Sep 14, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to hold public hearing on Chapter 203 Airport Regulations

The Nantucket Memorial Airport Commission will conduct a public hearing regarding revisions to the Town Regulation Codification of Chapter 203. The body will also discuss PFAS investigation updates and the FY23 capital projects budget.

airportregulationsbudgetpfasreal-estate
Remote Participation Via Zoom
Tue Sep 14, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a high volume of applications for residential and commercial property changes. The body will decide on a variety of requests including new dwellings, solar installations, and structural renovations.

zoninghistoric-preservationsolarhousingconstruction
Tue Sep 14, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss Fiscal Year 2022 draft budget

The Nantucket Islands Land Bank Commission will discuss property management issues and the Fiscal Year 2022 draft budget. The body will also review transfer exemptions and real estate acquisitions during an executive session.

budgetland-managementreal-estatepublic-space
Tue Sep 14, 2021 · 00:00

Select Board

Select Board holds workshop on Baxter Road long-term planning

The Select Board is conducting a workshop meeting with the Coastal Resilience Advisory Committee, town staff, and Arcadis. The session focuses on long-term planning for Baxter Road, including recommendations and adaptation pathways.

coastal-resilienceinfrastructureplanningroads
Tue Sep 14, 2021 · 00:00

Select Board

Select Board holds workshop on Baxter Road long-term planning

The Select Board is conducting a workshop with the Coastal Resilience Advisory Committee, town staff, and Arcadis. The session focuses on long-term planning and alternatives to address bluff and toe erosion along Baxter Road.

coastal-resilienceinfrastructureerosionbaxter-roadplanning
Tue Sep 14, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign requests and enforcement cases

The Sign Advisory Council is meeting to hold preliminary discussions on new sign requests and review enforcement actions. The body will also discuss a discrepancy regarding an approved wall sign.

signszoningenforcementland-use
Mon Sep 13, 2021 · 00:00

Finance Committee

Finance Committee to review FY2023 budget projections

The Finance Committee is meeting to review budget projections for fiscal year 2023. The session also includes the approval of minutes from the July 27, 2021 meeting.

budgetfinance
Mon Sep 13, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 12 property modification requests

The Historic Structures Advisory Board is reviewing a series of new business applications for property changes. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationzoningbuilding-permitsnantucket
Mon Sep 13, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 10 property modification requests

The Historic Structures Advisory Board is reviewing applications for exterior changes to residential and commercial properties. The board will consider requests ranging from new dwellings and additions to hardscaping and window updates.

historic-preservationzoningbuilding-permitshardscapinghousing
Mon Sep 13, 2021 · 00:00

Planning Board

Planning Board to review secondary dwellings and fee schedule restructure

The Planning Board will review applications for secondary, tertiary, and garage dwellings across multiple properties. The board will also hold public hearings for specific lot plans and discuss restructuring the fee schedule.

zoninghousingpublic-hearingsfees
Mon Sep 13, 2021 · 00:00

Planning Board

Planning Board to review secondary dwelling applications and land subdivisions

The Planning Board is reviewing multiple applications for secondary and tertiary dwellings. The meeting includes several After Neighborhood Review (ANR) land subdivisions and two public hearings. The board will also conduct a review of the fee schedule.

zoninghousingland-usefees
Mon Sep 13, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review 10 property alteration requests

The Sconset Advisory Board is meeting to conduct preliminary reviews of new business items. The board will discuss proposed construction and renovation projects at 10 different properties.

zoningconstructionsconsetproperty-review
Mon Sep 13, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential property modifications

The board is reviewing several applications for exterior alterations, additions, and relocations of structures. These items include changes to decks, fenestration, and garages across multiple properties.

zoningbuilding-permitsresidential-constructionsconset
Thu Sep 9, 2021 · 00:00

Select Board

Select Board to discuss real estate and litigation in executive session

The Select Board/County Commissioners will meet via Zoom to conduct an executive session. The board will discuss collective bargaining strategy, litigation regarding an off-shore wind project and a comprehensive permit, and the value or purchase of three specific properties.

real-estatelitigationcollective-bargainingwind-energypermits
Thu Sep 9, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review special permits and variances

The Zoning Board of Appeals will hold public hearings to decide on land-use requests. The board is reviewing requests for setback modifications, structure relocations, and the conversion of a studio into a dwelling.

zoningspecial-permitsvarianceshousingland-use
Thu Sep 9, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to hear requests for residential and school site modifications

The Zoning Board of Appeals will hold public hearings to decide on special permits and variances for several properties. The board will also consider a request to modify a prior permit to allow a studio to be used as a secondary dwelling.

zoningspecial-permitsvarianceshousingsolar-energy
Thu Sep 9, 2021 · 00:00

Zoning Board of Appeals

ZBA to review historic barn relocation and residential modifications

The Zoning Board of Appeals is considering requests for residential dwelling conversions and ground cover increases. The board will also determine if a historic barn relocation for an educational institution requires zoning relief.

zoningspecial-permitsground-coversetbackshousing
Thu Sep 9, 2021 · 00:00

Capital Program Committee

Capital Program Committee to review school improvements and FY23 requests

The committee will review the School Campus-wide Improvement Plan and discuss FY23 capital requests for the Water Department and Our Island Home. The meeting also includes a review of RORI to resolve outstanding issues.

capital-programschoolswater-departmentbudgetinfrastructure
Thu Sep 9, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on seven Notices of Intent

The Nantucket Conservation Commission is meeting to conduct public hearings for several Notices of Intent and Amended Orders of Conditions. The body will also review requests for determination of applicability and minor modifications for various properties.

conservationpublic-hearingzoningland-useenvironmental-permits
Thu Sep 9, 2021 · 00:00

Historic District Commission

Historic District Commission to review 45 new and 11 old business applications

The Historic District Commission is meeting to review a large volume of applications for residential and commercial alterations. The body will discuss new construction, rooftop solar installations, and historical renovations.

historic-preservationzoningsolarconstructiondemolition
Thu Sep 9, 2021 · 00:00

Nantucket Water Commissioners

Nantucket Water Commissioners to review PFAS project and solar power

The Nantucket Water Commissioners will meet to review production, billing, and rainfall reports. The board will receive updates on the Airport PFAS project and solar power at Wannacomet Water Company.

water-infrastructurepfassolar-powerpublic-works
Thu Sep 9, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review puppet show application

The Parks and Recreation Commission will meet to discuss a puppet show application and the Parks Partner Program. The body will also address security and maintenance.

parks-and-recreationpublic-eventssecuritymaintenance
Thu Sep 9, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review puppet show application

The Parks and Recreation Commission will discuss a special event permit application for a puppet show at Children's Beach. The body will also discuss the Parks Partner Program, maintenance, and security involving Neighborhood Police Officer Mack.

parks-and-recreationspecial-eventspublic-safetychildrens-beach
Wed Sep 8, 2021 · 00:00

Cemetery Commission

Nantucket Cemetery Commission discusses lot sales, Polpis updates, and green burials

The commission will review previous meeting minutes and approve recent lot sales. Discussion topics include cemetery records at Polpis and Historic Coloured Cemeteries, as well as potential regulation updates for green burials.

cemeteriesland-usepublic-recordsregulations
Wed Sep 8, 2021 · 00:00

Nantucket Housing Authority

Nantucket Housing Authority to hold public hearing on Fiscal Year 2022 Annual Plan

The Nantucket Housing Authority is inviting tenants and the public to a hearing to review the Proposed Annual Plan for Fiscal Year 2022. The plan outlines operations and plans for state-aided public housing.

housingbudgetpublic-hearinggovernment-operations
Wed Sep 8, 2021 · 00:00

Nantucket Housing Authority

Nantucket Housing Authority to hold public hearing on FY 2022 Annual Plan

The Nantucket Housing Authority will conduct a public hearing regarding its Annual Plan for Fiscal Year 2022. The board will also discuss the status of building envelope projects and funding requests for preservation work.

housingpublic-hearingbuilding-preservationbudget
Wed Sep 8, 2021 · 00:00

Select Board

Nantucket Select Board reviews contracts and historic preservation requests

The Select Board will review several pending contracts, including a $219,200 purchase for a septic pump-out boat. The meeting also includes a public hearing regarding the revocation of private shellfish aquaculture licenses.

governmentcontractsshellfishhistoric-preservationpublic-safety
Wed Sep 8, 2021 · 00:00

Select Board

Select Board discusses committee vacancies and historic preservation requests

The Select Board will review applications for a vacancy on the Roads and Right of Way Committee. The meeting also includes discussions on historic preservation restrictions, conservation restrictions, and a public hearing regarding shellfish aquaculture licenses.

zoninggovernmentenvironmentmaritimepreservation
Tue Sep 7, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board discusses oyster lease revocation and boat rental regulations

The Harbor & Shellfish Advisory Board is meeting to prepare for upcoming Select Board reviews regarding oyster lease revocations and boat Airbnb and liveaboard regulations. The board will also discuss dredging plans for scallops and harbor water quality.

shellfishboatingwater-qualityharbor-managementenvironmental-regulations
Tue Sep 7, 2021 · 00:00

Nantucket Public School Committee

School Committee to review budget planning and authorize student activity accounts

The Nantucket School Committee will discuss budget directives, enrollment, and the budget planning calendar. The body will also review financial reports regarding food services and substitute pay rates.

educationbudgetschool-financestudent-accounts
Tue Sep 7, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential and commercial modifications. The body will decide on new dwellings, additions, and rooftop solar installations, as well as discuss policies regarding demolition and hardscaping.

zoninghistoric-preservationhousingsolardemolition
Sat Sep 4, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to hear from state legislative liaison

The committee will host Mary Grace Mofsen, Legislative Liaison to State Representative Dylan Fernandes, as a guest speaker. Members will also follow up on noise bylaw revisions and the use of Zoom for meetings.

legislative-affairsnoise-bylawspublic-meetings
Thu Sep 2, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss FY23 requests for Police and Marine

The Capital Program Committee is meeting to discuss FY23 capital requests and outyear planning for the Police and Marine departments. The committee may also approve minutes from August 19 and 26, 2021.

budgetpolicemarinecapital-planning
Thu Sep 2, 2021 · 00:00

Conservation Commission

Conservation Commission to discuss enforcement action at Baxter Road

The Nantucket Conservation Commission is meeting via remote participation. The body will hear public comment and receive an update on an enforcement action.

conservationenforcementsiasconset
Thu Sep 2, 2021 · 00:00

Historic District Commission

Historic District Commission to review over 70 property modification requests

The Historic District Commission is meeting to discuss and decide on a large volume of new and old business applications for residential and commercial property changes. The body will also review policies regarding demolition, salvaging, and the consent agenda for new dwellings.

zoninghistoric-preservationsolardemolitionhousing
Thu Sep 2, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss Miacomet golf business

The Nantucket Islands Land Bank Commission will meet to discuss golf course tee time business regarding Miacomet. The meeting is scheduled for September 2, 2021, via Zoom.

golfland-usemiacomet
Thu Sep 2, 2021 · 00:00

Nantucket Planning & Economic Development Commission

By-Law Committee to review and evaluate NP&EDC By-Laws

The By-Law Committee of the Nantucket Planning & Economic Development Commission is meeting to review the most recent version of its by-laws. The committee will discuss proposed amendments to recommend to the NP&EDC.

governmentbylawsplanningeconomic-development
Wed Sep 1, 2021 · 00:00

Council on Aging

Council on Aging discusses senior programs and federal grant status

The Council on Aging will review various senior services, including Title IIIB federal grant applications and Saltmarsh programs. Discussion topics also include an upcoming Adult Health Fair and a luncheon to honor the 2021 Seniors of the Year.

senior-serviceshealthgrantscommunity-events
Tue Aug 31, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to discuss and decide on a large volume of applications for residential and commercial property changes. These include requests for new dwellings, pool installations, and rooftop solar arrays.

zoninghistoric-preservationsolarhousingconstruction
Mon Aug 30, 2021 · 00:00

Historic Structures Advisory Board (HDC)

HDC reviews demolition and construction requests for multiple properties

The Historic Structures Advisory Board is reviewing several new business applications for property alterations. These include requests for demolitions, new dwellings, and renovations across various residential and commercial sites.

historic-preservationdemolitionzoningsolarrenovation
Mon Aug 30, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews demolition and renovation requests

The board is reviewing applications for property alterations, including demolitions and new construction. The meeting covers residential and commercial projects across various Nantucket locations.

historic-preservationdemolitionzoningsolarrenovation
Mon Aug 30, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews two property projects

The Madaket Advisory Board is meeting to discuss new business regarding two specific property projects. The board will also discuss whether to hold future meetings in-person or via Zoom.

land-usehousingmadaketzoning
Mon Aug 30, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews partial demolition and addition at 31 Low Beach Road

The Sconset Advisory Board is meeting to conduct a preliminary review of a property proposal. The board will discuss a request for partial demolition and an addition at a specific residence.

zoningdemolitionhousingsconset
Thu Aug 26, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss Fire Department FY23 capital requests

The Capital Program Committee is meeting to discuss FY23 capital requests and outyear planning specifically for the Fire Department. Other agenda items are procedural.

capital-programfire-departmentbudgetplanning
Thu Aug 26, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple Notices of Intent

The Nantucket Conservation Commission is meeting to conduct public hearings on several Notices of Intent and requests for Amended Orders of Conditions. The body will also consider Certificates of Compliance and the issuance of Orders of Conditions for various properties.

conservationland-usepublic-hearingenvironmental-permits
Thu Aug 26, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various property applications and renovations

The Historic District Commission is reviewing numerous applications for residential additions, new dwellings, pools, and structural changes. The agenda includes items for consent, new business, and old business regarding various properties across Nantucket.

zoninghistoric-preservationresidentialconstruction
Tue Aug 24, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss funding for 46 Okorwaw House Move

The Affordable Housing Trust will review funding requests and project updates. The body will discuss the FY 2023 budget request to the Town of Nantucket and a Community Preservation Committee application.

affordable-housingbudgetreal-estatecommunity-land-trust
Tue Aug 24, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to review Coastal Resilience Plan project updates

The Coastal Resilience Advisory Committee will discuss a previous presentation by Arcadis regarding downtown, Madaket, and Nantucket Harbor. Project Manager Trevor Johnson will provide updates on resilience guidance for private property owners, erosion management, and governance recommendations.

coastal-resilienceerosion-managementenvironmental-planninggovernance
Tue Aug 24, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to review applications for new dwellings, demolitions, and property modifications. The body will decide on a wide range of requests including pool installations, garage construction, and window replacements across the district.

zoninghistoric-preservationdemolitionhousinglandscaping
Tue Aug 24, 2021 · 00:00

Historic District Commission

Historic District Commission reviews dwelling and structure applications

The Historic District Commission is reviewing several applications for new construction, renovations, and demolitions. The body will consider requests for new dwellings, pools, and garages at various properties.

zoninghistoric-districtconstructionresidential
Tue Aug 24, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review golf course management and FY2022 draft budget

The Nantucket Islands Land Bank Commission will discuss management services and reviews for the Sconset and Miacomet golf courses. The body will also review the Fiscal Year 2022 draft budget and property improvements at 101 Hummock Pond Rd. An executive session is scheduled to discuss real estate acquisitions.

golf-coursesbudgetreal-estateproperty-managementpublic-lands
Mon Aug 23, 2021 · 00:00

Historic Structures Advisory Board (HDC)

HDC reviews demolition and construction requests for 11 properties

The Historic Structures Advisory Board is reviewing new business applications for property alterations, including a cottage demolition and new dwelling. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationdemolitionconstructionzoning
Mon Aug 23, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential alterations

The board is reviewing applications for structural changes and repairs to several properties. These items include window replacements, door additions, and roof modifications.

historic-preservationzoningbuilding-permitsresidential
Fri Aug 20, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss preservation projects and grants

The commission will review the annual report and provide updates on the MHC Survey Project and the Arthur Cooper monument unveiling. Members will discuss CPC Grants and a Historic Preservation Tax Credit application for 2 Mayflower Circle.

historic-preservationgrantstax-creditsmonumentsplanning
Fri Aug 20, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss sewer project and preservation grants

The commission is meeting to review updates on the MHC Survey Project and the Sewer Force Main #3 project. Members will also discuss potential targets for Community Preservation Act (CPA) grants and a joint meeting with the HDC regarding 2 Mayflower Circle.

historic-preservationinfrastructuregrantszoningpublic-works
Thu Aug 19, 2021 · 00:00

Select Board

Select Board discusses municipal facilities strategy and DPW site options

The Select Board is reviewing a Facilities Master Plan to consolidate municipal offices, including a potential new building at 2 Fairgrounds Road. The meeting also includes a presentation on potential sites for a new consolidated Department of Public Works (DPW) facility.

government-operationsmunicipal-facilitiespublic-workszoninginfrastructure
Thu Aug 19, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review crosswalks and signage requests

The Traffic Safety Work Group is meeting to review several requests for new pedestrian safety measures and parking changes. The group will discuss the installation of crosswalks and signage at specific intersections and streets.

traffic-safetycrosswalksparkingsignageroads
Thu Aug 19, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group reviews crosswalks, signage, and driveway access

The Traffic Safety Work Group is reviewing several requests regarding pedestrian safety and street access. Items include potential new crosswalks at specific intersections and the installation of 'slow children' signage on Farmer Street.

trafficpedestrian safetyzoningparkingpublic works
Thu Aug 19, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review applications for new dwellings, demolitions, and property modifications. The body will decide on a variety of consent items and new business requests, as well as discuss policies regarding demoed house salvaging and advisory board reviews.

zoninghistoric-preservationdemolitionhousingland-use
Thu Aug 19, 2021 · 00:00

Historic District Commission

No meeting agenda is available for the August 19, 2021, meeting

The provided record contains no specific agenda items or descriptions of proposed actions. The document notes that there is no agenda available and directs readers to view the minutes.

procedural
Thu Aug 19, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on District Improvement Plan Year 3

The Nantucket Public School Committee will discuss COVID protocols, hiring, and projected enrollment. The body is scheduled to vote on the District Goals and District Improvement Plan Year 3, as well as several donations.

educationschool-budgetcovid-19district-planning
Thu Aug 19, 2021 · 00:00

Select Board

Select Board to hold Facilities Master Plan workshop

The Select Board will conduct a workshop regarding the Facilities Master Plan. The meeting is scheduled for August 19, 2021.

facilitiesgovernment-operations
Thu Aug 19, 2021 · 00:00

Board of Health

Board of Health to review septic variances and COVID emergency orders

The Board of Health will discuss a COVID Emergency Order and establish direction on well-to-septic variances in Madaket. The board is also reviewing several variance requests for residential and commercial properties.

public-healthseptic-systemszoning-variancescovid-19tobacco-regulation
Thu Aug 19, 2021 · 00:00

Board of Health

Board of Health reviews septic plans and variance requests

The Board of Health is reviewing septic system designs and variance applications for several properties. The meeting also addresses regulatory violations regarding tobacco and specific property notices.

public-healthseptic-systemsvariancesregulatory-enforcement
Thu Aug 19, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss FY23 School and IT requests

The Capital Program Committee is meeting to discuss FY23 capital requests and outyear planning. The discussion will specifically focus on School and Information Technology requests.

budgetschoolsinformation-technologycapital-planning
Thu Aug 19, 2021 · 00:00

Council on Aging

Planning for senior flu shot clinic and health information distribution

The Senior Flu Shot Clinic Subcommittee will discuss planning for a flu shot clinic and the distribution of health information for Nantucket seniors. Representatives from Nantucket Cottage Hospital, Nantucket Center for Elder Affairs, and the Council on Aging are expected to participate.

healthseniorspublic-healthnantucket
Wed Aug 18, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss lot consolidation and green burials

The Nantucket Cemetery Commission will meet to discuss administrative changes and the consolidation of two adjacent lots at Polpis. The body will also review developments regarding the Quaise Monument and green burial options.

cemeteriesland-usepublic-worksgreen-burials
Wed Aug 18, 2021 · 00:00

Select Board

Select Board to consider land taking on North Road and multiple utility petitions

The Select Board will hold public hearings regarding the acquisition of portions of North Road in Siasconset and several utility petitions for underground cabling. The board will also review various grant agreements and professional service contracts.

zoningutilitieshousingpublic-worksbudget
Wed Aug 18, 2021 · 00:00

Select Board

Select Board to hold public hearings on land acquisition and utility projects

The Select Board will conduct public hearings regarding the taking of portions of North Road and several utility petitions for underground cabling. The board will also review appointments for multiple town committees and discuss the location of a new Our Island Home facility.

zoningpublic-worksutilitiesappointmentssewerpublic-hearings
Tue Aug 17, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review FY2021 annual report

The committee is meeting to discuss a draft of the fiscal year 2021 annual report and Arcadis' role following the delivery of the Coastal Resilience Plan. Members will also receive updates on several coastal infrastructure and resilience projects.

coastal-resilienceinfrastructureenvironmentplanning
Tue Aug 17, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews fund requisitions

The Community Preservation Committee is meeting to review several fund requisitions for local organizations. The approval of the 2021-2022 budget has been deferred to September.

budgetgrantshousingcommunity-preservation
Tue Aug 17, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential and commercial modifications. The body will discuss new dwellings, pool installations, and structural changes across various Nantucket properties.

zoninghistoric-preservationhousingconstructionsigns
Tue Aug 17, 2021 · 00:00

Historic District Commission

Historic District Commission reviews five property modification requests

The Commission is reviewing applications for alterations to residential and commercial properties. The items include requests for solar installations, new construction, and exterior modifications.

historic-districtzoningsolarconstruction
Tue Aug 17, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss DPW reorganization

The committee is meeting to discuss the implications of the Department of Public Works reorganization. The body will also review road and sidewalk projects.

roadssidewalksdpwinfrastructurepublic-works
Tue Aug 17, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign requests for five properties

The Sign Advisory Council is meeting to discuss new business regarding sign changes and installations. The council will review requests for projecting, free-standing, and general sign updates at various locations.

signszoningland-use
Mon Aug 16, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews dwelling and hardscape projects

The Historic Structures Advisory Board is meeting to review old and new business regarding property modifications. The board will discuss specific projects including new dwellings, hardscaping, and structural additions.

historic-preservationzoninghousinghardscape
Mon Aug 16, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews property alterations and new construction

The board is reviewing old and new business regarding structural changes to residential properties. This includes discussions on dwellings, garages, and hardscape modifications.

historic-preservationzoningresidential-constructionhardscape
Mon Aug 16, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review five property projects

The Sconset Advisory Board is meeting to conduct preliminary reviews of five specific property requests. These items include a new dwelling and various revisions to fenestration and sash colors.

zoninghousingbuilding-permitssconset
Mon Aug 16, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review four residential property applications

The board is reviewing a viewpack of applications for residential projects in Sconset. The meeting focuses on proposals for a new dwelling and various renovations.

zoningresidentialsconsetbuilding-permits
Fri Aug 13, 2021 · 00:00

Board of Health

Nantucket Board of Health meeting cancelled

The Board of Health meeting scheduled for August 13, 2021, has been cancelled.

healthcancelled-meeting
Thu Aug 12, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review special permits and variance requests

The Zoning Board of Appeals is meeting to hold public hearings and take votes on several property modifications. The board will consider requests for special permits to alter dwellings and outdoor spaces, as well as variance relief for solar arrays.

zoningsolarpublic-hearingsvariancesspecial-permits
Thu Aug 12, 2021 · 00:00

Zoning Board of Appeals

ZBA to hear appeals and variance requests for residential and solar projects

The Zoning Board of Appeals will consider several special permits and variance requests. Key items include a request to make a seasonal deck permanent and two requests to validate solar arrays built within setbacks.

zoningsolarspecial-permitsvariancesresidential
Thu Aug 12, 2021 · 00:00

Board of Health

Nantucket Board of Health to discuss emergency order

The Nantucket Board of Health is meeting to discuss an emergency order. The meeting is being conducted via remote participation.

public-healthemergency-order
Thu Aug 12, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss 2021 and 2023 capital projects

The committee is meeting to elect officers and assign liaisons for the FY24-cycle. Members will discuss updates on 2021 Annual Town Meeting Capital Appropriations and Fiscal Year 2023 Capital Projects.

budgetcapital-projectstown-administration
Thu Aug 12, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 12 Notice of Intent applications

The Nantucket Conservation Commission will conduct public hearings for various Notices of Intent and requests for amended orders of conditions. The body will also review certificates of compliance and minor modifications for several properties. An executive session is scheduled to discuss litigation strategy regarding the Siasconset Beach Preservation Fund Geotextile Tube Project.

conservationpublic-hearingszoninglitigationenvironmental-protection
Thu Aug 12, 2021 · 00:00

Council on Aging

Council on Aging plans senior flu shot clinic

The Council on Aging Senior Flu Shot Clinic Subcommittee is meeting to discuss and plan a flu shot clinic. The meeting includes planning for the distribution of health information for Nantucket seniors.

public-healthseniorshealthcare
Thu Aug 12, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to discuss and decide on applications for new dwellings, additions, and exterior modifications. The agenda includes a high volume of requests for pools, hardscaping, and historic determinations.

historic-preservationzoningresidential-constructionland-use
Thu Aug 12, 2021 · 00:00

Nantucket Water Commissioners

Water Commissioners to review airport PFAS project and solar power

The Nantucket Water Commissioners will meet to review production, billing, and rainfall reports. The board will discuss updates regarding the airport PFAS project and solar power at Wannacomet Water Company.

water-infrastructuresolar-powerpfaspublic-utilities
Thu Aug 12, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission meeting on August 12, 2021

The Commission will conduct an election of new officers and discuss several community programs. Topics include a donation from the Nantucket Softball League and updates regarding Children's Beach and the Nantucket Island Fair.

parksrecreationcommunityeventsgovernment
Wed Aug 11, 2021 · 00:00

Cemetery Commission

Nantucket Cemetery Commission meeting cancelled

The Nantucket Cemetery Commission meeting scheduled for August 11, 2021, has been cancelled.

cemeterygovernment-administration
Wed Aug 11, 2021 · 00:00

Conservation Commission

Conservation Commission meeting on August 11, 2021

The Nantucket Conservation Commission will hold a public meeting via Zoom. The agenda includes a public comment period and an update regarding enforcement action for the Siasconset Beach Preservation Fund at 87-105 Baxter Road.

conservationenforcementbeaches
Wed Aug 11, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission discusses golf course master plans and renovations

The Commission will meet to discuss business regarding local golf courses. Discussions include a master plan presentation for Sconset Golf Course and a discussion on renovation and expansion for the Miacomet Golf Course driving range.

golfland-userecreationsconsetmiacomet
Wed Aug 11, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission reviews Waterline construction update

The Service and Public Relations Subcommittee will hear a presentation from Richard Lasdin, P.E., regarding the Waterline construction update. The meeting includes a period for questions and comments from Waterline abutters, Tier 1 participants, and PFAS impacted residents.

airportconstructionwaterlinepublic-comment
Remote Participation Via Zoom
Tue Aug 10, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee discusses draft resilience strategies for Downtown, Harbor, and Madaket

The Coastal Resilience Advisory Committee is reviewing updates to the Coastal Resilience Plan, including risk tiers and sea level rise data. The body is discussing draft strategies for specific areas and reviewing related engineering and conservation projects.

coastal-resilienceclimate-changeinfrastructureplanningenvironment
Tue Aug 10, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential and commercial modifications. The body will decide on a variety of new dwellings, pool installations, and historic structure alterations.

zoninghistoric-preservationhousingconstruction
Tue Aug 10, 2021 · 00:00

Select Board

Select Board to hold workshop on large-scale events

The Select Board is meeting to conduct a workshop regarding large-scale events. No other decisions or discussions are listed on the agenda.

eventspublic-safetyplanning
Tue Aug 10, 2021 · 00:00

Select Board

Select Board to hold workshop on large-scale events

The Select Board will conduct a workshop regarding large-scale events. The meeting includes a call to order and an adjournment.

public-safetyeventsgovernment-administration
Tue Aug 10, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to hold large-scale events workshop

The Visitor Services Advisory Committee is meeting to conduct a workshop regarding large-scale events. No other specific decisions or proposals are listed on the agenda.

visitor-serviceseventstourism
Tue Aug 10, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission discusses FAA grants, PFAS investigation, and airport regulations

The Commission will review meeting minutes, warrants, and a $317,697 FAA grant award. Discussion includes updates on the PFAS investigation and a proposed public hearing for updating airport regulations.

airportfinanceenvironmentregulationslegal
Remote Participation Via Zoom
Tue Aug 10, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 10 property renovation and construction projects

The Commission is reviewing applications for renovations, new dwellings, and exterior additions. The meeting covers a variety of residential projects including pools, cabanas, and window replacements.

historic-districtzoningrenovationsconstructionhousing
Tue Aug 10, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property management and real estate acquisitions

The Nantucket Islands Land Bank Commission will meet to review property management updates and transfer business. The commission will also enter an executive session to discuss real estate acquisitions.

real-estateproperty-managementland-bankfinance
Mon Aug 9, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 11 property projects

The Historic Structures Advisory Board is meeting to discuss old and new business regarding property modifications. The board will review requests for new dwellings, additions, and demolitions across various Nantucket addresses.

historic-preservationdemolitionzoningconstruction
Mon Aug 9, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential construction and demolition

The board is reviewing several applications for new dwellings, additions, and shed modifications. The meeting includes requests for demolition and new construction at multiple residential addresses.

historic-preservationzoningresidential-constructiondemolition
Mon Aug 9, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review hardscape work at 14 Starbuck Road

The Madaket Advisory Board is meeting to discuss new business and procedural items. The board will review a proposal for spa hardscape work at a specific residential property.

land-usemadakethardscape
Mon Aug 9, 2021 · 00:00

Planning Board

Planning Board to review dwelling applications and subdivision plans

The Planning Board will discuss applications for secondary, tertiary, and garage dwellings. The meeting includes reviews of After Neighborhood Record (ANR) plans and several public hearings regarding property developments.

zoninghousingsubdivisionspublic-hearingsland-use
Mon Aug 9, 2021 · 00:00

Planning Board

Planning Board to review dwelling applications and land subdivisions

The Planning Board is reviewing applications for secondary, tertiary, and garage dwellings. The board will also consider several After-the-Fact (ANR) plans and hold public hearings for specific properties. Draft article concepts for the 2022 Annual Town Meeting are listed under other business.

zoninghousingland-usepublic-hearingssubdivisions
Mon Aug 9, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews five property development projects

The Sconset Advisory Board is meeting to conduct preliminary reviews of several residential projects. The board will discuss proposals for new dwellings, an addition, and pool installations.

zoninghousingsconsetdevelopment
Mon Aug 9, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review five residential project applications

The Sconset Advisory Board is reviewing applications for new dwellings, additions, and pools. The board will consider specific plans for five different residential properties.

zoningresidential-constructionsconsetbuilding-permits
Sat Aug 7, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to hear from DEI Officer

The committee will host guest speaker Kimal McCarthy, the Diversity, Equity and Inclusion Officer. Members will also follow up on noise bylaw revisions and the use of Zoom for meetings.

diversity-equity-inclusionnoise-bylawspublic-meetings
Fri Aug 6, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission Grant Subcommittee meets August 6, 2021

The subcommittee will discuss CPC Grants and potential targets for preservation. Members will also discuss possible grant applications for fiscal years 2022 or 2023.

grantspreservationgovernment-funding
Thu Aug 5, 2021 · 00:00

Board of Health

Board of Health to review mask and occupancy emergency order

The Nantucket Board of Health will meet to review Emergency Order 16 regarding mask mandates and occupancy restrictions. The board will also discuss member updates and concerns.

public-healthmasksemergency-orders
Thu Aug 5, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on a variety of requests including new dwellings, additions, and hardscaping projects across the island.

zoninghistoric-preservationhousingconstructionland-use
Thu Aug 5, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property modifications and additions

The commission is reviewing a series of consent items for property alterations. These include requests for additions, solar arrays, and exterior changes across various residential locations.

historic-districtzoningsolarconstructionresidential
Thu Aug 5, 2021 · 00:00

Select Board

Select Board to discuss litigation and real property acquisitions

The Select Board and County Commissioners will meet via Zoom to hold an executive session. The body will discuss legal strategies regarding beach preservation and geotube projects, as well as the value or purchase of specific real properties.

litigationreal-estatebeach-preservationexecutive-session
Wed Aug 4, 2021 · 00:00

Council on Aging

Council on Aging to elect officers and review federal grant status

The Council on Aging will hold elections for chair, vice chair, and secretary. The body will also discuss the status of Title IIIB federal grant applications and various senior programming updates.

seniorsgrantspublic-healthgovernment-administration
Wed Aug 4, 2021 · 00:00

Select Board

Select Board to consider Jetties Beach Concession lease and mobile food unit application

The Select Board will review several professional service contracts, budget reports for water and sewer funds, and traffic safety recommendations. The board is also holding a public hearing for a new mobile food unit and considering a five-year lease for the Jetties Beach Concession.

contractszoningbudgetpublic-healthroadsleasing
Wed Aug 4, 2021 · 00:00

Select Board

Select Board to hold public hearing on new mobile food unit application

The Select Board is meeting to review budget reports, approve warrants and contracts, and consider a mobile food unit application. The board will also discuss traffic safety recommendations and the conveyance of surplus property.

zoningbudgettraffic-safetypublic-healthcontracts
Tue Aug 3, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board to vote on letter regarding weed killer use at downtown Stop & Shop parking lot

The Harbor & Shellfish Advisory Board will review reports from the Marine and Natural Resources departments. The board is discussing harbor health, boat regulations, and shellfish permits.

shellfishharbor-managementwater-qualityboating-regulationsenvironment
Tue Aug 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations and new builds

The Historic District Commission is meeting to review applications for new dwellings, demolitions, and exterior modifications. The body will consider a high volume of requests ranging from residential additions and pools to commercial signage and historic determinations.

zoninghistoric-preservationconstructionsignagehousing
Tue Aug 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various residential property applications

The commission will review several applications regarding residential additions, demolitions, and exterior modifications. These items include garage constructions, window replacements, and hardscape revisions across multiple locations.

zoningresidentialconstructionhistoric-preservation
Tue Aug 3, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review golf course operations and property management

The Nantucket Islands Land Bank Commission will review monthly reports for Sconset and Miacomet golf courses and discuss property management for specific sites. The body will also address financial warrants and real estate acquisitions in executive session.

golf-coursesproperty-managementreal-estatefinancebeach-access
Tue Aug 3, 2021 · 00:00

Nantucket Public School Committee

School Committee to discuss 2021-2022 District Improvement Plan

The Nantucket School Committee will meet for a workshop session. The primary focus of the meeting is the District Improvement Plan and goals for the 2021-2022 period.

educationschool-planningdistrict-goals
Tue Aug 3, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review six sign applications

The Sign Advisory Council will meet to discuss new business regarding sign installations and changes at six different properties. The council will also address enforcement matters.

signageland-usezoningpublic-hearings
Tue Aug 3, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews six sign applications

The Sign Advisory Council is reviewing applications for various signs at six different locations. The body will consider requests for free-standing, wall, and projecting signs, as well as one sign change.

signszoningland-use
Mon Aug 2, 2021 · 00:00

Council for Human Services

Council for Human Services meeting on August 2, 2021

The Council will discuss a school bullying initiative with Mike Horton from NPS and receive an update from the Director of Human Services. The agenda also includes approval of previous minutes and a discussion regarding rescheduling the next meeting.

educationhuman-servicesschool-safety
Mon Aug 2, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews three property additions and alterations

The Historic Structures Advisory Board is meeting to conduct preliminary reviews and discuss old business regarding specific property modifications. The board will also address lighting provisions for the HDC general checklist.

historic-preservationzoningbuilding-permitsnantucket
Mon Aug 2, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews new dwelling and pool proposals

The Sconset Advisory Board is meeting to review several property projects. The board will discuss proposals for new dwellings, a pool and hardscape, and building additions.

zoninghousingconstructionsconset
Mon Aug 2, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews dwelling and addition proposals

The board is reviewing applications for new construction and additions at three different properties. The meeting includes new business and old business items from July and August 2021.

zoninghousingconstructionsconset
Fri Jul 30, 2021 · 00:00

Nantucket Historical Commission

NHC to review Sewer Force Main #3 plans and 6 Gull Island Lane tax credit

The Nantucket Historical Commission is holding a special meeting to review design plans and a historic tax credit application. The body will discuss infrastructure and property-specific preservation items.

historic-preservationsewertax-creditsinfrastructure
Thu Jul 29, 2021 · 00:00

Cyrus Peirce Middle School

CPS School Council reviews district vision and school improvement plan

The CPS School Council is meeting to review the district's new vision, mission, and core values. The body will also discuss the School Improvement Plan and updates regarding hiring.

educationschool-policydistrict-planninghiring
Thu Jul 29, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential and commercial projects

The Historic District Commission is meeting to discuss a large volume of new and old business applications. The body will review requests for new dwellings, additions, and hardscaping across various Nantucket properties.

zoninghistoric-preservationresidential-constructioncommercial-developmenthardscaping
Tue Jul 27, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to discuss preliminary countywide coastal adaptation framework

The Coastal Resilience Advisory Committee is meeting to receive a project update and discuss a preliminary long-term coastal adaptation framework. The body will also review updates on several concurrent resilience projects.

coastal-resilienceinfrastructureenvironmentplanning
Tue Jul 27, 2021 · 00:00

Finance Committee

Finance Committee to receive Affordable Housing Trust Fund update

The Finance Committee is meeting to review committee reports and receive an update on the Affordable Housing Trust Fund. The meeting also includes the approval of minutes from July 13, 2021.

financeaffordable-housingbudget
Tue Jul 27, 2021 · 00:00

Finance Committee

Finance Committee reviews affordable housing funding and project pipelines

The committee is discussing funding articles from the 2021 Annual Town Meeting for the Affordable Housing Trust. The session covers current expenditures, proposed appropriations for operations and construction, and future housing projects.

affordable-housingbudgetbondingzoningtown-meeting
Tue Jul 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various property applications

The Historic District Commission will review multiple property applications including new dwellings, additions, and renovations. The agenda includes public hearings for book amendments and discussions on residential and commercial projects across Nantucket.

zoninghousingconstructionhistoric-preservationland-use
Tue Jul 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 13 property modification requests

The Commission is reviewing applications for exterior revisions, solar installations, and additions at various residential properties. The meeting focuses on ensuring these changes comply with historic district standards.

historic-districtzoningsolarresidential-construction
Tue Jul 27, 2021 · 00:00

Nantucket Islands Land Bank Commission

Nantucket Islands Land Bank Commission meeting cancelled

The meeting scheduled for July 27, 2021, was cancelled. No other business was listed on the agenda.

proceduralland-bank
Tue Jul 27, 2021 · 00:00

Visitor Services Advisory Committee

Committee discusses impact of large island events on Town resources

The Visitor Services Advisory Committee is meeting to continue a discussion regarding the scheduling of large island events. The committee will consult with Town Public Safety officials about how these events impact Town resources.

visitor-servicespublic-safetyevent-planningtown-resources
Mon Jul 26, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential and commercial alterations

The Historic Structures Advisory Board is meeting to review preliminary and ongoing applications for property alterations. The board will consider requests ranging from new dwellings and foundations to window replacements and fence installations.

historic-preservationzoningbuilding-permitsnantucket
Mon Jul 26, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews various property alterations

The Historic Structures Advisory Board is reviewing several pending applications for property changes. These include additions, window replacements, and hardscape revisions across multiple locations.

zoninghistoric-preservationresidentialconstruction
Mon Jul 26, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review staircase work at 23 Starbuck Road

The Madaket Advisory Board will meet to discuss new business regarding a specific property project. The board will also approve minutes from June 2021 and discuss its future meeting schedule.

zoningland-usemadaket
Mon Jul 26, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews several residential construction projects

The Sconset Advisory Board will conduct a preliminary review of multiple new business items. These include proposals for new houses, additions, fences, and garage modifications at various local addresses.

zoningresidentialconstructionsconset
Mon Jul 26, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews multiple residential property applications

The Sconset Advisory Board (HDC) is reviewing several requests for residential modifications and additions. These items include window replacements, fence installations, and various structural changes to existing homes.

zoningresidentialconstructionsconset
Sat Jul 24, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers meeting on July 24, 2021

The committee will meet via Zoom to discuss various town topics and follow up on previous items. The agenda includes a guest speaker, Sarah Alger, the Town Moderator.

governmenttown-moderatornoise-bylawenergytransportation
Thu Jul 22, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple Notices of Intent

The Nantucket Conservation Commission will conduct public hearings for several Notices of Intent and Requests for Determination. The body will also review Certificates of Compliance and discuss the issuance of Orders of Conditions for various properties.

conservationpublic-hearingland-useenvironmental-regulation
Thu Jul 22, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for residential and commercial property changes. The body will decide on consent items, old business, and new applications involving new dwellings, demolitions, and exterior renovations.

zoninghistoric-preservationhousingsolarconstruction
Thu Jul 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing a series of consent items for property alterations. These requests include changes to sheds, doors, windows, and additions across various residential addresses.

historic-districtzoningresidentialbuilding-permits
Thu Jul 22, 2021 · 00:00

Scholarship Committee

Scholarship Committee to determine 2021 funding and award recipients

The Scholarship Committee will meet to set the total amount of scholarship funds for 2021 and elect officers. The body will review personal student information in executive session to select recipients for Town Scholarships and the Thomas F. Curley Scholarship.

scholarshipseducationgrants
Wed Jul 21, 2021 · 00:00

County Commission

County Commission to appoint representative to Planning and Economic Development Commission

The County Commission will meet to approve minutes and payroll warrants for July 2021. The body will also discuss the 2021-2022 appointment of a County Representative to the Nantucket Planning and Economic Development Commission.

appointmentsbudgeteconomic-developmentplanning
Wed Jul 21, 2021 · 00:00

Select Board

Select Board discusses housing plans, road acquisitions, and mobile food units

The Select Board will consider a request for an updated Housing Production Plan and a quitclaim deed for Richmond Great Point Development, LLC. Public hearings are scheduled regarding the acquisition of portions of North Road and a new mobile food unit application. The board will also discuss the continuation of outdoor dining.

housingzoningpublic-worksfoodgovernment-administration
Wed Jul 21, 2021 · 00:00

Select Board

Select Board to hold public hearings on road acquisition and food unit application

The Select Board will consider an updated Housing Production Plan and a quitclaim deed for Richmond Great Point Development, LLC. The meeting includes public hearings regarding the taking of portions of North Road and a new mobile food unit application for Yezzi’s on Nantucket.

housingroadspublic-hearingszoningbusiness-permits
Tue Jul 20, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses applications and housing plans

The Affordable Housing Trust will meet to discuss several housing applications and project updates. The agenda includes reviews of timetables for specific projects and discussions regarding a Community Land Trust.

affordable-housinghousing-productionreal-estatecommunity-land-trust
Tue Jul 20, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses housing plans and project updates

The Affordable Housing Trust will review several housing applications and project timelines. Discussion topics include the Richmond Wildflower acceleration, 31 Fairgrounds Road timetable, and a potential Community Land Trust.

affordable-housingzoninghousing-productionreal-estatecommunity-land-trust
Tue Jul 20, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee to review fund requisitions and 2021-2022 budget

The Community Preservation Committee will discuss several fund requisitions for local organizations and historical sites. The body is also scheduled to elect officers and approve the 2021-2022 budget.

budgethistoric-preservationgrantspublic-forum
Tue Jul 20, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is reviewing a large volume of applications for residential and commercial modifications. The body will decide on requests ranging from minor window replacements and signage to the demolition and construction of new dwellings.

zoninghistoric-preservationconstructionsolardemolition
Tue Jul 20, 2021 · 00:00

Historic District Commission

No agenda available for the July 20, 2021 meeting

There is no formal agenda provided for this meeting. The record contains only individual project documents for review.

zoningresidentialhistoric-preservation
Tue Jul 20, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations and sign requests

The Commission is reviewing a series of consent items for residential modifications and sign installations. The agenda lists various requests for renovations, additions, and pools across multiple properties.

historic-districtzoningresidential-constructionsigns
Tue Jul 20, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review garage and staircase projects

The Madaket Advisory Board is meeting to discuss two specific property renovation requests. The board will also review minutes from June 22 and June 29, 2021.

land-userenovationsmadaket
Tue Jul 20, 2021 · 00:00

Nantucket Public School Committee

School Committee to review superintendent entry plan and teacher status

The Nantucket Public School Committee will discuss the superintendent's entry plan findings and professional teacher status. The body will also review hiring updates and a central registration presentation.

educationpersonneldonationsschool-administration
Tue Jul 20, 2021 · 00:00

Nantucket Public School Committee

School Committee holds orientation for new members

The Nantucket School Committee is conducting a workshop session focused on new member orientation. Guest Jim Hardy from the MASC will lead discussions on committee roles and legal requirements.

educationgovernancetrainingschool-committee
Tue Jul 20, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss Lovers Lane and Newtown Roads

The committee will discuss the impact of ATM and ballot approval for Lovers Lane and Newtown Roads. Members will also review committee positions on rotaries and streets without sidewalks.

roadssidewalkstransportationinfrastructure
Tue Jul 20, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews sign applications and enforcement

The Sign Advisory Council will meet to review new business regarding sign applications. The agenda includes a projecting sign for 13 Center Street, LLC and two signs for Mark Furlong at 81 Hinsdale Road.

signszoningland-use
Tue Jul 20, 2021 · 00:00

Visitor Services Advisory Committee

Committee to discuss scheduling of large island events

The Visitor Services Advisory Committee is meeting to continue a discussion started on July 13, 2021. The committee will discuss the future scheduling of large island events and their impacts on Town resources with members of the Nantucket Lodging Association.

tourismevent-planningtown-resources
Mon Jul 19, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews four property alterations

The board is reviewing applications for additions, alterations, and hardscape work at four specific addresses. The meeting focuses on evaluating proposed changes to historic structures.

historic-preservationzoningbuilding-permitsland-use
Mon Jul 19, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews six property projects

The Historic Structures Advisory Board is meeting to discuss old business regarding six specific property projects. The board will also review lighting provisions for the HDC general checklist.

historic-preservationzoningbuilding-permitshousing
Mon Jul 19, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Nantucket Planning & Economic Development Commission meeting July 19, 2021

The commission will review membership appointments and elect officers for the Chairman and Vice-Chairman positions. The agenda includes a draft review of the Sconset Area Plan and discussion regarding goals for FY2022.

governmentappointmentszoningplanninghousing
Mon Jul 19, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews dwelling and addition projects

The Sconset Advisory Board is meeting to conduct preliminary reviews and discuss old business. The board will review a new dwelling and revisions to an addition project.

zoninghousingbuilding-permitssconset
Fri Jul 16, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to review sidewalk policies and grant scopes

The Nantucket Historical Commission is meeting to discuss historic preservation policies and administrative updates. The body will review sidewalk and pavement policies, as well as the Sewer Force Main 3 review. Members will also consider a letter of support for a historic tax credit application for 6 Gull Island.

historic-preservationsidewalksgrantsinfrastructurezoning
Fri Jul 16, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Nantucket Planning & Economic Development Commission By-Law meeting canceled

The July 16, 2021, meeting of the By-Law Committee of the Nantucket Planning & Economic Development Commission was canceled.

proceduralby-laws
Thu Jul 15, 2021 · 00:00

Board of Health

Board of Health to review septic variances and property condemnations

The Nantucket Board of Health will meet to decide on septic system loans, permits, and variances for several residential properties. The board will also ratify a property condemnation and discuss swimming pool research.

septicsewerpublic-healthzoningcannabis
Thu Jul 15, 2021 · 00:00

Board of Health

Board of Health reviews septic permits and a mixed-use structure condemnation

The Board of Health is reviewing several septic system applications and variance requests. The meeting includes a discussion on the condemnation of a mixed-use structure.

healthsepticzoningcondemnationpermits
Thu Jul 15, 2021 · 00:00

Cannabis Advisory Committee

Cannabis Advisory Committee meeting cancelled

The Cannabis Advisory Committee meeting scheduled for July 15, 2021, has been cancelled.

cannabismeeting-cancellation
Thu Jul 15, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential construction projects

The Historic District Commission is meeting to discuss a high volume of applications for new dwellings, demolitions, and home alterations. The body will also review policies regarding move/demo hearings and hardscaping.

zoninghistoric-preservationresidential-constructiondemolitionsolar-energy
Thu Jul 15, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review speed limits and signage requests

The Traffic Safety Work Group is meeting to discuss various requests for new road signage, speed limit changes, and parking adjustments across several island locations. The body will review petitions for one-way traffic and new stop signs to improve pedestrian and driver safety.

traffic-safetysignagespeed-limitsparkingroads
Thu Jul 15, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review signage and speed limit requests

The Traffic Safety Work Group is meeting to discuss various requests for new signage, speed limit changes, and parking modifications. The group will review specific road safety petitions and pavement markings across several town locations.

traffic-safetysignagespeed-limitsparkingroads
Wed Jul 14, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss lot consolidation and green burials

The Nantucket Cemetery Commission will meet to approve lot sales and minutes. The body will discuss the consolidation of two adjacent lots at Polpis and the implementation of green burials.

cemeteriesland-usepublic-records
Wed Jul 14, 2021 · 00:00

Select Board

Select Board holds public hearing on harbor and town pier regulations

The Select Board is meeting to discuss infrastructure projects, budget transfers, and utility pole attachments. The body will hold a public hearing regarding amendments to harbor and town pier regulations.

harborssewerbudgettelecommunicationscontracts
Wed Jul 14, 2021 · 00:00

Select Board

Select Board to discuss real property at 9 Salem Street and 48 Cliff Road

The Select Board/County Commissioners will meet via Zoom to enter an executive session. The board will consider the purchase, exchange, lease, or value of specific real property.

real-estateproperty-valuationexecutive-session
Wed Jul 14, 2021 · 00:00

Select Board

Select Board to hold public hearing on harbor and town pier regulations

The Select Board will conduct a public hearing regarding amendments to harbor and town pier regulations. The body will also review engineering updates for Baxter Road and the Third Sewer Force Main project.

harbor-regulationssewercontractstelecommunicationsinfrastructure
Tue Jul 13, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review plan progress and project updates

The committee will receive a report on the June 24th Virtual Open House and discuss next steps for the Coastal Resilience Plan. Members will also review updates on several concurrent resilience projects and elect officers.

coastal-resilienceinfrastructureplanningenvironment
Tue Jul 13, 2021 · 00:00

Finance Committee

Finance Committee to review fund transfers and elect officers

The Finance Committee will meet to discuss the adoption of previous meeting minutes and the election of officers and committee appointments. The body will also review and approve 33B Transfers and Reserve Fund Transfers.

financebudgetappointments
Tue Jul 13, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous building and signage applications

The Historic District Commission is meeting to review a high volume of applications for new dwellings, renovations, and signage. The body will consider consent items, old business, and new business regarding property alterations across Nantucket.

zoninghistoric-preservationhousingsignagesolar
Tue Jul 13, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various property additions and demolitions

The commission is reviewing multiple construction projects, including new dwellings, garages, pools, and demolition requests. The agenda includes items categorized as consent, old business, and new business across several dates.

zoningconstructionresidentialhistoric-preservation
Tue Jul 13, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential construction and renovations

The commission is reviewing applications for new dwellings, additions, and renovations at several properties. The agenda consists of a list of project documents for review.

historic-districtzoninghousingrenovations
Tue Jul 13, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property use and real estate acquisitions

The Nantucket Islands Land Bank Commission will review recommendations from the Golf Capital Committee and discuss property use requests for several locations. The body will also address personnel compensation and real estate acquisitions in executive session.

land-usereal-estateproperty-managementpersonnelgolf
Tue Jul 13, 2021 · 00:00

Select Board

Select Board to participate in Nantucket Community Association Summer Forum

The Select Board is meeting to participate in the Nantucket Community Association Summer Forum. No other business items are listed on the agenda.

community-forumpublic-engagement
Tue Jul 13, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss large island events

The committee will introduce two candidates for membership. Members will also discuss the scheduling of large island events and how those events impact Town resources.

visitor-servicestown-resourcesevent-scheduling
Tue Jul 13, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to review PFAS results and ratify federal grants

The Nantucket Memorial Airport Commission will discuss soil and groundwater results regarding PFAS investigation and water service reimbursement. The body is also scheduled to ratify several grant awards and agreements totaling over $800,000.

airportgrantspfasenvironmenttransportation
Remote Participation Via Zoom
Mon Jul 12, 2021 · 00:00

Council for Human Services

Council for Human Services to review behavioral health assessment

The Council for Human Services will receive a presentation on the Nantucket Behavioral Health Assessment from Government Performance Solutions, Inc. The body will also discuss a school bullying initiative and receive updates on vaccine clinics.

behavioral-healthpublic-healthschoolsvaccines
Mon Jul 12, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews seven property modification requests

The Historic Structures Advisory Board is meeting to review several new business applications for property modifications. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationzoninghousing
Mon Jul 12, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews property alterations

The board is reviewing applications for structural and aesthetic changes to several properties. These items include requests for new fencing, roofing, and hardscaping.

historic-preservationzoningbuilding-permitsnantucket
Mon Jul 12, 2021 · 00:00

Planning Board

Planning Board to review Stop & Shop preliminary plans and housing items

The Planning Board will hold a joint discussion with the Select Board regarding ATM 2020/2021/2022 and discuss the Housing Production Plan. The board will also review various dwelling applications and hold public hearings for several property developments.

zoninghousingland-usepublic-hearingsdevelopment
Mon Jul 12, 2021 · 00:00

Planning Board

Planning Board to review housing production plan and multiple dwelling requests

The Planning Board will discuss the Housing Production Plan and an ATM discussion. The body is reviewing several applications for secondary, tertiary, and garage dwellings, as well as various After the Fact (ANR) filings and preliminary plans.

housingzoningland-usepublic-hearings
Mon Jul 12, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential construction and alterations

The Sconset Advisory Board will discuss several new business items regarding property modifications. The board is reviewing requests for new structures, barn moves, and hardscaping at various Sconset addresses.

zoningconstructionresidentialsconset
Mon Jul 12, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews residential construction and alteration requests

The board is reviewing several applications for property modifications and new construction in Sconset. These include requests for new dwellings, garages, and outdoor structures.

zoningconstructionresidentialsconset
Mon Jul 12, 2021 · 00:00

Select Board

Select Board to attend Planning Board meeting regarding annual town meeting

The Select Board will attend a Planning Board meeting to discuss topics following the 2021 Annual Town Meeting. The meeting is scheduled for remote participation via Zoom.

governmentplanningtown-meeting
Sat Jul 10, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to elect leadership and discuss bylaws

The committee will elect a Chair, Vice-Chair, and Secretary. Members will discuss noise bylaw revisions, town committee assignments, and citizen's warrant articles including Article 90.

bylawsgovernancewarrant-articlestown-committees
Fri Jul 9, 2021 · 00:00

Madaket Area Plan Work Group

The Madaket Area Plan Committee meeting is cancelled

The scheduled meeting for July 9, 2021, has been cancelled. No other business or discussion items are listed.

madaket-area-plancancellation
Thu Jul 8, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on nine Notices of Intent

The Nantucket Conservation Commission will conduct public hearings for nine Notices of Intent and two requests for Amended Orders of Conditions. The body will also review requests for determinations, certificates of compliance, and extensions of conditions.

conservationpublic-hearingland-useenvironmental-regulation
Thu Jul 8, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a large volume of applications for new dwellings, additions, and demolitions. The body will also discuss policies regarding move/demo hearings and the consent agenda process.

zoninghistoric-preservationdemolitionhousingsolar
Thu Jul 8, 2021 · 00:00

Nantucket Water Commissioners

Water Commissioners to review PFAS projects and annual fire fees

The Nantucket Water Commissioners will meet to review production, billing, and rainfall reports. The board will discuss PFAS projects at the airport, Sun Island Road, and Wannacomet Water Company, as well as annual fire fees.

water-utilitypfassolar-powerpublic-healthfees
Thu Jul 8, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to discuss Nantucket Island Fair and partner program

The Parks and Recreation Commission is meeting to introduce new members and discuss security and maintenance. The body will review the Nantucket Island Fair at Tom Nevers Field and the Parks Partner Program.

parks-and-recreationpublic-eventsmaintenancecommunity-programming
Thu Jul 8, 2021 · 00:00

Select Board

Select Board to hold executive session on labor and real estate

The Select Board and County Commissioners will meet via Zoom to conduct an executive session. The board will discuss collective bargaining strategies, litigation, and the value of specific real properties.

labor-relationslitigationreal-estatepolicebeach-preservation
Thu Jul 8, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review residential permits and variances

The Zoning Board of Appeals will hold public hearings to decide on special permits and variances for residential properties. The board is reviewing requests regarding building heights, parking requirements, and land use modifications.

zoningresidentialspecial-permitsvariancesparking
Wed Jul 7, 2021 · 00:00

Audit Committee

Audit Committee to review FY20 Comprehensive Annual Financial Report

The Audit Committee is meeting to receive a presentation from auditors Roselli, Clark & Associates. The body will conduct an audit exit conference and discuss the FY20 Management Letter.

auditfinancegovernment-oversight
Wed Jul 7, 2021 · 00:00

Audit Committee

Audit exit conference regarding Town financial trends and metrics

The Audit Committee met for an exit conference with Rosselli, Clark & Associates to review financial trends. The discussion included the town's bond rating achievement, reserve levels, and various informational items.

auditfinancebond-ratinggovernment-operationstransit
Wed Jul 7, 2021 · 00:00

Audit Committee

Audit report for fiscal year 2020 maintains Town's AAA bond rating

The Audit Committee reviewed a management letter from Roselli, Clark & Associates regarding the Town's financial statements for the year ended June 30, 2020. The report notes that strong fiscal management allowed the Town to maintain a AAA bond rating despite the impacts of Covid-19.

auditfinancebond-ratingpensionstax-rate
Wed Jul 7, 2021 · 00:00

Council on Aging

Council on Aging discusses federal grants and human services

The Council on Aging will review several official business items including grant application status and human services reports. Discussion topics include Saltmarsh programs, dementia-friendly initiatives, and updates on Elder Services of Cape Cod and the Islands.

human-servicesgrantshealthseniors
Wed Jul 7, 2021 · 00:00

County Commission

Nantucket County Commission meeting on July 7, 2021

The County Commission will conduct an election of officers and review various administrative items. The agenda includes the approval of previous meeting minutes and financial warrants.

government-administrationfinanceelections
Wed Jul 7, 2021 · 00:00

Select Board

Select Board to consider liquor license transfer and major DPW contracts

The Select Board will hold a public hearing regarding a wine and malt beverages license transfer and vote on 2022 town meeting dates. The body will also review a large volume of pending contracts for health services, roadwork, and sewer infrastructure.

liquor-licenseroadssewerbudgetpublic-healthgrants
Wed Jul 7, 2021 · 00:00

Select Board

Select Board discusses town meeting dates and reviews various municipal contracts

The Select Board will discuss proposed dates for the 2022 Annual Town Meeting and Election. The agenda also includes a public hearing regarding a liquor license transfer and several contract approvals.

governmentliquor-licensebudgetpublic-safetyinfrastructure
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property modifications

The commission is reviewing a series of consent items for property alterations. These requests include changes to sheds, AC units, and hardscaping across various residential addresses.

historic-districtzoningbuilding-permitsresidential
Tue Jul 6, 2021 · 00:00

Historic District Commission

HDC reviews proposals for 31 Fairgrounds Rd and 278 Polpis Road

The Historic District Commission is reviewing applications for multiple buildings at 31 Fairgrounds Rd and a resite proposal for 278 Polpis Road. No formal agenda was provided for this meeting.

historic-districtzoningbuilding-permitsnantucket
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations and new construction

The commission is reviewing several applications for property modifications and new construction. The agenda consists of a series of project reviews for specific addresses.

historic-districtzoningconstructionsolar
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews several residential property modifications

The commission is reviewing old business regarding additions, new dwellings, and pools at various residential addresses. No formal agenda was provided beyond the list of properties under review.

historic-districtzoningresidential-construction
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous residential construction projects

The Commission is reviewing applications for new dwellings, additions, and pools across various properties. The agenda includes requests for demolitions, moving structures off-site, and new garage constructions.

zoninghistoric-districtsconstructiondemolitionhousing
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 11 property renovation and construction projects

The commission is reviewing applications for new dwellings, renovations, and solar installations. The meeting includes requests for structural changes and additions to residential properties.

zoninghistoric-districtsolarconstructionresidential
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple property alterations

The commission is reviewing old business regarding additions, new dwellings, and hardscaping for various properties. No formal agenda was provided for this meeting.

historic-districtzoninghousingconstruction
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple property alterations

The commission is reviewing applications for exterior changes, new constructions, and demolitions at various residential and mixed-use properties. The agenda consists of a list of specific project filings for review.

historic-districtzoningconstructionresidentialsolar
Tue Jul 6, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review CCAP application and Housing Production Plan

The Affordable Housing Trust will discuss a CCAP application and review the Housing Production Plan. The body will also discuss housing-related articles from the Annual Town Meeting and priorities leading up to the 2022 Annual Town Meeting.

affordable-housinghousing-production-planreal-estatetown-meeting
Tue Jul 6, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review Housing Production Plan

The Affordable Housing Trust will discuss a CCAP application and review the 2021-2026 Housing Production Plan. The body will also provide updates on 31 Fairgrounds Road and discuss priorities leading up to the 2022 Annual Town Meeting.

affordable-housingzoninghousing-production-planreal-estate
Tue Jul 6, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss oyster lease revocation and boat regulations

The board will meet to discuss updates on boat Airbnb and liveaboard regulations and a draft letter to the Select Board regarding an oyster lease permit revocation. The meeting also includes reports from the Marine and Natural Resources departments.

shellfishboatingwater-qualityzoningenvironment
Tue Jul 6, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for new dwellings, renovations, and exterior modifications. The agenda includes consent items, new business, and old business regarding residential and mixed-use structures across Nantucket.

zoninghistoric-preservationhousingsolarconstruction
Thu Jul 1, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential and sign applications

The Historic District Commission is meeting to discuss a high volume of applications for new dwellings, additions, and hardscaping. The body will also review requests for temporary banners and wall signs, as well as rooftop solar installations.

zoninghistoric-preservationhousingsolarsigns
Wed Jun 30, 2021 · 00:00

Conservation Commission

Conservation Commission to review Siasconset Beach and Snowdon projects

The Nantucket Conservation Commission is meeting via Zoom to conduct a 2020 annual review and discuss an amended order of conditions. The body will hear public comment before reviewing specific property matters.

conservationbeach-preservationenvironmental-review
Tue Jun 29, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to review Baxter Road Engineering Feasibility Assessment

The Coastal Resilience Advisory Committee will hold a workshop with the Select Board, Town Staff, and Arcadis. The meeting focuses on the Baxter Road Engineering Feasibility Assessment, including desired outcomes, preliminary results, and future adaptation scenarios.

coastal-resilienceinfrastructurebaxter-roadengineering
Tue Jun 29, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee reviews feasibility of Baxter Road bluff stabilization

The Coastal Resilience Advisory Committee held a workshop with the Select Board and Arcadis to discuss engineering alternatives for addressing bluff erosion on Baxter Road. The body reviewed five potential scenarios ranging from maintaining the current system to relocating the road and utilities.

coastal-resilienceerosioninfrastructurebaxter-roadzoning
Tue Jun 29, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential and commercial projects

The Historic District Commission is meeting to discuss a high volume of applications for new dwellings, renovations, and pools. The body will also ratify several previous decisions regarding demolitions and new constructions.

zoninghistoric-preservationhousingsolarcommercial-development
Tue Jun 29, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential and commercial property alterations

The commission is reviewing several applications for property modifications, including pools, solar installations, and new dwellings. The meeting includes reviews of both approved and unapproved site features.

historic-districtzoningsolarresidential-constructionland-use
Tue Jun 29, 2021 · 00:00

Historic District Commission

No agenda available for the June 29, 2021 meeting

There is no agenda provided for this meeting of the Historic District Commission. The record contains only a list of old business items from the May 25, 2021 meeting.

historic-preservationresidential-constructionzoning
Tue Jun 29, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 19 property applications

The commission is reviewing applications for new dwellings, additions, and renovations. The agenda lists specific property requests for review under New Business.

zoninghistoric-preservationhousingconstruction
Tue Jun 29, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews pool reduction at 1 Goose Cove Way

The Madaket Advisory Board is meeting to discuss new business regarding a specific property request. The board will also review minutes from June 22, 2021, and discuss its future meeting schedule.

land-useresidential-propertymadaket
Tue Jun 29, 2021 · 00:00

Select Board

Select Board workshop on Baxter Road engineering feasibility

The Select Board is holding a workshop with the Coastal Resilience Advisory Committee, town staff, and Arcadis. The meeting focuses on the Baxter Road engineering feasibility assessment, including project status, desired outcomes, and potential alternatives.

coastal-resilienceinfrastructurebaxter-roadengineering
Tue Jun 29, 2021 · 00:00

Select Board

Select Board holds workshop on Baxter Road engineering feasibility

The Select Board and Coastal Resilience Advisory Committee met with Arcadis to review feasibility assessments for addressing bluff erosion on Baxter Road. The session focused on comparing five different engineering alternatives and discussing long-term adaptation pathways.

coastal-resilienceinfrastructureerosionbaxter-roadpublic-works
Tue Jun 29, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign plans for Center Street and Broad Street

The Sign Advisory Council is meeting to discuss old and new business regarding signage requests. The body will review master sign plans, temporary banners, and a wall sign application.

signagezoningland-usenantucket
Mon Jun 28, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 13 property modification requests

The Historic Structures Advisory Board is meeting to review new business applications for property work. The board will consider requests ranging from roof repairs and additions to the movement of structures between properties.

historic-preservationzoninghousingdemolition
Mon Jun 28, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple residential property applications

The Historic Structures Advisory Board is reviewing several applications for residential modifications and new construction. These items include house and garage movements, additions, and hardscape revisions across various locations.

residentialconstructionhistoric-preservationzoning
Mon Jun 28, 2021 · 00:00

Nantucket Public School Committee

Nantucket School Committee to hold reorganizational meeting

The School Committee is meeting to conduct its reorganizational session. The body will determine School Committee and Task Force assignments for Fiscal Year 2022.

educationgovernanceappointments
Mon Jun 28, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews new dwelling and pool applications

The Sconset Advisory Board will conduct a preliminary review of several property projects. Discussion includes a new dwelling and pool at 10 Hydrangea Lane, as well as a renovation at 3 Grand Avenue.

zoninghousingresidential-development
Sat Jun 26, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to discuss post-election commentary

The committee will hear from guest speaker Libby Gibson regarding post-ATM and Town elections. Members will also discuss future meeting topics and the proposition to continue meeting via Zoom.

electionstransportationenergyparkingpublic-comment
Fri Jun 25, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss CCAP application for 3 Evergreen Way

The Affordable Housing Trust is holding a special meeting to discuss a CCAP application. The body will also hear public comment and address other business.

affordable-housingccap-applicationhousing
Thu Jun 24, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to attend virtual open house

The committee is discussing its attendance at the Nantucket Coastal Resilience Plan Virtual Open House #2. This event is scheduled for June 24.

coastal-resilienceplanningpublic-engagement
Thu Jun 24, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 13 land use items

The Nantucket Conservation Commission is meeting to conduct public hearings on Notices of Intent and Amended Orders of Conditions. The body will also discuss the issuance of Orders of Conditions for various properties and review requests for determinations and modifications.

conservationland-usepublic-hearingenvironment
Thu Jun 24, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous new dwelling and renovation requests

The Historic District Commission is meeting to elect officers and review a large volume of applications for new dwellings, additions, and site improvements. The body will also discuss policies regarding move/demo hearings and hardscaping.

zoninghistoric-preservationhousingsolarconstruction
Thu Jun 24, 2021 · 00:00

Nantucket Water Commissioners

Nantucket Water Commissioners to review fees and water infrastructure projects

The Nantucket Water Commissioners will meet to discuss production, billing, and rainfall reports. The board will review annual fire, cross connection, and well inspection fees, as well as a five to ten year plan.

water-utilityfeesinfrastructuresolar-powerpfas
Wed Jun 23, 2021 · 00:00

Select Board

Select Board considers $13.3 million in Bond Anticipation Notes

The Select Board will review a request to sell $13.3 million in notes for sewer, water, airport, and PFAS projects. The board will also hold public hearings on utility petitions and mobile food unit applications.

financeinfrastructureutilitiespublic-healthzoning
Wed Jun 23, 2021 · 00:00

Select Board

Select Board to consider $13.3 million bond sale for infrastructure

The Select Board will review a request to sell $13.3 million in Bond Anticipation Notes for sewer, water, airport, and PFAS projects. The board will also hold public hearings on utility petitions and mobile food unit applications. Other business includes real estate transfers and the approval of pending contracts.

budgetinfrastructureutilitiesreal-estatepublic-health
Wed Jun 23, 2021 · 00:00

Nantucket Public School Committee

School Committee to recommend appointment for one-year vacancy

The Nantucket School Committee is meeting to provide a recommendation to the Board of Selectmen regarding a one-year vacancy on the committee. This position will remain open through the Annual Town Election 2022.

appointmentsschool-committeegovernance
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews new dwellings and additions

The commission is reviewing carried-over new business from June 7, 2021. The items consist of various applications for new construction, renovations, and property modifications.

zoninghistoric-districthousingconstruction
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is addressing old business carried over from the June 15, 2021 meeting. The agenda consists of a list of pending applications for property modifications and new constructions.

historic-districtzoningconstructionsolar
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing applications for exterior modifications to several residential properties. These include requests for pools, solar installations, and new dwellings.

zoninghistoric-districtresidential-constructionsolar-energy
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous residential construction requests

The Historic District Commission is reviewing new business applications for residential modifications. These requests include new dwellings, pool installations, and structural renovations across various properties.

historic-districtzoningresidential-constructionpoolssolar
Tue Jun 22, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review two property projects

The Madaket Advisory Board is meeting to discuss new business regarding two specific properties. The board will review a proposal for a new dwelling and a request to reduce a pool size.

zoninghousingland-usemadaket
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on new dwellings, additions, pools, and signage across various Nantucket addresses.

zoninghistoric-preservationconstructionresidential-developmentcommercial-development
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing a series of consent items for residential property changes. These include additions, roof modifications, and shed placements.

historic-districtzoningresidential-constructionpermits
Tue Jun 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple dwelling and landscape projects

The commission is reviewing carried-over new business from May 18, 2021. The agenda consists of several applications for new dwellings, alterations, and hardscape projects.

historic-districtzoningdemolitionhousinglandscaping
Tue Jun 22, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda available for this meeting. The provided text consists of a list of old business items carried over from the May 25, 2021, meeting.

zoningresidentialhistoric-district
Tue Jun 22, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss golf course business and property management

The Nantucket Islands Land Bank Commission will review monthly reports for Sconset and Miacomet golf courses and discuss property management at Cisco Beach and Larrabee Farm. The body will also hold an annual election of officers and enter an executive session regarding real estate acquisition.

land-bankgolf-coursesproperty-managementreal-estatepublic-space
Tue Jun 22, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign requests for 29 Center Street and other sites

The Sign Advisory Council is meeting to discuss several sign applications and revisions. The body will review requests for a master sign plan and specific signage at 29 Center Street, as well as banners and wall signs at other locations.

signagezoningland-usepublic-hearings
Tue Jun 22, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews signage requests for multiple properties

The Sign Advisory Council is reviewing applications for various signs, including wall signs, banners, and a master sign plan. The body will consider requests for properties on Sanford Road, Broad Street, and Center Street.

signagezoningbusiness-permits
Mon Jun 21, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews three property projects

The Historic Structures Advisory Board is meeting to conduct preliminary reviews of old business regarding three specific properties. The board will also discuss lighting provisions for the HDC general checklist.

historic-preservationzoningbuilding-permitscoastal-resilience
Mon Jun 21, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to review transportation program and member appointments

The Nantucket Planning & Economic Development Commission will consider appointments for an At-Large Member and review a transportation program. The body will also review a contract for the Deputy Director of Planning.

appointmentstransportationcontractsplanning
Mon Jun 21, 2021 · 00:00

Nantucket Planning & Economic Development Commission

NP&EDC to review transportation planning and member appointments

The Nantucket Planning & Economic Development Commission is meeting to review draft minutes from May 17, 2021. The body will also consider the FFY 2022 Draft Unified Planning Work Program for the 3C Transportation Program and review materials regarding at-large members Mary Longacre and Hillary Hedges Rayport.

transportationplanningappointmentsgovernment-administration
Thu Jun 17, 2021 · 00:00

Board of Health

Nantucket Board of Health meeting cancelled

The Board of Health meeting scheduled for June 17, 2021, was cancelled.

board-of-healthcancelled
Thu Jun 17, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential and commercial projects

The Historic District Commission is meeting to review applications for new dwellings, demolitions, and renovations. The body will also discuss policies regarding move/demo hearings and hardscaping.

zoninghistoric-preservationdemolitionsolarconstruction
Thu Jun 17, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee to discuss maintenance plans and specific tree removals

The Tree Advisory Committee is meeting to review town tree maintenance and planting policies. The body will discuss several specific tree removal requests and root interference issues across the town.

treespublic-workssewermaintenancezoning
Wed Jun 16, 2021 · 00:00

Nantucket Housing Authority

Housing Authority to review Miacomet Road building envelope bid

The Nantucket Housing Authority will meet to approve vouchers and a construction bid. The board will also consider a request to use the Tom Nevers property for a film festival.

housingcontractsconstructionpublic-property
Wed Jun 16, 2021 · 00:00

Select Board

Select Board to hold organization meeting and elect officers

The Select Board is meeting to conduct organizational business following the June 15, 2021 Annual Town Election. The session includes a swearing-in ceremony and the election of officers.

government-organizationelectionsselect-board
Tue Jun 15, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews fund requisitions

The Community Preservation Committee is meeting to review fund requisitions and discuss committee business. The body will also plan for an annual public forum scheduled for July 20.

community-preservationfundingpublic-forum
Tue Jun 15, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss oyster lease revocations and boat rules

The board will review reports from the Marine and Natural Resources departments. Members will discuss proposed regulations for boat Airbnbs and liveaboards, as well as a draft letter to the Select Board regarding oyster lease permit revocations.

shellfishboatingwater-qualityharbor-managementenvironment
Tue Jun 15, 2021 · 00:00

Historic District Commission

Historic District Commission reviews dwelling and exterior changes

The Commission is reviewing several applications for new dwellings, fenestration changes, and exterior modifications. The agenda includes requests for new construction and the removal of existing cottages.

historic-districtzoninghousingconstruction
Tue Jun 15, 2021 · 00:00

Historic District Commission

The Historic District Commission has no agenda for this meeting

There is no agenda available for this meeting. The record indicates that there is no agenda and directs readers to view the minutes.

procedural
Tue Jun 15, 2021 · 00:00

Historic District Commission

Historic District Commission to review carried-over property applications

The commission is addressing old business carried over from the May 25, 2021 meeting. The session consists of reviews for various residential additions, new dwellings, and outdoor structures.

historic-districtzoningresidential-constructionbuilding-permits
Tue Jun 15, 2021 · 00:00

Historic District Commission

No meeting agenda available for the Historic District Commission

There is no agenda available for this meeting. The provided text consists of a list of new business items carried over from the June 7, 2021, meeting.

zoninghousingconstructionhistoric-preservation
Tue Jun 15, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential additions and new dwellings

The commission is reviewing old business regarding several residential property modifications. The items include requests for new dwellings, additions, and outdoor amenities.

historic-districtzoningresidential-constructionsolar
Tue Jun 15, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council to discuss awards and membership

The Nantucket Cultural Council will meet to approve previous minutes and discuss the reception for awards. The body will also consider potential new members and a new logo for the Local Cultural Council.

arts-and-culturemembershiplocal-government
Tue Jun 15, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on vacancy and collective bargaining agreement

The Nantucket School Committee will meet to discuss a vacancy on the committee and the superintendent's evaluation. The body will vote on a collective bargaining agreement for facilities and grounds staff and a $3,000 donation for the Summer Boost program.

educationcollective-bargainingschool-budgetappointments
Tue Jun 15, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee meeting cancelled

The meeting scheduled for June 15, 2021, has been cancelled.

roadsprocedural
Tue Jun 15, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications for 29 Center Street and other sites

The Sign Advisory Council is meeting to discuss old and new business regarding sign installations. The body will review multiple sign requests for properties on Center Street, Hummock Pond Road, Old South Road, India Street, and Broad Street.

signszoningland-usenantucket
Tue Jun 15, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications for 29 Center St and other locations

The Sign Advisory Council is reviewing several sign proposals, including a master sign plan and multiple individual signs for properties on Center St, Hummock Pond Rd, Old South Rd, and India St.

signagezoningbusiness-permitsnantucket
Tue Jun 15, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust meeting cancelled

The Affordable Housing Trust meeting scheduled for June 15, 2021, was cancelled.

affordable-housingcancelled-meeting
Tue Jun 15, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential and commercial projects

The Historic District Commission is meeting to review a high volume of applications for new dwellings, additions, and hardscaping. The body will decide on consent items, sign permits, and both new and old business regarding property alterations.

zoninghistoric-preservationhousingcommercial-developmentsolar
Tue Jun 15, 2021 · 00:00

Historic District Commission

Historic District Commission reviews signage and structural modifications

The commission is reviewing several applications for certificates of appropriateness. These include requests for signage changes, structural additions, and historic determinations.

historic-districtszoningsignagebuilding-permits
Mon Jun 14, 2021 · 00:00

Airport Commission, Energy & Environment Subcommittee

Airport Commission discusses ground noise program and South Ramp extension

The Energy and Environment Subcommittee is discussing the creation of a ground noise program and operations policy for the South Ramp extension. The meeting includes updates on PFAS, stormwater inspections, and a potential FAA environmental grant.

airportnoise-abatementenvironmentpfasstormwater
Mon Jun 14, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission discusses ongoing projects and street furniture

The commission will review administrative items including commissioner reappointments and updates on in-person meetings. Discussion topics include the Tom Nevers Bike Path, a sewer project, and developing operational guidelines.

historic-preservationinfrastructurepublic-policytransportation
Mon Jun 14, 2021 · 00:00

Airport Commission, Energy & Environment Subcommittee

Airport Commission Subcommittee to discuss noise abatement and PFAS updates

The Energy and Environment Subcommittee is meeting to discuss ground noise program elements and the South Ramp Extension operations policy. The body will also review updates regarding PFAS and stormwater inventory and inspection.

airportnoise-abatementpfasstormwaterenvironment
Mon Jun 14, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews new dwellings and property improvements

The Historic Structures Advisory Board will conduct a preliminary review of several new business items including new dwellings, pools, and hardscapes. The board will also discuss lighting provisions for the HDC general checklist.

zoninghousingresidential-developmenthistoric-preservation
Mon Jun 14, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews several residential property applications

The Historic District Commission is reviewing multiple applications for residential changes including new dwellings, pool and hardscape installations, and window replacements. These items include projects on Lincoln Avenue, York Lane, Water Street, and Main Street.

zoningresidentialhistoric-preservationconstruction
Mon Jun 14, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review new dwelling proposal at 11 D Street

The Madaket Advisory Board will meet to discuss new business regarding a property owner's request. The board is reviewing a proposal for a new dwelling at 11 D Street.

housingland-usemadaket
Mon Jun 14, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to review Tom Nevers Bike Path and sewer projects

The Commission will discuss the Tom Nevers Bike Path schematics and follow up on the Sewer Force Main 3 project. The body will also address administrative matters, including commissioner reappointments and the development of operational guidelines.

historic-preservationinfrastructurebike-pathsewerplanning
Mon Jun 14, 2021 · 00:00

Planning Board

Planning Board to hold public hearings on various land use and subdivision permits

The Planning Board will meet via Zoom to review applications for second dwellings, garage apartments, and preliminary plans. The session includes multiple public hearings for special permits and subdivision modifications.

zoningland-usesubdivisionpublic-hearingshousing
Mon Jun 14, 2021 · 00:00

Planning Board

Planning Board to review multiple land subdivisions and public hearings

The Planning Board is meeting to review several After Neighborhood Record (ANR) filings and preliminary plans. The body will also hold public hearings for various properties and developments. The meeting includes a review of minutes from November 18, 2020.

zoningland-usepublic-hearingssubdivisionshousing
Mon Jun 14, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews pool and hardscape project at 29 Main St

The Sconset Advisory Board is meeting to conduct a preliminary review of a specific property improvement project. The board will also note an upcoming virtual open house for the Coastal Resilience Plan.

land-usehardscapecoastal-resiliencesconset
Mon Jun 14, 2021 · 00:00

Tuckernuck Advisory Board

Tuckernuck Advisory Board to elect officers

The Tuckernuck Advisory Board will meet via Zoom to conduct procedural business. The board intends to elect officers and discuss the schedule for future meetings.

governmentappointmentstuckernuck
Fri Jun 11, 2021 · 00:00

Historic District Commission

Historic District Commission reviews design guidelines and various property applications

The Historic District Commission will review the Resilient Nantucket Design Guidelines for final adoption. The meeting includes a large volume of new business regarding dwellings, additions, and hardscape projects across the island.

zoninghistoric-preservationhousingconstructionland-use
Fri Jun 11, 2021 · 00:00

Historic District Commission

Historic District Commission reviews flooding adaptation guidelines

The commission is reviewing draft design standards and guidelines for flooding adaptation. No formal agenda was provided for this meeting.

floodingresiliencedesign-standardshistoric-district
Fri Jun 11, 2021 · 00:00

Madaket Area Plan Work Group

Madaket Area Plan Work Group to discuss goals and chapter outlines

The Madaket Area Plan Work Group is meeting to review a draft outline of nine plan chapters and assign tasks. The group will specifically discuss Chapter 1, which focuses on goals, objectives, and boundary definition.

zoninghousingeconomic-developmentenvironmenttransportationinfrastructure
Thu Jun 10, 2021 · 00:00

Zoning Board of Appeals

ZBA to consider affordable housing confirmation for Habitat for Humanity

The Zoning Board of Appeals is meeting to discuss several property modifications and variance requests. A key item involves confirming a prior permit for Habitat for Humanity to ensure affordable units count toward the town's subsidized housing inventory.

zoningaffordable-housingvariancesresidential-development
Thu Jun 10, 2021 · 00:00

Zoning Board of Appeals

Zoning Board to review affordable housing and residential variances

The Zoning Board of Appeals will consider a request from Habitat for Humanity to confirm permits for the Miacomet Village project to aid the town's subsidized housing inventory. The board will also hear requests for residential variances and special permits for home additions and garage construction.

zoningaffordable-housingvariancesresidentialcommercial
Thu Jun 10, 2021 · 00:00

Zoning Board of Appeals

ZBA to consider affordable housing certification for Benjamin Drive project

The Zoning Board of Appeals will discuss several permit modifications and variance requests. A key item involves confirming a prior decision for Habitat for Humanity to include units in the Town's Subsidized Housing Inventory.

zoningaffordable-housingvariancesspecial-permitsland-use
Thu Jun 10, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review beach use and demolition requests

The Commission will discuss requests for the use of Children’s Beach for summer events and review demolition applications for storage and rink facilities. The body will also address the transition back to in-person meetings.

parks-and-recreationpublic-facilitiesdemolitioncommunity-eventsbeach-use
Thu Jun 10, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 10 notices of intent

The Nantucket Conservation Commission is meeting to conduct public hearings for several notices of intent and amended orders of conditions. The body will also review requests for determination, minor modifications, and certificates of compliance.

conservationenvironmentpublic-hearingland-use
Thu Jun 10, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission reviews demolition and beach use requests

The Commission will review demolition applications for the Tom Nevers storage building and outdoor rink. The body will also consider requests for event use of Children’s Beach and discuss summer programming.

parks-and-recreationdemolitionpublic-beachcommunity-eventssummer-programming
Wed Jun 9, 2021 · 00:00

Select Board

Select Board to review PFAS risk assessment and public safety facility upgrades

The Select Board will discuss COVID-19 updates, face covering requirements for public transit, and the potential return to in-person meetings. The body is also reviewing applications for various town commissions and boards.

public-healthcontractsenvironmentpublic-safetytransportationappointments
Wed Jun 9, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss green burials and Polpis Cemetery developments

The Nantucket Cemetery Commission is meeting to approve lot sales and minutes. The body will discuss green burials, cemetery surveys, and updates regarding Polpis Cemetery and the Quaise Monument.

cemeteriesland-usepublic-works
Wed Jun 9, 2021 · 00:00

Select Board

Select Board to review committee applications and COVID-19 transit mask rules

The Select Board will review applications for various town commissions and boards. The meeting includes a COVID-19 update and a discussion on returning to in-person meetings.

appointmentscovid-19public-transportationsewersadministration
Tue Jun 8, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to discuss $235,620.87 general fund repayment proposal

The Nantucket Memorial Airport Commission is meeting to discuss a general fund repayment proposal and in-kind services. The body will also review PFAS investigation updates and a landing fee waiver request for the Nantucket Flying Association.

airportbudgetenvironmentreal-estatepersonnel
Remote Participation Via Zoom
Tue Jun 8, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss diversity and equity

The Visitor Services Advisory Committee will meet to review reports and approve previous minutes. The agenda includes a discussion with Kimal McCarthy, the Town Director of Diversity, Equity and Inclusion.

visitor-servicesdiversity-equity-inclusiontown-administration
Tue Jun 8, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review Union Lodge Masons signs and guidelines

The Sign Advisory Council is reviewing sign applications for the Union Lodge Masons on Main Street. The council will also discuss updates to sign guidelines and a construction sign letter for the Nantucket Builders Association.

signszoningmain-streetbusiness-regulations
Tue Jun 8, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review Cisco Beach food vendor proposal

The Nantucket Islands Land Bank Commission will meet to discuss property management and transfer business. The session includes a review of a mobile food vendor proposal for Cisco Beach and financial authorizations for bond payments.

land-bankreal-estatepublic-beachfinance
Tue Jun 8, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee prepares for June 24 virtual open house

The committee is reviewing the Coastal Resilience Plan's mid-project report and preparing for a second virtual open house. Members will also receive updates on various coastal resilience projects and engineering assessments.

coastal-resilienceflood-riskinfrastructurepublic-engagementenvironmental-planning
Mon Jun 7, 2021 · 00:00

Select Board

Select Board to discuss Annual Town Meeting

The Select Board is scheduled to meet on June 7, 2021. The agenda includes a discussion regarding the Annual Town Meeting if necessary.

governmenttown-meeting
Mon Jun 7, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda available for this meeting. The provided text consists of a list of old business items carried over from the May 25, 2021, meeting.

zoninghistoric-districtresidential-development
Mon Jun 7, 2021 · 00:00

Historic District Commission

No agenda available for Historic District Commission meeting

There is no formal agenda available for this meeting. The record lists old business regarding apartment buildings at 2 Pimpernel Place and 2 Wildflower Drive.

historic-districtapartment-buildingsnantucket
Mon Jun 7, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over building and site applications

The commission is reviewing a series of carried-over new business items from May 18, 2021. The meeting focuses on applications for new dwellings, additions, and exterior alterations within the historic district.

zoninghistoric-districtbuilding-permitshousingsolar
Mon Jun 7, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various residential property applications

The commission is reviewing several residential projects including additions, sheds, fences, and window changes. These items are listed under the consent agenda for consideration.

zoningresidentialhistoric-preservationconstruction
Mon Jun 7, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property applications

The Historic District Commission is reviewing several categories of property applications including consent items, old business, and new business. These items include requests for sheds, additions, new dwellings, pools, and solar installations.

zoninghistoric-preservationhousingconstruction
Mon Jun 7, 2021 · 00:00

Tuckernuck Advisory Board

Tuckernuck Advisory Board discusses rooftop solar and board appointments

The board will review two rooftop solar projects for properties on Tuckernuck. Members will also discuss the appointment of advisory and associate board members for fiscal year 2022.

solarhousinggovernment-appointmentstuckernuck
Mon Jun 7, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews several residential additions and new dwellings

The Sconset Advisory Board (HDC) is reviewing multiple applications for residential construction projects. These include additions, a pool installation, and new dwelling constructions.

zoningresidentialconstructionhousing
Mon Jun 7, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews several residential dwelling and addition projects

The Sconset Advisory Board will conduct a preliminary review of old business regarding various residential properties. Discussion includes new dwellings, additions, and a pool installation.

zoningresidentialconstructionsconset
Mon Jun 7, 2021 · 00:00

Planning Board

Planning Board meeting on June 7, 2021

The Planning Board will meet to discuss technical changes for the 2021 Annual Town Meeting. The agenda also includes provisions for call to order, other business, and public comment.

governmenttown-meetingplanning
Mon Jun 7, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission meeting scheduled for June 7, 2021

The Nantucket Islands Land Bank Commission is meeting to discuss the Annual Town Meeting if needed. The agenda contains no other specific business items.

town-meetingland-bank
Mon Jun 7, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential alterations and new builds

The Historic Structures Advisory Board is reviewing several applications for property alterations and new construction. The board will consider revisions to existing structures and proposals for new dwellings.

historic-preservationzoningresidential-constructionbuilding-permits
Mon Jun 7, 2021 · 00:00

Finance Committee

Finance Committee to discuss Annual Town Meeting items

The Finance Committee is scheduled to meet on June 7, 2020. The agenda includes discussion of the Annual Town Meeting if necessary.

financetown-meeting
Mon Jun 7, 2021 · 00:00

Council for Human Services

Council for Human Services discusses vaccine program and food security

The Council will receive an update on the COVID Vaccine Program from the Director of Human Services. The meeting includes a presentation by Process First regarding community food security and updates on a human services center initiative.

healthcovid-19food-securityeducationhuman-services
Mon Jun 7, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential projects on Prospect and Quaker Road

The Historic Structures Advisory Board is meeting to conduct preliminary reviews of several property projects. The board will discuss old business regarding residential construction and additions, as well as lighting provisions for the HDC general checklist.

historic-preservationzoninghousingconstruction
Mon Jun 7, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda provided for this Historic District Commission meeting. The document contains a list of project files but no stated items for discussion or decision.

procedural
Sun Jun 6, 2021 · 00:00

Planning Board

Planning Board meeting to discuss technical changes for the Annual Town Meeting

The Planning Board will meet to discuss potential technical changes regarding the 2021 Annual Town Meeting. The agenda also includes a call to order, approval of the agenda, other business, and public comment.

governmenttown-meetingplanning
Sun Jun 6, 2021 · 00:00

Planning Board

Planning Board meeting on June 6, 2021

The Planning Board will meet at the Nantucket Public Schools Backus Playing Field. The agenda includes a discussion regarding technical changes for the 2021 Annual Town Meeting.

governmenttown-meetingplanning
Sun Jun 6, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission continues Annual Town Meeting

The Nantucket Islands Land Bank Commission is meeting to continue the Annual Town Meeting that began on June 5, 2021.

land-banktown-meeting
Sun Jun 6, 2021 · 00:00

Nantucket Islands Land Bank Commission

Nantucket Islands Land Bank Commission Annual Town Meeting

The commission is scheduled to hold an Annual Town Meeting. This meeting serves as the rain date if the meeting does not occur on June 5, 2021.

town-meetingland-bank
Sun Jun 6, 2021 · 00:00

Finance Committee

Finance Committee meeting for Annual Town Meeting rain date

The Finance Committee is meeting as a rain date for the Annual Town Meeting. The agenda does not list specific items for decision or discussion beyond this purpose.

financetown-meetingprocedural
Sun Jun 6, 2021 · 00:00

Finance Committee

Finance Committee to continue Annual Town Meeting discussions

The Finance Committee is meeting to continue discussions from the June 5, 2021, Annual Town Meeting if necessary.

financetown-meeting
Sun Jun 6, 2021 · 00:00

Select Board

Select Board to continue Annual Town Meeting

The Select Board will meet at the Nantucket Public Schools Backus Playing Field. This meeting serves as a continuation of the Annual Town Meeting held on June 5, 2021.

governmentannual-town-meeting
Sun Jun 6, 2021 · 00:00

Select Board

Select Board schedules rain date for Annual Town Meeting

The Select Board is meeting for the Annual Town Meeting. This session serves as the rain date if the meeting does not occur on June 5, 2021.

town-meetinggovernance
Sat Jun 5, 2021 · 00:00

Finance Committee

Finance Committee to review technical amendments

The Finance Committee will meet to review and discuss technical amendments. This meeting takes place immediately before the Annual Town Meeting.

financetown-meeting
Sat Jun 5, 2021 · 00:00

Nantucket Islands Land Bank Commission

Nantucket Islands Land Bank Commission meeting scheduled for June 5

The commission is scheduled to meet at the Nantucket Public Schools Backus Playing Field. The agenda consists of the Annual Town Meeting.

government-meetingnantucket
Sat Jun 5, 2021 · 00:00

Planning Board

Planning Board to discuss 2021 Annual Town Meeting technical changes

The Planning Board is meeting to discuss potential technical changes for the 2021 Annual Town Meeting. The agenda consists primarily of procedural items and public comment.

town-meetingplanningprocedural
Sat Jun 5, 2021 · 00:00

Select Board

The Select Board will conduct the Annual Town Meeting

The Select Board is scheduled to hold the Annual Town Meeting on June 5, 2021. The meeting will take place at the Nantucket Public Schools – Backus Playing Field.

governmentannual-town-meeting
Fri Jun 4, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee discusses final report

The committee is meeting to discuss the finalization and approval of a report intended for the Select Board and Town Meeting. The meeting includes provisions for public comment and the setting of the next meeting date.

government-structuretown-administration
Fri Jun 4, 2021 · 00:00

Nantucket Public School Committee

School Committee conducts vacancy interviews

The Nantucket School Committee is meeting to interview candidates for a committee vacancy. The session will include interviews with Joe Plandowski and Anthony “Rocky” Fox.

school-committeeappointmentsinterviews
Fri Jun 4, 2021 · 00:00

Nantucket Historical Commission

DPW proposes infrastructure improvements for Sea Street Pump Station Force Main No.3

The Department of Public Works is presenting requested improvements and surface restorations following a 60% design review. The project includes sidewalk extensions, crosswalk additions, drainage updates, and cobblestone work across several streets including Sea, Liberty, and Winter Streets.

infrastructurepublic-workssidewalksroadsdrainage
Fri Jun 4, 2021 · 00:00

Nantucket Historical Commission

Commission to review Sewer Force Main #3 design plans

The Nantucket Historical Commission is holding a special meeting to review 75% designed plans for Sewer Force Main #3. The review will be conducted with consultants from Hazen & Sawyer & Environmental Partners as part of Section 106 requirements.

sewerinfrastructurehistorical-preservationsection-106
Thu Jun 3, 2021 · 00:00

Select Board

Select Board to discuss police bargaining and property matters

The Select Board and County Commissioners will meet via Zoom to conduct executive sessions. These private discussions include strategy regarding police collective bargaining, security deployment, beach ownership, and the Surfside Crossing permit appeal.

policesecurityreal-estatelitigationgovernment-operations
Thu Jun 3, 2021 · 00:00

Town Government Study Committee

Committee discusses finalization of report to Select Board and Town Meeting

The Town Government Study Committee is meeting to discuss the finalization of its report. The discussion includes determining topics for inclusion in the report and the approval of the final document.

government-studytown-administrationreport-finalization
Thu Jun 3, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Nantucket By-Law Committee meeting cancelled

The June 3, 2021, meeting of the By-Law Committee, a sub-committee of the Nantucket Planning & Economic Development Commission, was cancelled.

proceduralplanningby-laws
Thu Jun 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property modifications

The commission is reviewing several applications for residential alterations and additions. The meeting focuses on specific property changes including solar installations, pools, and structural additions.

historic-districtzoningsolarconstructionresidential
Thu Jun 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property applications and discusses Article 82

The Historic District Commission will discuss Article 82 and review numerous property applications. The agenda includes consent items for various structures, sign requests, and new business involving dwellings, pools, and solar installations.

zoninghistoric-preservationhousingconstruction
Thu Jun 3, 2021 · 00:00

Historic District Commission

Historic District Commission agenda contains no meeting items

There is no formal agenda available for this meeting. The provided text consists of a list of consent items and signs, but no specific discussion or decision topics are listed.

zoningsignageresidentialhistoric-district
Thu Jun 3, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no formal agenda provided for this Historic District Commission meeting. The document lists various new business items from May 18, 2021, but does not specify what will be decided or discussed.

historic-preservationzoningresidential-development
Thu Jun 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple residential construction projects

The commission is reviewing old business regarding various residential alterations and new constructions. The agenda consists of a list of properties pending review for dwellings, pools, and additions.

historic-districtzoningresidential-constructionbuilding-permits
Wed Jun 2, 2021 · 00:00

Council on Aging

Council on Aging discusses senior needs and program updates

The Council on Aging will discuss potential federal grant qualifications for seniors and caregivers. The meeting includes reports on Human Services, Covid-19 Task Force activities, Saltmarsh programs, and Elder Services of Cape Cod and the Islands.

seniorshuman-servicescovid-19healthcaregovernment-programs
Wed Jun 2, 2021 · 00:00

Finance Committee

Finance Committee to review technical amendments to the 2021 Annual Town Meeting Warrant

The Finance Committee will meet via Zoom to discuss potential technical amendments to articles in the 2021 Annual Town Meeting Warrant. The meeting also includes a review of previous meeting minutes and committee reports.

budgetgovernment-operationstown-meeting
Wed Jun 2, 2021 · 00:00

Finance Committee

Finance Committee holds pre-annual town meeting conference

The Finance Committee is meeting for a pre-annual town meeting conference with the moderator. The agenda contains no other specific discussion items or decisions.

financetown-meetingprocedural
Wed Jun 2, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss final report

The committee is meeting to discuss the finalization of a report intended for the Select Board and Town Meeting. The discussion will focus on the topics and motions to be included in that report.

town-governmentreportlocal-administration
Wed Jun 2, 2021 · 00:00

Select Board

Select Board to hold pre-annual town meeting conference

The Select Board is meeting for a pre-annual town meeting conference with the moderator. No other substantive items are listed on the agenda.

town-meetingadministrationprocedural
Wed Jun 2, 2021 · 00:00

Select Board

Select Board discusses short-term rental impact fees and reviews town contracts

The Select Board will review various town warrants, pending contracts, and departmental reports. Discussion includes options for a community impact fee on short-term rentals and updates on town projects.

zoningbudgethousinginfrastructuregovernment-administration
Wed Jun 2, 2021 · 00:00

Select Board

Select Board to discuss community impact fees for short-term rentals

The Select Board will review town project bids and discuss the possibility of imposing a community impact fee on short-term rentals. The meeting also includes reports on COVID-19 and post-Memorial Day activities.

short-term-rentalsinfrastructurecontractspublic-safetyzoning
Tue Jun 1, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications and guideline updates

The Sign Advisory Council is reviewing sign applications for various properties, including multiple requests for 30 Main Street. The council will also discuss updates to sign guidelines and a potential vote on a construction sign letter to the Nantucket Builders Association.

signszoningland-usenantucket
Tue Jun 1, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on Teaching Assistant contract and multiple donations

The Nantucket Public School Committee will vote on the 2021-2024 Teaching Assistant Collective Bargaining Agreement. The body will also consider several donations to NCS and CPS and discuss a $50,000 reduction in the NCS MOU subsidy.

educationcontractsdonationsbudget
Tue Jun 1, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board to discuss oyster lease revocations and boat regulations

The Harbor & Shellfish Advisory Board will review reports from the Marine and Natural Resources departments. The board is discussing the revocation of an oyster lease permit and updates to regulations for liveaboards and boat Airbnbs.

shellfishharbor-regulationswater-qualitydredgingenvironment
Tue Jun 1, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses HPP draft and program parameters

The Affordable Housing Trust is reviewing a draft Housing Production Plan (HPP) and discussing the Closing Cost Assistance Program. The meeting also includes updates on various housing project loans, grants, and property acquisitions.

affordable housinghousing production planreal estategrantsloans
Tue Jun 1, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review HPP draft and Closing Cost Assistance Program

The Affordable Housing Trust will continue its review of the draft Housing Production Plan (HPP) and evaluate parameters for the Closing Cost Assistance Program (CCAP). The board will also discuss outreach for the Annual Town Meeting and hold an executive session regarding real property.

affordable-housinghousing-production-planreal-estatetown-meeting
Thu May 27, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple Notices of Intent

The Nantucket Conservation Commission is meeting to review several Notices of Intent and requests for amended orders of conditions. The body will also consider certificates of compliance for various properties.

conservationpublic-hearingland-useenvironment
Thu May 27, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to discuss and decide on a large volume of applications for residential and commercial property changes. These include requests for new dwellings, pools, additions, and rooftop solar installations across various Nantucket addresses.

zoninghistoric-preservationbuilding-permitssolar-energyresidential-development
Thu May 27, 2021 · 00:00

Nantucket Housing Authority

Nantucket Housing Authority to discuss income limits and occupancy rules

The Nantucket Housing Authority is meeting to consider adopting revised income limits for admission and fair market rents for occupancy in state-aided public housing. The board will also review vouchers and appoint a member to the NP&EDC.

housingpublic-housingincome-limitsappointments
Thu May 27, 2021 · 00:00

Town Government Study Committee

Committee discusses finalization of report to Select Board and Town Meeting

The Town Government Study Committee is meeting to discuss the finalization of its report. The discussion includes determining which topics to include in the report and related motions.

government-studytown-administration
Wed May 26, 2021 · 00:00

County Commission

County Commission to review payroll and treasury warrants

The County Commission is meeting to approve minutes from March 24, 2021, and authorize payroll and treasury warrants for April and May 2021. The remainder of the agenda consists of procedural items and public comment.

budgetadministrationfinance
Wed May 26, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss final report

The committee is meeting to discuss the finalization of its report to the Select Board and Town Meeting. The discussion will focus on the topics to be included in the report and related motions.

government-studytown-reportadministration
Wed May 26, 2021 · 00:00

Select Board

Select Board to hold public hearings on land taking and new licenses

The Select Board will discuss COVID-19 updates, real estate agreements, and town project bids. The meeting includes public hearings regarding the taking of portions of North Road and applications for entertainment and liquor licenses.

zoninglicensingpublic-worksreal-estatebudget
Wed May 26, 2021 · 00:00

Select Board

Select Board to hold public hearings on land taking and new licenses

The Select Board will conduct public hearings regarding the taking of portions of North Road in Siasconset and applications for new entertainment and liquor licenses. The board will also review real estate agreements and provide updates on COVID-19 and town project bids.

real-estatelicensingpublic-hearingsroadszoning
Tue May 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing old business carried over from the May 3, 2021 meeting. The items consist of various applications for additions, new dwellings, and exterior modifications.

historic-districtzoningbuilding-permitshousing
Tue May 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews projects for Easy St and Low Beach Road

The commission is reviewing carried-over new business from April 27, 2021. The meeting focuses on specific property modifications and structures.

historic-districtzoningland-usenantucket
Tue May 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews signs and property modifications

The commission is reviewing several requests for signs and property alterations. The agenda includes multiple as-built filings for structures at 168 Hummock Pond Road.

historic-districtsignszoningproperty-modifications
Tue May 25, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property and sign applications

The Historic District Commission is meeting to review a high volume of applications for property alterations, new constructions, and signage. The body will consider consent items, new business, and old business regarding residential and commercial structures.

zoninghistoric-preservationconstructionsignagesolar
Tue May 25, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property requests and personnel promotion

The Nantucket Islands Land Bank Commission will review monthly reports for Sconset and Miacomet golf courses and various property use requests. The body will also consider the promotion of the Assistant Director to Executive Director.

property-managementpersonnelgolf-coursesreal-estate
Tue May 25, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications and update guidelines

The Sign Advisory Council is meeting to review sign applications for several properties on Main Street, Center Street, Old North Wharf, and India Street. The council will also discuss sign guidelines and a construction sign letter for the Nantucket Builders Association.

signszoningbusiness-permitsland-use
Tue May 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations

The commission is reviewing a large volume of carried-over new business items from May 18, 2021. The meeting consists of reviews for residential additions, new dwellings, and exterior modifications.

zoninghistoric-districtresidentialconstructionsolar
Tue May 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple residential construction projects

The commission is reviewing old business regarding various residential alterations and new constructions. The items include requests for new dwellings, additions, and pools across several properties.

historic-districtzoningresidential-constructionhousing
Tue May 25, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews sign applications for downtown properties

The Sign Advisory Council is reviewing applications for wall, projecting, and fence signs at various locations. The body will evaluate specific sign requests for properties on Main Street, Center Street, India Street, and Old North Wharf.

signszoningbusiness-permitsnantucket
Tue May 25, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to hold public information session on housing insecurity

The Affordable Housing Trust will hold a public information session featuring a panel discussion on how housing insecurity affects the community. Municipal Housing Director Tucker Holland will present on the Trust's ongoing work to address the crisis.

affordable-housinghousing-insecuritypublic-information
Tue May 25, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review progress on resilience plan

The committee is meeting to discuss the Mid Project Report and public engagement efforts for the Coastal Resilience Plan. Members will provide feedback to the project team and discuss public educational exhibits.

coastal-resilienceenvironmental-planningpublic-engagementinfrastructure
Mon May 24, 2021 · 00:00

Finance Committee

Finance Committee discusses grouping of Annual Town Meeting Articles

The Finance Committee is meeting to discuss and potentially adopt a motion to group Annual Town Meeting Articles 38, 90, and 97. The committee will also hold an Annual Town Meeting information session.

financetown-meetingbudget
Mon May 24, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 22 property alteration requests

The Historic Structures Advisory Board is meeting to review new and additional business regarding property modifications. The board will discuss specific projects including new dwellings, additions, and demolitions. The meeting also includes discussions on outdoor lighting regulations and screening in the OHD.

historic-preservationzoningdemolitionbuilding-permitslighting-regulations
Mon May 24, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple property alterations

The board is reviewing applications for additions, demolitions, and exterior changes to various properties. The agenda consists of a series of project filings for board consideration.

historic-preservationzoningdemolitionbuilding-permits
Mon May 24, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review new dwelling and pool projects

The Sconset Advisory Board is meeting to continue discussions on two specific property projects. The board will review a proposal for a new dwelling and a request for a pool and hardscape.

zoninghousingland-usesconset
Sat May 22, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to discuss Town Warrant Articles

The committee is meeting to discuss Town Warrant Articles and potential advocacy for the Annual Town Meeting. Members will also review the Nantucket Civic League ‘Meet the Articles Forum’ and plan future meeting topics.

town-meetingadvocacytransportationenergyparking
Fri May 21, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to review historic pavement and tax credits

The Nantucket Historical Commission will discuss the preservation of historic pavement and review a Historic Tax Credit application for 6 Gull Island. The body will also conduct Section 106 reviews for Sewer Main #3 and Sparks Ave.

historic-preservationtax-creditsinfrastructurezoning
Fri May 21, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to review historic pavement and tax credits

The Commission will discuss policies for protecting historic pavement and review historic tax credit eligibility for 6 Gull Island. The body is also reviewing Section 106 compliance for the Sparks Ave and Sewer Main #3 projects.

historic-preservationtax-creditszoninginfrastructurepublic-policy
Fri May 21, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Madaket Area Plan Work Group to discuss project approach and roles

The Madaket Area Plan Work Group is meeting to discuss the high-level approach for the project. The group will also determine necessary roles and initial assignments.

planningmadaketeconomic-development
Thu May 20, 2021 · 00:00

Nantucket Public School Committee

Nantucket School Committee meeting cancelled

The meeting scheduled for May 20, 2021, has been cancelled.

schoolsprocedural
Thu May 20, 2021 · 00:00

Nantucket Water Commissioners

Water Commissioners to discuss solar power and PFAS project

The Nantucket Water Commissioners will review production and billing reports and receive updates on the Airport PFAS project and solar power at Wannacomet Water Company. The board will also discuss Article 91 for the June 5, 2021, Annual Town Meeting.

water-utilitysolar-powerpfascontractstown-meeting
Thu May 20, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee discusses final report

The committee is meeting to discuss the finalization of a report intended for the Select Board and Town Meeting. The discussion will focus on the topics to be included in the report and related motions.

town-governmentreportlocal-administration
Thu May 20, 2021 · 00:00

Board of Health

Board of Health to discuss COVID-19 updates and septic-to-sewer extensions

The Nantucket Board of Health will review specific property septic and sewer issues and consider a six-month extension for septic-to-sewer connections. The board will also discuss COVID-19 updates and emergency orders.

public-healthsewersepticcovid-19housing
Thu May 20, 2021 · 00:00

Cannabis Advisory Committee

Cannabis Advisory Committee to elect officers and set future direction

The Cannabis Advisory Committee is meeting to confirm member participation and elect officers. The committee will also discuss updates from the Town Meeting and determine the future focus and direction of the group.

cannabiscommittee-governancetown-meeting
Thu May 20, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee meeting cancelled

The Tree Advisory Committee meeting scheduled for May 20, 2021, has been cancelled.

treesenvironment
Thu May 20, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee discusses final report and Charter amendments

The committee is discussing the finalization of a report for the Select Board and Town Meeting. Members are proposing and voting on specific amendments to the Town Charter regarding administrative transparency and board authority.

town-chartergovernment-studytransparencyadministrative-reform
Thu May 20, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to discuss and decide on a large volume of applications for residential and commercial property changes. These include new dwellings, pool installations, rooftop solar, and structural demolitions.

zoninghistoric-preservationhousingsolardemolition
Thu May 20, 2021 · 00:00

Cyrus Peirce Middle School

Cyrus Peirce Middle School Council to discuss 2021-22 scheduling and testing

The CPS School Council is meeting to discuss student transitions and the 2021-22 schedule. The body will also review MCAS testing updates and the Grade 8 celebration.

educationschool-counciltestingscheduling
Thu May 20, 2021 · 00:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council to discuss MCAS and hiring updates

The Nantucket Intermediate School Council will meet to receive updates on MCAS and hiring. The body will also discuss end-of-year celebrations.

educationschool-councilmcashiring
Wed May 19, 2021 · 00:00

Abatement Advisory Committee

Abatement Advisory Committee to review FY2021 real estate abatement applications

The committee is meeting to discuss new business and approve minutes from February 28, 2019. The primary focus of the meeting is an executive session to review real estate abatement applications for Fiscal Year 2021.

taxesreal-estateabatementsfiscal-year-2021
Wed May 19, 2021 · 00:00

Select Board

Select Board to hold public hearings on utility petitions and review contracts

The Select Board will conduct public hearings regarding National Grid utility installations on Hummock Pond Road and Sherburne Turnpike. The board is also reviewing several pending contracts for town services and equipment. Additionally, they will discuss the modified committee appointment process.

utilitiescontractspublic-safetyinfrastructuregovernment
Wed May 19, 2021 · 00:00

Select Board

Select Board to hold public hearings on utility petitions for Hummock Pond Road and Folger Road

The Select Board will consider utility petitions from National Grid/Nantucket Electric Company and review pending contracts. The board is also discussing a modified committee appointment process and receiving a COVID-19 weekly update.

utilitiescontractspublic-hearingspolicesewergovernment
Tue May 18, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss oyster lease and boat regulations

The Harbor & Shellfish Advisory Board will meet to discuss updates on boat Airbnb and liveaboard regulations and a draft letter to the Select Board regarding an oyster lease permit revocation. The board will also review reports from the Marine and Natural Resources departments.

shellfishboatingwater-qualityharbor-managementenvironment
Tue May 18, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews fund requisitions totaling over $100,000

The Community Preservation Committee is meeting to ratify and review fund requisitions for several local organizations. The committee will also acknowledge the service of former member Mark Voigt.

grantsfundingcommunity-preservation
Tue May 18, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a high volume of applications for residential and commercial modifications. The body will decide on a variety of projects including new dwellings, additions, and signage.

zoninghistoric-preservationconstructionsolarsignage
Tue May 18, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing old business carried over from the May 3, 2021 meeting. The items consist of various residential property modifications and new construction requests.

historic-districtzoningresidential-constructionsolar
Tue May 18, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property applications

The Historic District Commission is reviewing a large volume of new business items regarding residential properties. These items include requests for new dwellings, additions, pools, solar installations, and various exterior alterations.

zoningresidentialhistoric-preservationconstruction
Tue May 18, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple residential property modifications

The commission is reviewing applications for additions, roof changes, and sheds across various properties. The agenda lists several requests for fenestration and hardscape changes. No formal meeting agenda was provided beyond the list of application documents.

historic-districtzoningresidential-constructionbuilding-permits
Tue May 18, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss sidewalk and road projects

The committee is meeting to receive updates on sidewalk projects and the taking of Winn Street and partial Somerset Road. The agenda also includes discussions on Chapter 91 and outstanding projects.

roadssidewalksinfrastructureright-of-way
Tue May 18, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review 12 sign applications and update guidelines

The Sign Advisory Council is reviewing applications for projecting, wall, and informational signs at various properties. The council will also discuss updating sign guidelines and a potential vote on a construction sign letter to the Nantucket Builders Association.

signszoningland-useregulations
Tue May 18, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential construction and demolition requests

The commission is reviewing carried-over new business items from April 27, 2021. The agenda consists of applications for new dwellings, additions, pools, and demolitions at various properties.

historic-districtzoningdemolitionhousingconstruction
Tue May 18, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review 12 sign applications

The Sign Advisory Council is meeting to review applications for various signs on Nantucket. The agenda consists of requests for projecting, public information, wall, flag, and fence signs.

signszoningbusiness-permitsnantucket
Tue May 18, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review property purchases and loan documents

The Affordable Housing Trust will discuss the purchase of 18 Vesper Lane and a CFAP application for 40 Essex Road. The board will also review and approve loan and grant documents for Wildflower Commons Richmond Phase 2A.

affordable-housingreal-estateloansgrants
Tue May 18, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review property purchases and loan documents

The Affordable Housing Trust will discuss the purchase of 18 Vesper Lane from the University of Massachusetts and review loan and grant documents for Wildflower Commons. The body will also consider a Covenant Formation Assistance Program application for 40 Essex Road.

affordable-housingreal-estategrantsloanszoning
Mon May 17, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential construction and demolition requests

The Sconset Advisory Board is reviewing several applications for new dwellings, pools, and structural modifications. The meeting includes requests for new construction and the movement of a demolition cottage.

zoninghousingconstructionsconset
Mon May 17, 2021 · 00:00

Nantucket Planning & Economic Development Commission

NP&EDC to vote on 2022-2026 Transportation Improvement Program

The Nantucket Planning & Economic Development Commission is meeting to approve the FFY 2022-2026 Transportation Improvement Program after the public review period. The commission will also consider authorizing the release of the FFY 2022 Unified Planning Work Program for a 21-day public comment period.

transportationplanninginfrastructurepublic-comment
Mon May 17, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews 12 property development applications

The Sconset Advisory Board is meeting to review new business applications for residential construction and landscaping. The board will also discuss repairs to the North Gully Road footpath.

zoningconstructionlandscapingsconsetroads
Mon May 17, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss final report

The committee is meeting to discuss the finalization of a report intended for the Select Board and Town Meeting. The discussion will focus on the topics and motions to be included in that report.

government-studytown-reportselect-board
Mon May 17, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to review transportation programming and public comment periods

The Nantucket Planning & Economic Development Commission is meeting to discuss transportation programming documents. The body will consider authorizing a public comment period for the FFY 2022 UPWP and approving the FFY 2022-2026 Transportation Improvement Program.

transportationplanningpublic-comment
Mon May 17, 2021 · 00:00

Conservation Commission

Conservation Commission to review Siasconset Beach Preservation Fund

The Nantucket Conservation Commission is meeting to conduct a 2020 annual review. The commission will also discuss a matter regarding the Siasconset Beach Preservation Fund.

conservationbeach-preservationenvironmental-review
Mon May 17, 2021 · 00:00

Council for Human Services

Council for Human Services to discuss food security and community center

The Council for Human Services will receive updates on the COVID vaccine program and a community initiative for a human services center. The body will also hear a presentation on community food security and discuss potential projects regarding school bullying and police blotter publications.

human-servicespublic-healthfood-securityeducationcommunity-development
Mon May 17, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 16 property modification requests

The Historic Structures Advisory Board is reviewing a series of applications for new dwellings, additions, and renovations. The board will also discuss outdoor lighting regulations and inadequate screening in the OHD.

historic-preservationzoningbuilding-permitshousing
Mon May 17, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple residential additions and renovations

The Historic Structures Advisory Board is reviewing several applications for residential modifications, including new dwellings, additions, and window replacements. The agenda includes requests for garage construction, driveway aprons, and fenestration changes across various properties.

zoningresidentialhistoric-preservationconstruction
Mon May 17, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews three property projects

The Madaket Advisory Board is meeting to discuss new business regarding three specific property projects. The board will review proposed scopes of work including renovations and additions.

land-useconstructionmadaketzoning
Mon May 17, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to finalize report for Select Board and Town Meeting

The committee is meeting to discuss the finalization of its report to the Select Board and Town Meeting. The discussion will focus on the specific topics and motions to be included in the final report.

town-governmentcharter-reviewlocal-government
Fri May 14, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property and sign applications

The Historic District Commission is meeting to review a large volume of applications for residential modifications, new dwellings, and signage. The body will decide on consent items, new business applications, and old business regarding property alterations.

zoninghistoric-preservationresidential-developmentsolarsignage
Fri May 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various property modifications

The commission is reviewing several requests for consent regarding residential structures and exterior changes. Items include solar arrays, roof changes, garages, and fences across multiple locations.

zoningresidentialsolarconstructionhistoric-preservation
Fri May 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing new business items carried over from the April 27, 2021 meeting. The agenda consists of a list of property applications for review.

historic-districtzoningdemolitionresidential-construction
Fri May 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential additions and new dwellings

The commission is addressing old business carried over from May 3, 2021. The meeting involves reviewing various residential property modifications and new construction projects.

historic-districtzoningresidential-constructionsolar
Thu May 13, 2021 · 00:00

Nantucket Elementary School Council

Nantucket Elementary School Council to review handbook and improvement plan

The Nantucket Elementary School Council will meet to review the school's handbook and School Improvement Plan. The body will also approve minutes from the April 1, 2021 meeting.

educationschool-councilschool-improvement-planhandbook
Thu May 13, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee reviews charter revisions and final report

The committee is meeting to review charter revisions provided by the Town Counsel’s office. Members will also discuss the finalization of a report and related motions for the Select Board and Town Meeting.

town-governmentcharter-revisionlocal-governance
Thu May 13, 2021 · 00:00

Town Government Study Committee

Committee discusses charter revisions and report finalization

The Town Government Study Committee is reviewing proposed charter revisions from the Town Counsel's office. Members are discussing how to finalize their report for the Select Board and Town Meeting, including potential recommendations regarding various town commissions.

government-studycharter-revisiontown-governancemunicipal-law
Thu May 13, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review residential permits and lot subdivisions

The Zoning Board of Appeals will hold public hearings to discuss special permits and variances for residential properties. The board is considering requests for lot subdivisions, building height extensions, and the use of a deck for outdoor classes.

zoningspecial-permitsvariancesresidentialland-use
Thu May 13, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review property subdivisions and permit modifications

The Board will consider requests for special permits and variances regarding residential property alterations and lot subdivisions. The meeting includes a request to withdraw a subdivision application and a request to continue a permit modification hearing.

zoningspecial-permitsvariancesresidential-housing
Thu May 13, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review residential permits and yoga studio modification

The Board is considering special permits for residential additions and lot subdivisions. The meeting includes a request to allow outdoor classes at a yoga studio to accommodate social distancing.

zoningspecial-permitsresidentialcommercial-usepublic-hearings
Wed May 12, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss green burials and cemetery surveys

The Nantucket Cemetery Commission will meet to approve lot sales and minutes. The body will discuss green burials, cemetery survey updates, and a burial plot for cremains abandoned with the Town Clerk.

cemeteriesland-usepublic-records
Wed May 12, 2021 · 00:00

Real Estate Assessment Committee

Committee reviews land takings and a subdivision restriction modification

The Real Estate Assessment Committee is meeting to discuss specific land parcels and a request for a recommendation to the Select Board. The body will review orders of taking for the Town and a petition to modify a deed restriction.

real-estateland-useproperty-assessmenttown-deeds
Wed May 12, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee to review land takings and deed modifications

The committee will discuss town orders of taking for specific parcels and a request to modify a subdivision restriction. The meeting includes a review of land transfers and recommendations for the Select Board.

real-estateland-usezoningtown-property
Wed May 12, 2021 · 00:00

Select Board

Select Board discusses shellfish licenses and town meeting information

The Select Board will consider public hearings regarding private shellfish aquaculture license renewals and a revocation. The meeting also includes updates on the upcoming Annual Town Meeting and road blockings for sewer improvements.

shellfishinfrastructuregovernment-meetingspublic-hearingssewer
Wed May 12, 2021 · 00:00

Select Board

Select Board to hold public hearings on shellfish aquaculture licenses

The Select Board will conduct public hearings regarding the renewal and revocation of private shellfish aquaculture licenses. The meeting also includes COVID-19 updates and a request for a noise bylaw waiver for sewer work.

shellfishlicensingsewerpublic-healthgovernment
Tue May 11, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review grant request for Benjamin Drive project

The Affordable Housing Trust will discuss a grant request from Habitat for Humanity and review the draft HPP. The board will also consider assistance applications for specific residential properties.

affordable-housinggrantshousing-assistancereal-estate
Tue May 11, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review Habitat for Humanity grant and housing programs

The Affordable Housing Trust will discuss a grant request for the Benjamin Drive project and review applications for closing cost and covenant formation assistance. The body will also review a draft Housing Production Plan.

affordable-housinggrantshousing-production-planreal-estate
Tue May 11, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss real estate acquisitions and park updates

The Nantucket Islands Land Bank Commission is meeting to review property management updates and financial authorizations. The commission will also hold an executive session to discuss real estate acquisitions.

real-estateparksfinanceland-bankpublic-works
Tue May 11, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign requests and update guidelines

The Sign Advisory Council is meeting to review sign applications for several properties and discuss updates to sign guidelines. The body will also consider a vote on a construction sign letter addressed to the Nantucket Builders Association.

signszoningpublic-worksguidelines
Tue May 11, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews five sign applications

The Sign Advisory Council is reviewing applications for wall, projecting, and education panel signs at five different locations. The body will determine the approval of these specific signage requests.

signagezoningland-usenantucket
Tue May 11, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss Summer 2021 travel predictions

The Visitor Services Advisory Committee is meeting to review travel predictions for Summer 2021. The discussion includes input from the Nantucket Memorial Airport Assistant Manager and a member of the Steamship Authority Board of Governors.

tourismtransportationairportsteamship-authority
Tue May 11, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission reviews nearly $1M grant for safety and security equipment

The Nantucket Memorial Airport Commission is meeting to discuss grant funding, noise abatement, and PFAS investigations. The body will also consider a concession relief grant and updates to scheduled air carrier standards.

airportgrantssafetyenvironmentreal-estate
Remote Participation Via Zoom
Mon May 10, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews property modifications

The Historic Structures Advisory Board is reviewing a series of old and new business items regarding property alterations. The board will discuss specific scopes of work for residential and commercial addresses, as well as outdoor lighting and screening regulations.

historic-preservationzoningbuilding-permitslighting-regulations
Mon May 10, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential modifications

The board is meeting to address carried-over business regarding several residential property requests. The discussion focuses on additions, decks, and new structures at specific addresses.

historic-preservationzoningresidential-construction
Mon May 10, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews six property modifications

The board is reviewing applications for exterior changes to six residential properties. These items were carried over from the May 18, 2021, meeting.

historic-preservationzoningresidential-permitsnantucket
Mon May 10, 2021 · 00:00

Planning Board

Planning Board to review multiple housing and land division requests

The Planning Board is meeting to discuss secondary dwellings, garage apartments, and After Neighborhood Record (ANR) plans. The agenda includes several public hearings for specific property addresses and reviews of preliminary and sketch plans for Sparks Avenue.

zoninghousingland-usepublic-hearings
Mon May 10, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review pool and hardscape project on Hydrangea Lane

The Sconset Advisory Board is meeting to review a property project and discuss local infrastructure. The board will consider a proposal for a pool and hardscape at 03-3265 6 + 8 Hydrangea Lane.

land-usehardscapeinfrastructuresconset
Mon May 10, 2021 · 00:00

Planning Board

Planning Board to review zoning map changes and multiple land use applications

The Planning Board will discuss a technical zoning map amendment for Osprey, Tautemo Way, and Hummock Pond Road. The board is also reviewing several applications for second dwellings, garage apartments, and land subdivisions.

zoningland-usehousingpublic-hearingssubdivisions
Thu May 6, 2021 · 00:00

Conservation Commission

Nantucket Conservation Commission meeting on May 6, 2021

The Commission will conduct a public meeting via Zoom and YouTube. The agenda includes several Notices of Intent, minor modifications, and certificates of compliance.

conservationland-usepublic-hearingnantucket
Thu May 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property applications and sign requests

The Historic District Commission is reviewing various property applications including new dwellings, additions, and renovations. The agenda also includes a review of several sign-related requests and ongoing business from previous meetings.

zoninghistoric-preservationresidentialconstructionsignage
Thu May 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various property modifications

The commission is reviewing several applications for exterior changes including fences, signs, and color updates. These items are presented under the categories of Consent, Consent With Conditions, and Signs.

zoninghistoric-preservationsignageresidential-construction
Thu May 6, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no formal agenda provided for this Historic District Commission meeting. The record contains only supplemental documents related to specific properties.

historic-preservationzoningresidential
Thu May 6, 2021 · 00:00

Parks and Recreation Commission

The May 6 Parks and Recreation Commission meeting is cancelled

The scheduled meeting for the Nantucket County Parks and Recreation Commission on May 6, 2021, has been cancelled.

cancellation
Thu May 6, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee discusses final report and investigation topics

The committee is meeting to discuss unresolved items on its list of topics to investigate. Members will also discuss the finalization of a report intended for the Select Board and Town Meeting.

government-studytown-administrationreporting
Thu May 6, 2021 · 00:00

Select Board

Select Board to discuss real estate and litigation in executive session

The Select Board and County Commissioners will meet via Zoom to conduct an executive session. The board will discuss the value or lease of several properties and legal strategies regarding wind energy and development permits.

real-estatelitigationwind-energyzoning
Wed May 5, 2021 · 00:00

Select Board

Select Board to review sewer contracts and housing development letter

The Select Board will discuss COVID-19 updates, budget reports, and the 2021 Annual Town Meeting. The body is deciding on several municipal contracts and requests to increase spending limits for airport and municipal funds.

sewerhousingbudgetparkingcontracts
Wed May 5, 2021 · 00:00

Select Board

Select Board discusses committee vacancies and town budget reports

The Select Board will review various departmental requests, including airport fuel and municipal aggregation spending limits. The meeting also includes updates on the Surfside Road Sewer Improvements Project and upcoming Annual Town Meeting information.

budgetinfrastructurepublic-worksgovernment-administrationzoning
Wed May 5, 2021 · 00:00

Council on Aging

Council on Aging to discuss Senior Man and Senior Woman of the Year

The Council on Aging will meet via Zoom to conduct official business. The meeting includes a discussion regarding nominations for Senior Man and Senior Woman of the Year.

senior-servicesawards
Wed May 5, 2021 · 00:00

Golf Capital Workgroup

Golf Capital Planning Workgroup to discuss course improvements

The Golf Capital Planning Workgroup is meeting to discuss business and projects for the Sconset and Miacomet golf courses. The group will review master plan updates and construction costs.

golf-coursescapital-planninginfrastructurerecreation
Tue May 4, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review 15 sign applications and guideline updates

The Sign Advisory Council is meeting to review various sign applications for properties on Centre Street, Freedom Square, Washington Street, Main Street, Federal Street, Chestnut Street, and India Street. The council will also discuss updating sign guidelines and a construction sign letter for the Nantucket Builders Association.

signszoningbusiness-permitsland-use
Tue May 4, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews six sign applications

The Sign Advisory Council is reviewing applications for wall and projecting signs at six different locations. The body will determine the approval or revision of these signage requests.

signagezoningbusiness-permits
Tue May 4, 2021 · 00:00

Nantucket Public School Committee

School Committee discusses return to in-person learning and campus planning

The Nantucket School Committee will discuss the return to in-person learning for CPS and NHS. The body will also review a Master Campus Plan presentation from SMRT and a 3rd Quarter Budget Update.

educationbudgetcampus-planningpublic-schools
Mon May 3, 2021 · 00:00

Council for Human Services

Council for Human Services to discuss police blotter and middle school bullying

The Council for Human Services will meet to discuss requests regarding the publication of the police blotter and the body's role in addressing middle school bullying. The meeting also includes updates on the COVID vaccine program and a community initiative for a human services center.

human-servicespublic-safetyeducationhealthcommunity-development
Mon May 3, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property applications

The Historic District Commission is meeting to discuss and decide on a large volume of new and old business applications. These items primarily concern new dwellings, demolitions, and property alterations across various Nantucket addresses.

zoninghistoric-preservationdemolitionsolarhousing
Mon May 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews demolition and renovation requests

The commission is reviewing carried-over new business from April 6, 2021. The agenda includes requests for a building demolition and a garage addition.

historic-districtdemolitionrenovationzoning
Mon May 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is addressing old business carried over from the April 20, 2021 meeting. The agenda consists of a list of property applications for review.

historic-districtzoningbuilding-permitsresidential-construction
Mon May 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential construction projects

The commission is reviewing applications for new dwellings, additions, and outbuildings. The provided record contains project documents but no formal agenda text.

historic-districtzoningresidential-constructionbuilding-permits
Mon May 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing a large volume of new business items carried over from April 27, 2021. The items consist of applications for new dwellings, additions, and modifications to properties within the historic district.

zoninghistoric-districthousingsolardemolition
Mon May 3, 2021 · 00:00

Historic District Commission

Historic District Commission reviews old business for multiple properties

The commission is reviewing old business regarding various residential additions, pools, and new dwellings. No formal agenda was provided for this meeting.

historic-districtzoningresidential-constructionsolar
Mon May 3, 2021 · 00:00

Historic Structures Advisory Board (HDC)

HDC to review fenestration work at 16 Western Avenue

The Historic Structures Advisory Board will conduct a preliminary review of a project at 16 Western Avenue. The board will also discuss outdoor lighting regulations and screening in the OHD.

historic-preservationzoninglighting-regulations
Mon May 3, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review metal roof proposal and footpath repairs

The board will conduct a preliminary review of a metal roof project at 32 New St. Members will also discuss repairs for the North Gully Road footpath.

zoningresidentialinfrastructuresconset
Mon May 3, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews metal roof violation at 32 New St

The board is reviewing documentation regarding a metal roof at 32 New St. The materials include a failed HDC inspection, a violation notice, and previous historic determinations.

historic-district-commissionbuilding-violationssconsetroofing
Fri Apr 30, 2021 · 00:00

Commission on Disability

Commission on Disability to review variance request for 21 South Water Street

The Commission on Disability will meet to discuss a variance request regarding accessibility at 21 South Water Street. The body will also approve minutes from the March 19, 2021, meeting.

disability-accesszoning-variancepublic-accessibility
Fri Apr 30, 2021 · 00:00

Historic District Commission

HDC to discuss conceptual plans for 27 N. Liberty St

The Historic District Commission will hold a special meeting to discuss a conceptual proposal for an addition and move at 27 N. Liberty Street. The commission will also review policies regarding move/demo hearings and the consent agenda for new dwellings.

historic-districtzoningland-useresidential-development
Fri Apr 30, 2021 · 00:00

Historic District Commission

HDC reviews North Liberty Streetscape plan and 27 N Liberty St

The Historic District Commission is reviewing documents related to a streetscape plan and a sub-division addition. No formal agenda was provided for this meeting.

historic-districtstreetscapezoningnantuket
Fri Apr 30, 2021 · 00:00

Board of Health

Board of Health to discuss COVID-19 updates and mask order

The Nantucket Board of Health will meet to provide updates on COVID-19 and Emergency Order number 13 regarding masks. The meeting includes a period for public comment.

healthcovid-19public-safetymasks
Thu Apr 29, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to discuss a high volume of applications for new dwellings, additions, and demolitions. The body will also review specific consent items and discuss policies regarding move/demo hearings and hardscaping.

zoninghistoric-preservationdemolitionsolarhousing
Thu Apr 29, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to discuss Water Service Agreement

The Nantucket Memorial Airport Commission is meeting to discuss and possibly adopt a Water Service Agreement. Public comment will be invited on this item.

airportwater-serviceinfrastructure
Remote Participation Via Zoom
Wed Apr 28, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee meets to discuss investigation topics and report finalization

The committee will review unresolved items from its list of topics to investigate. Members will also discuss the finalization of a report intended for the Select Board and Town Meeting.

government-structuretown-administrationreporting
Wed Apr 28, 2021 · 00:00

Select Board

Select Board discusses COVID-19 updates and various licensing requests

The Select Board will review a weekly COVID-19 update including reports from the Public Health Director and Economic Task Force. The meeting includes several public hearings regarding new business licenses and utility petitions.

covid-19licensingpublic-healthinfrastructurepublic-hearings
Wed Apr 28, 2021 · 00:00

Select Board

Select Board discusses liquor licenses, public hearings, and various town contracts

The Select Board will review several public hearing applications for food, entertainment, and alcohol licenses. The meeting also includes updates on COVID-19 resources and a joint session with the NRTA Advisory Board regarding commuter bus service.

licensingpublic-hearingscovid-19transportationgovernment-business
Wed Apr 28, 2021 · 00:00

Conservation Commission

Commission to discuss Siasconset Beach preservation project

The Nantucket Conservation Commission will meet via Zoom and YouTube. The commission will enter executive session to consider property values and litigation strategy regarding the Siasconset Beach Preservation Fund Geotextile Tube Project.

conservationbeach-preservationlitigationreal-property
Tue Apr 27, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to discuss coastal resilience around Nantucket Harbor

The Coastal Resilience Advisory Committee will discuss resilience efforts for areas east of Coatue Point and Monomoy Creeks, extending to Coskata and Wauwinet. The meeting includes presentations from conservation organizations, town biologists, and local homeowner associations.

coastal-resilienceenvironmentnantucket-harborconservationshellfish
Tue Apr 27, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is reviewing a large volume of applications for residential and municipal property changes. The body is deciding on requests for new dwellings, additions, demolitions, and exterior modifications to maintain historic standards.

zoninghistoric-preservationdemolitionresidential-constructionsigns
Tue Apr 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations

The commission is reviewing a large volume of consent items, conditional consents, and sign requests. These items involve exterior modifications to residential and commercial properties within the historic district.

historic-districtzoningsignsdemolitionconstruction
Tue Apr 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential construction and alterations

The commission is reviewing carried-over new business items from April 6, 2021. The meeting focuses on various residential applications for new dwellings, additions, and exterior modifications.

historic-districtzoningresidential-constructionbuilding-permits
Tue Apr 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property alterations

The commission is reviewing old business carried over from April 20, 2021. The meeting consists of applications for additions, new dwellings, and exterior modifications to various properties.

historic-districtzoningbuilding-permitsresidential-development
Tue Apr 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations

The Commission is reviewing new business applications for various residential and mixed-use projects. These items include requests for new dwellings, additions, and solar installations within the historic district.

historic-districtzoningsolardemolitionconstruction
Tue Apr 27, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple property alterations

The commission is reviewing applications for new dwellings, additions, and exterior modifications. The meeting includes reviews for rooftop solar installations and pool hardscaping.

historic-districtzoningbuilding-permitssolarresidential
Tue Apr 27, 2021 · 00:00

Nantucket Cultural Council

Council discusses fund reallocation and virtual award reception

The Nantucket Cultural Council will discuss reallocating funds currently granted to Out to See Foundation to The Lizza Show. Members will also discuss the possibility of holding a virtual award reception.

artsfundingcommunity-programs
Tue Apr 27, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss golf course reviews and property improvements

The Nantucket Islands Land Bank Commission will review monthly reports for Sconset and Miacomet golf courses and provide updates on improvement projects. The body will also vote on amending the dog ban for Land Bank properties.

golf-coursesproperty-managementreal-estatelitigationpublic-lands
Tue Apr 27, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review multiple sign applications and political sign rules

The Sign Advisory Council is meeting to discuss regulations for 30-day political signs and review several sign applications. The body will also discuss updates to sign guidelines and a potential letter to the Nantucket Builders Association regarding construction signs.

signszoningpolitical-signsconstruction
Tue Apr 27, 2021 · 00:00

Sign Advisory Council (HDC)

Historic District Commission reviews several wall and street signs

The Historic District Commission is reviewing multiple sign applications for various properties. These include wall signs at Chestnut St, India St, Center St, and Manors House, as well as a private road sign on Russells Way.

zoningsignagehistoric-preservation
Mon Apr 26, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 20 property modification requests

The Historic Structures Advisory Board is meeting to review old and new business regarding property alterations. The board will discuss specific structural changes, new dwellings, and solar installations. Additional discussion items include outdoor lighting regulations and the 'Resilient Nantucket' Community Design Guideline update.

historic-preservationzoningsolarbuilding-permitscommunity-design
Mon Apr 26, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple residential and mixed-use projects

The Historic District Commission is reviewing several applications for new dwellings, additions, and structural changes. Items include window modifications, solar panel installations, and various building renovations across several streets.

zoningresidentialhistoric-preservationconstruction
Mon Apr 26, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review seven property improvement requests

The Madaket Advisory Board will discuss new business regarding several residential construction projects. The board is reviewing requests for new dwellings, studios, pools, and other structures.

zoningland-useresidential-constructionmadaket
Mon Apr 26, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews multiple residential construction projects

The board is reviewing several building applications for properties on Mississippi Ave and Warrens Landing Rd. These items include requests for sheds, garages, gazebos, pools, and a new dwelling.

zoningbuilding-permitsresidential-construction
Mon Apr 26, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to authorize public comment on 2022-2026 Transportation Improvement Program

The Nantucket Planning & Economic Development Commission is meeting to discuss action items and approve previous minutes. The primary focus is the authorization of a 21-day public comment period for transportation programming documents.

transportationinfrastructurepublic-comment
Mon Apr 26, 2021 · 00:00

Nantucket Planning & Economic Development Commission

NP&EDC discusses bike path maintenance and Harbor Place development

The Commission reviewed a DPW report regarding the assessment and maintenance of the town's 35-mile bike path network. Members also discussed updates on the Harbor Place project, including ownership changes and historic preservation considerations.

transportationzoninginfrastructureeconomic developmenthistoric preservation
Mon Apr 26, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board discusses various property renovations and design guidelines

The Sconset Advisory Board will review several new business items involving residential additions, renovations, and dwellings. The board will also discuss North Gully Road footpath repairs and the Resilient Nantucket Community Design Guideline update.

zoningresidentialconstructiondesign-guidelinesinfrastructure
Mon Apr 26, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review 11 property alteration requests

The Sconset Advisory Board is reviewing applications for residential renovations, additions, and landscaping. The board will consider specific changes to structures and outdoor amenities across various properties.

zoningresidentialconstructionlandscapingsconset
Fri Apr 23, 2021 · 00:00

Commission on Disability

The April 23, 2021, Commission on Disability meeting is cancelled

The scheduled meeting for the Commission on Disability has been cancelled. There are no items listed for discussion or decision.

cancelled-meeting
Thu Apr 22, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 19 notices of intent

The Nantucket Conservation Commission is meeting to conduct public hearings for 19 notices of intent and review requests for determinations and modifications. The body will also discuss the issuance of orders of conditions for various properties and town projects.

conservationpublic-hearingsenvironmental-permitsland-use
Thu Apr 22, 2021 · 00:00

Conservation Commission

Conservation Commission reviews multiple land and water resource items

The Conservation Commission is reviewing various applications, requests, and reports regarding land use and storm water management. Items include projects by the Town of Nantucket DPW, Nantucket Islands Land Bank, and several private property owners.

conservationstorm-waterland-usetown-projectsproperty-development
Thu Apr 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property applications and roofing discussions

The Historic District Commission is reviewing various property applications including new dwellings, additions, and garages. The agenda also includes a discussion regarding alternative roof shingles and grey shingles within the OHD/SOHD.

zoninghistoric-preservationhousingconstruction
Thu Apr 22, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential exterior projects

The commission is reviewing consent items for residential property modifications. The agenda does not provide a formal list of discussion items or decisions.

historic-districtzoningresidential-permits
Wed Apr 21, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss unresolved investigation topics

The Town Government Study Committee will meet to discuss unresolved items on its list of topics to investigate. A specific point of discussion includes expanding or redefining the roles of the Town Government Study Committee and the Town Governance Committee.

town-governmentcommittee-rolesgovernance
Tue Apr 20, 2021 · 00:00

Historic District Commission

Historic District Commission reviews sign and building requests

The commission is reviewing applications for signs, a building addition, and a color change. The agenda consists of a list of properties seeking certificates of appropriateness.

historic-districtsignszoningbuilding-permits
Tue Apr 20, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing several carried-over applications for property alterations. These items include requests for new construction, renovations, and landscaping changes within the historic district.

historic-districtzoningresidential-constructionlandscaping
Tue Apr 20, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing old business carried over from the March 30, 2021 meeting. The agenda consists of a list of property applications for review.

historic-districtzoningbuilding-permitshousing
Tue Apr 20, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing a list of carried-over new business items from April 6, 2021. The items consist of various residential construction and renovation requests.

historic-districtzoningconstructionresidential
Tue Apr 20, 2021 · 00:00

Historic District Commission

No meeting agenda is available for the April 20, 2021, meeting

There is no formal agenda provided for this Historic District Commission meeting. The record contains a list of old business files related to various residential properties.

historic-preservationresidentialzoning
Tue Apr 20, 2021 · 00:00

Historic District Commission

Historic District Commission reviews three property modifications

The commission is reviewing applications for additions, hardscaping, and other modifications to specific properties. No formal agenda text was provided beyond the project documents.

historic-districtzoningproperty-modificationsnantucket
Tue Apr 20, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Board reviews proposals for 7 New Street

The Historic Structures Advisory Board is reviewing multiple proposals for 7 New Street. The items include a garage connector, fenestration, and a studio.

historic-preservationzoningbuilding-permits
Tue Apr 20, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss Harbor Walk and street takings

The committee will discuss public access and education following a Chapter 91 forum, including the Harbor Action Plan. Members will also receive updates on the Winn Street and partial Somerset Road taking, as well as sidewalk projects.

roadsright-of-waysidewalkspublic-accessharbor-walk
Tue Apr 20, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications and mission statement

The Sign Advisory Council is reviewing several sign applications for businesses on Federal Street, Sanford Road, Straight Wharf, Broad Street, and Centre Street. The council will also discuss and potentially vote on a mission statement and a construction sign letter to the Nantucket Builders Association.

signszoningbusiness-permitsnantucket
Tue Apr 20, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews sign applications for downtown Nantucket

The Sign Advisory Council is reviewing applications for various signs at multiple locations. The body will consider requests for projecting, wall, and letter signs.

signagezoningbusiness-permitsnantucket
Tue Apr 20, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review closing cost assistance applications

The Affordable Housing Trust will discuss applications for the Closing Cost Assistance Program. The board will also receive updates on the HPP and preparations for the Annual Town Meeting.

affordable-housinghousing-trustclosing-costs
Tue Apr 20, 2021 · 00:00

Community Preservation Committee

The April 20, 2021 Community Preservation Committee meeting is cancelled

The scheduled meeting for the Community Preservation Committee on April 20, 2021, has been cancelled. There are no items listed for discussion or decision.

cancelled-meeting
Tue Apr 20, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss oyster leases and dredging

The board will review reports from the Marine and Natural Resources departments. Members will discuss regulations for boat Airbnbs and liveaboards, oyster lease permits, and dredging plans to address sand in scallops.

shellfishharbor-managementdredgingenvironmental-healthboating-regulations
Tue Apr 20, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property and sign applications

The Historic District Commission is meeting to review applications for new dwellings, additions, and exterior alterations. The body will also consider several sign requests and process denials for unresponsive applicants.

zoninghistoric-preservationhousingsignssolar
Fri Apr 16, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss MHC survey grant and road sign limits

The Commission will review updates to a Massachusetts Historical Commission survey plan and the evaluation of ATM Article 82 regarding road sign limitations. The body will also discuss the Section 106 review for Sewer Main #3 and policies for preserving town-owned sidewalks.

historic-preservationzoninginfrastructuregrantsroads
Fri Apr 16, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to review Sewer Main #3 and road sign limits

The commission is meeting to discuss the MHC Survey grant and the evaluation of ATM Article 82 regarding road sign limitations. The body will also review Section 106 projects and the preservation of town-owned historic resources.

historic-preservationinfrastructurezoninggrantspublic-works
Thu Apr 15, 2021 · 00:00

Board of Health

Board of Health to review multiple variance requests for local businesses and properties

The Board of Health is reviewing several variance applications related to food service and property standards. The meeting includes requests for flooring and food preparation variances, as well as toilet facility regulations for food service establishments.

public-healthvariancesfood-serviceregulations
Thu Apr 15, 2021 · 00:00

Board of Health

Board of Health to review septic loans and multiple variance requests

The Nantucket Board of Health will discuss a MAHB grant application and review several loan releases and septic repairs. The board is also considering multiple variances for flooring, bathroom requirements, and sewer connections. Updates on COVID-19 and 2020 tick-borne disease data are on the agenda.

healthsepticvariancespublic-healthsewer
Thu Apr 15, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential and sign applications

The Historic District Commission is reviewing a series of applications for exterior modifications to residential properties and commercial signage. The meeting focuses on consents and consents with conditions for various structural and aesthetic changes.

historic-districtzoningresidential-modificationssignage
Thu Apr 15, 2021 · 00:00

Historic District Commission

No meeting agenda is available for the April 15, 2021, meeting

There is no agenda provided for this Historic District Commission meeting. The document lists several items carried over from a March 23, 2021, meeting regarding various residential projects.

historic-preservationresidentialzoningconstruction
Thu Apr 15, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing several applications for additions, pools, and structural changes to residential properties. The agenda does not list formal motions or votes.

historic-districtzoningresidential-constructionnantucket
Thu Apr 15, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for residential and commercial modifications. The body will decide on consent items, sign plans, and new business regarding dwellings, garages, and pools.

zoninghistoric-preservationresidential-constructionsignagesolar-energy
Thu Apr 15, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on School Choice participation for 2021-2022

The Nantucket Public School Committee will discuss the return to in-person learning for middle and high schools. The body will vote on School Choice participation for the 2021-2022 academic year and a scholarship donation from the Karp Family Foundation. The meeting includes presentations from Veritas, ELPAC, and SNAC.

educationschool-choicescholarshipsin-person-learningschool-board
Thu Apr 15, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to discuss parking and loading zone requests

The Traffic Safety Work Group is meeting to discuss several parking and zoning requests across the town. The body will review specific requests for no-parking zones, loading areas, and school zone designations.

traffic-safetyparkingzoningpublic-safety
Thu Apr 15, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to discuss parking and encroachments

The Traffic Safety Work Group is meeting to review several parking requests and discuss property encroachments. The body will consider signage and zoning changes for specific residential and commercial streets.

parkingtraffic-safetyzoningroadsencroachments
Thu Apr 15, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee to review tree removal requests and credit policies

The Tree Advisory Committee is meeting to discuss tree removal appeals, maintenance plans, and planting policies. The body will also review specific credit balances for the Nantucket Tree Fund and individual accounts.

treeszoningpublic-worksenvironment
Wed Apr 14, 2021 · 00:00

Select Board

Nantucket Select Board meets to discuss noise waivers and preservation restrictions

The Select Board will consider requests for noise bylaw waivers for various public works projects. The meeting also includes a review of historic preservation restrictions and a public hearing regarding a new stop sign on Coffin Street.

public-workszoninghistoric-preservationtrafficgovernment
Wed Apr 14, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss lot sales and cemetery project updates

The Nantucket Cemetery Commission is meeting to approve lot sales and minutes from March 10, 2021. The body will discuss cemetery surveys, a burial plot for cremains, and developments at Polpis Cemetery and Quaise Monument.

cemeteriesland-surveyspublic-records
Wed Apr 14, 2021 · 00:00

Nantucket Housing Authority

NHA to discuss property transfer of Lots 17B and 17C to Habitat

The Nantucket Housing Authority is meeting to review administrative reports and vouchers. The body will discuss the transfer of ownership for two lots to Habitat and accounting service contracts.

housingreal-estatecontractsgovernment-administration
Wed Apr 14, 2021 · 00:00

Select Board

Select Board discusses stop sign installation and various town projects

The Select Board will consider a public hearing regarding a permanent stop sign on Coffin Street. The meeting also includes updates on COVID-19, road construction projects, and several departmental requests.

public-safetyinfrastructurezoningpublic-workscovid-19
Tue Apr 13, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission discusses FAA grants, MassDOT awards, and airport operations

The Nantucket Memorial Airport Commission is reviewing several grant agreements and pending expenditures. Discussion items include a federal coronavirus relief grant, various MassDOT grant awards, and updates on PFAS investigations.

airportgrantsfinanceinfrastructuregovernment-funding
Remote Participation Via Zoom
Tue Apr 13, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee meeting on April 13, 2021

The committee will meet via Zoom to review previous minutes and hear reports. The agenda includes a conversation with the NCMC Executive Director and reports from the Director and VS Coordinator.

government-operationstourism
Tue Apr 13, 2021 · 00:00

Coastal Resilience Advisory Committee

Scope of work for Baxter Road engineering feasibility assessment

The Coastal Resilience Advisory Committee is reviewing a scope of work by Arcadis to assess Baxter Road and related infrastructure from Sankaty Lighthouse to Butterfly Lane. The project includes stakeholder engagement, an analysis of up to five alternatives such as bluff stabilization or road relocation, and a final memorandum of recommendations.

coastal-resilienceengineeringinfrastructuresiasconsetpublic-works
Tue Apr 13, 2021 · 00:00

Coastal Resilience Advisory Committee

Nantucket Coastal Resilience Plan Mid Project Summary Report released

The Coastal Resilience Advisory Committee is reviewing a draft Mid Project Summary Report. The document analyzes coastal hazards and risks to buildings, transportation, utilities, and natural resources on Nantucket.

climate-resiliencecoastal-hazardsinfrastructureenvironmentplanning
Tue Apr 13, 2021 · 00:00

Select Board

Select Board workshop on Baxter Road engineering feasibility

The Select Board will hold a workshop meeting with the Coastal Resilience Advisory Committee, town staff, and Arcadis. The discussion focuses on the Baxter Road engineering feasibility assessment.

coastal-resilienceengineeringinfrastructurebaxter-road
Tue Apr 13, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission discusses property management and real estate acquisition

The Commission will discuss several property management items including employee housing renovations and a site plan amendment. The meeting includes an executive session regarding potential real estate acquisitions.

property-managementreal-estatehousingzoning
Tue Apr 13, 2021 · 00:00

Select Board

Select Board holds workshop on Baxter Road engineering feasibility

The Select Board met with the Coastal Resilience Advisory Committee and Arcadis to discuss a feasibility assessment for Baxter Road. The session focused on addressing coastal bluff erosion and evaluating potential engineering alternatives to protect public infrastructure.

coastal-resilienceinfrastructureerosionbaxter-roadengineering
Tue Apr 13, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications for Federal Street and other locations

The Sign Advisory Council is meeting to discuss several sign applications, including a master sign plan and projecting signs. The council will also consider a construction sign letter to the Nantucket Builders Association.

signsland-usebusiness-permits
Tue Apr 13, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews several sign applications

The Sign Advisory Council is reviewing multiple sign applications for various locations. These include letter signs, projecting signs, hanging signs, and wall signs.

signsbusinesszoning
Tue Apr 13, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee to review Baxter Road Engineering Feasibility Assessment

The Coastal Resilience Advisory Committee is holding a workshop with the Select Board, town staff, and Arcadis. The group will discuss the Baxter Road Engineering Feasibility Assessment, including project alternatives and the prioritization of solutions.

coastal-resilienceinfrastructurebaxter-roadengineering
Tue Apr 13, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review mid-project plan report

The committee will receive a mid-project report from the Coastal Resilience Plan Project Team regarding coastal risk assessment and community engagement. The meeting also includes updates on youth climate initiatives and upcoming resilience forums.

coastal-resilienceclimate-changeenvironmental-planningpublic-engagement
Mon Apr 12, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews property additions and design guidelines

The board will review several new business items including dormer and shed additions, rooftop solar, and chimney/roof work. Members will also discuss the placement of a historic sign at 36 Main Street and updates to the Resilient Nantucket Community Design Guidelines.

zoninghistoric-preservationresidential-developmentcommunity-design
Mon Apr 12, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews roof and window work at 33 N Liberty Street

The Historic Structures Advisory Board will conduct a preliminary review of proposed roof and window work for Thomas Montgomery at 33 N Liberty Street. The board will also discuss community design guidelines and outdoor lighting regulations.

zoninghousingdesign-guidelineshistoric-preservation
Mon Apr 12, 2021 · 00:00

Planning Board

Planning Board reviews dwelling applications and public hearings

The Planning Board is reviewing several residential development applications including secondary dwellings, garage apartments, and tertiary dwellings. The agenda also includes multiple Applications for Residential (ANR) and various public hearings.

zoninghousingresidentialpublic-hearing
Mon Apr 12, 2021 · 00:00

Planning Board

Nantucket Planning Board discusses second dwellings, garage apartments, and ANR plans

The Planning Board will review several applications for second dwellings, garage apartments, tertiary dwellings, and subdivisions. The agenda also includes a public hearing regarding a zoning map change for Appleton Road, Bartlett Road, and Perry Lane.

zoninghousingland-useresidential
Mon Apr 12, 2021 · 00:00

Finance Committee

Finance Committee to review Annual Town Meeting warrant articles and airport projects

The Finance Committee will review and approve comments for selected 2021 Annual Town Meeting Warrant Articles. The body will also review and revote on capital projects for Airport Improvement Projects.

budgetairporttown-meetingcapital-projects
Sat Apr 10, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers meeting on April 10, 2021

The committee will discuss Town Warrant Articles and potential advocacy for the Annual Town Meeting. Discussion topics include a noise ordinance, remote meeting propositions, and updates on Harbor Place and energy initiatives.

government-operationstown-meetingnoise-ordinanceenergytransportation
Thu Apr 8, 2021 · 00:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council discusses in-person school reports and new positions

The council will receive a report regarding the first week of all in-person instruction. The meeting also includes discussion of new staff positions for the 2021-22 school year.

educationschool-councilstaffing
Thu Apr 8, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple land use intents

The Nantucket Conservation Commission is meeting via Zoom and YouTube to conduct public hearings on several Notices of Intent. The body will also review requests for determination and minor modifications for various properties.

conservationland-usepublic-hearingenvironment
Thu Apr 8, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to review setback and height relief requests

The Board of Appeals is conducting public hearings for three properties seeking modifications to special permits or variances. Decisions will focus on side yard setbacks and building height nonconformities.

zoningsetbacksspecial-permitshousing
Thu Apr 8, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review beach programming and master plan addenda

The commission is discussing tentative plans for July 4 and Children’s Beach programming. The body will also review a recommended maintenance plan and sub-plan addenda for the Jetties area.

parks-and-recreationbeach-programmingmaster-planpublic-space
Thu Apr 8, 2021 · 00:00

Select Board

Select Board to discuss real estate and collective bargaining in executive session

The Select Board and County Commissioners will meet via Zoom to conduct an executive session. The board will discuss collective bargaining strategy and the value or purchase of four specific real estate properties.

real-estatecollective-bargainingexecutive-session
Thu Apr 8, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to hear three special permit and variance requests

The Zoning Board of Appeals will hold initial public hearings and consider votes on three property modifications. These include requests to change dwelling usage, adjust side yard setbacks, and alter a nonconforming building height.

zoningspecial-permitvariancehousing
Thu Apr 8, 2021 · 00:00

Zoning Board of Appeals

ZBA discusses dwelling modifications and setback relief

The Zoning Board of Appeals will consider three new business items involving residential properties. These include requests to modify existing permits for a studio, validate a bulkhead setback, and allow for a dwelling addition.

zoningresidentialsetbacksdwellings
Wed Apr 7, 2021 · 00:00

Select Board

Select Board to hold public hearing on outdoor dining expansion

The Select Board will conduct a public hearing regarding applications for 2021 outdoor dining expansions and alterations. The board will also review several municipal contracts and discuss a new lease for the Nantucket Hunting Association.

outdoor-diningcontractszoningpublic-healthinfrastructure
Wed Apr 7, 2021 · 00:00

Select Board

Select Board to hold public hearing on 2021 outdoor dining expansions

The Select Board will consider applications for outdoor dining expansions and alterations. The meeting includes updates on COVID-19, the DEI office, and the Surfside Road sewer project. The board will also review various professional service contracts and lease requests.

outdoor-diningcontractspublic-healthinfrastructurezoning
Wed Apr 7, 2021 · 00:00

Council on Aging

Council on Aging to discuss 2021 Seniors of the Year recognition

The Council on Aging will meet to discuss recognition plans for the 2021 Seniors of the Year. The body will also receive reports on pandemic-related programming and human services.

seniorscovid-19community-servicesarts-and-culture
Tue Apr 6, 2021 · 00:00

Finance Committee

Finance Committee meeting for April 6, 2021, cancelled

The scheduled meeting of the Finance Committee was cancelled. The original agenda included a continued joint meeting with the Select Board and Planning Board to review the final 2021 Annual Town Meeting Warrant.

financetown-warrant
Tue Apr 6, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss oyster leases and dredging

The board will review oyster lease permits and discuss a dredging plan to address excessive sand in scallops. The meeting also includes updates on boat Airbnb and liveaboard regulations, as well as lawn fertilizer use.

shellfishdredgingboatingenvironmentharbor-management
Tue Apr 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews dozens of property applications

The Historic District Commission is reviewing various property applications including sheds, decks, roofs, and pools. The agenda includes items for consent with specific visibility conditions and a list of new business items for upcoming discussion.

zoninghistoric-preservationresidentialconstruction
Tue Apr 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple property applications

The commission is reviewing numerous requests for residential modifications and additions. These items are categorized under consent or consent with conditions.

zoningresidentialhistoric-preservation
Tue Apr 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various sign applications

The commission is reviewing several applications for projecting, wall, and hanging signs across multiple locations. There is no formal meeting agenda provided beyond these specific project files.

zoningsignshistoric-preservationbusiness
Tue Apr 6, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple property modification requests

The commission is reviewing applications for property alterations, including solar installations and pool construction. No formal agenda text was provided, but supporting documents for specific addresses are listed.

historic-districtzoningsolarresidential-construction
Tue Apr 6, 2021 · 00:00

Planning Board

The April 6, 2021 Planning Board meeting has been cancelled

This meeting was scheduled as a continuation of the Planning Board joint meeting with the Select Board and Finance Committee. The meeting has been cancelled.

procedural
Tue Apr 6, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda available for this meeting. The document lists several items of old business carried over from the March 30, 2021, meeting.

historic-preservationresidential-developmentconstruction
Tue Apr 6, 2021 · 00:00

Select Board

The April 6, 2021 Select Board meeting has been cancelled

The Nantucket Select Board meeting scheduled for April 6, 2021, at 4:00 PM via Zoom has been cancelled.

administrative
Tue Apr 6, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews sign applications and construction letter

The Sign Advisory Council will review several sign applications for various properties across Nantucket. The council may also discuss a possible vote regarding a construction sign letter to the Nantucket Builders Association.

signszoningbusiness
Tue Apr 6, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews various sign applications

The Sign Advisory Council is reviewing multiple applications for projecting and wall signs across several locations. The agenda includes individual sign requests for properties on India St, Macy's Ln, Federal St, Broad St, S Water St, Washington St, Old South Rd, Centre St, and Orange St.

signsbusiness-licensingzoning
Mon Apr 5, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews new dwelling and addition requests

The Sconset Advisory Board is meeting to review several property applications, including requests for new dwellings and additions. The board will also discuss the 'Resilient Nantucket' community design guidelines and the placement of a historic marker at 36 Main Street.

zoninghousinghistoric-preservationcommunity-design
Mon Apr 5, 2021 · 00:00

Council for Human Services

Council for Human Services to discuss vaccine program and funding allocations

The Council for Human Services will receive updates on the COVID vaccine program and the introduction of a Community Health Nurse. Members will discuss Town funding and Marijuana Tax allocations via the Contract Review Committee and review future initiatives.

human-servicescovid-19public-healthbudgetmarijuana-tax
Mon Apr 5, 2021 · 00:00

Finance Committee

Finance Committee to review final 2021 Annual Town Meeting Warrant

The Finance Committee is holding a joint meeting with the Select Board and Planning Board. The body will review the final 2021 Annual Town Meeting Warrant and its associated motions.

financetown-meetingbudgetplanning
Mon Apr 5, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple property projects

The Historic Structures Advisory Board will discuss various residential additions, renovations, and new constructions. The board also intends to discuss the "Resilient Nantucket" community design guideline update.

zoningresidentialconstructionhistoric-preservationdesign-guidelines
Mon Apr 5, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews various residential property applications

The Historic District Commission is reviewing multiple applications for residential additions, renovations, and site changes. These items include requests for new dwellings, pool installations, and window or door replacements across several locations.

zoningresidentialhistoric-preservationconstruction
Mon Apr 5, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews residential construction and renovation projects

The Madaket Advisory Board is meeting to discuss several property modification requests. The board will review a new dwelling and various home improvements including a spa, deck, and roofing changes.

zoningconstructionresidential-permitsmadaket
Mon Apr 5, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews five residential property modifications

The board is reviewing plans for decks, patios, stairs, a spa, and roof changes at five different addresses. These items are presented as documents for the board's consideration.

zoningresidentialbuilding-permitsmadaket
Mon Apr 5, 2021 · 00:00

Planning Board

Planning Board to discuss ATM Warrant Articles 39-64

The Planning Board is holding a joint meeting with the Select Board and Finance Committee. The body will discuss motions and comments regarding ATM Warrant Articles 39-64.

planningwarrant-articlesgovernment
Mon Apr 5, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews several new dwelling and addition applications

The board is reviewing multiple applications for new dwellings, garages, sheds, and dormer additions. These items include residential projects on Cannonbury Lane, Low Beach Road, and Hedge Row.

zoningresidentialconstructionsconset
Mon Apr 5, 2021 · 00:00

Select Board

Select Board to review final 2021 Annual Town Meeting Warrant

The Select Board is holding a joint meeting with the Finance Committee and Planning Board. The body will review the final 2021 Annual Town Meeting Warrant and its associated motions.

town-meetingbudgetplanninggovernance
Mon Apr 5, 2021 · 00:00

Select Board

Select Board to review final 2021 Annual Town Meeting Warrant

The Select Board is holding a joint meeting with the Finance Committee and Planning Board. The purpose of the meeting is to review the final 2021 Annual Town Meeting Warrant and its associated motions.

budgetzoningroadstown-meetingbylaws
Fri Apr 2, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review Sustainable Nantucket facility

The Nantucket Islands Land Bank Commission is meeting to conduct a tour of the Sustainable Nantucket facility. The commission will review infrastructure requests at 168 Hummock Pond Road.

land-bankinfrastructuresustainable-nantucket
Thu Apr 1, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss closing cost assistance revisions

The Affordable Housing Trust will meet to discuss potential changes to the Closing Cost Assistance Program. The board may also consider applicable closing costs for a property at 2A South Pasture Lane.

affordable-housingclosing-costsreal-estate
Thu Apr 1, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property applications

The Historic District Commission is meeting to discuss a high volume of new and old business applications. The body will review requests for new dwellings, pools, hardscaping, and rooftop solar installations across various town properties.

zoninghistoric-preservationhousingsolarland-use
Thu Apr 1, 2021 · 00:00

Nantucket Elementary School Council

Nantucket Elementary School Council to discuss in-person instruction

The Nantucket Elementary School Council will meet to review previous minutes and discuss report cards. The council will also discuss in-person instruction, specifically regarding safety protocols, class changes, and lunch/snack procedures.

educationschool-safetyelementary-school
Thu Apr 1, 2021 · 00:00

Nantucket Public School Committee

Nantucket School Committee to discuss return to in-person learning

The Nantucket School Committee will meet to discuss the return to in-person learning and review the District Report Card. The body will also receive reports on enrollment and dropout rates.

educationschool-committeestudent-enrollmentpublic-schools
Wed Mar 31, 2021 · 00:00

Conservation Commission

Conservation Commission to hold hearing on wetland regulation amendments

The Nantucket Conservation Commission is meeting to discuss amendments to the Town of Nantucket Conservation Commission Wetland Protection Regulations. The body will also review specific property conditions and compliance certificates.

wetlandsenvironmentzoningregulations
Wed Mar 31, 2021 · 00:00

Finance Committee

Finance Committee meeting for March 31, 2021, cancelled

The scheduled meeting of the Finance Committee was cancelled. The original agenda included a review of remaining articles in the 2021 Annual Town Meeting Warrant.

financetown-meetingcancelled
Tue Mar 30, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss NPEDC and committee roles

The Town Government Study Committee is meeting to hear a presentation regarding the NPEDC. Members will also discuss unresolved items concerning the Affordable Housing Trust Fund and the roles of the study and governance committees.

town-governmentaffordable-housingcommittee-structurenpedc
Tue Mar 30, 2021 · 00:00

Nantucket Water Commissioners

Water Commissioners to review PFAS project and solar power updates

The Nantucket Water Commissioners will meet to review production and billing reports. The board will discuss updates regarding a merger, solar power at Wannacomet Water Company, and the Airport PFAS project.

water-utilitysolar-powerpfasinfrastructure
Tue Mar 30, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss NPEDC and housing trust fund

The committee is meeting to review unresolved investigation topics and receive a presentation on the Nantucket Planning and Economic Development Commission (NPEDC). Discussions will include the potential for the Affordable Housing Trust Fund to become a town department.

town-governmentplanningaffordable-housinggovernance
Tue Mar 30, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss Housing Production Plan strategies

The Affordable Housing Trust will meet to review survey and focus group feedback regarding Nantucket’s Housing Production Plan. The body will discuss recommended strategies for housing production based on this feedback.

affordable-housinghousing-production-planplanning
Tue Mar 30, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration applications

The Historic District Commission is meeting to review a high volume of applications for residential modifications. The body will consider new dwellings, pools, and additions, as well as several rooftop solar installations.

zoninghistoric-preservationhousingsolarconstruction
Tue Mar 30, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential exterior modifications

The commission is reviewing several applications for residential exterior changes. These items are listed under consent or consent with conditions.

historic-districtzoningresidentialexterior-modifications
Tue Mar 30, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda available for this meeting. The provided text consists of a list of old business items carried over from the March 16, 2021, meeting.

historic-preservationresidentialconstruction
Tue Mar 30, 2021 · 00:00

Historic District Commission

Historic District Commission reviews old business for multiple properties

The commission is reviewing old business items for various residential projects. The provided text lists properties under consideration but does not include a formal agenda or specific decisions.

historic-districtzoningresidential-constructionnantucket
Tue Mar 30, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing applications for property alterations, including solar installations and pool construction. No formal agenda text was provided, but supporting documents list specific addresses for review.

historic-districtzoningsolarresidential-construction
Tue Mar 30, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant articles

The Finance Committee will review and discuss several articles for the 2021 Annual Town Meeting. Discussion includes various budget appropriations, fund transfers, and requests to increase revolving fund limits.

budgetfinancetown-meetinggovernment-operations
Mon Mar 29, 2021 · 00:00

Conservation Commission

Conservation Commission to review public hearings for DPW and Land Bank

The Nantucket Conservation Commission will conduct a public meeting via Zoom and YouTube. The agenda includes public hearings for Notices of Intent and potential Orders of Conditions regarding the Town of Nantucket DPW and Nantucket Islands Land Bank properties.

conservationpublic-hearingsdpwland-banknantucket
Mon Mar 29, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant Articles

The Finance Committee is meeting to review and discuss several articles for the 2021 Annual Town Meeting Warrant. The committee may adopt motions regarding these articles.

budgettown-meetingpublic-healthairportwater-safety
Mon Mar 29, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Board reviews new dwelling proposal at 14 Lowell Place

The Historic Structures Advisory Board is meeting to conduct a preliminary review and discuss old business. The board will also discuss updates to the Community Design Guideline regarding "Resilient Nantucket."

historic-preservationhousingdesign-guidelines
Mon Mar 29, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to discuss community design and historic signage

The Sconset Advisory Board will review a property addition and discuss updates to community design guidelines. The board will also discuss the placement of a historic marker at 36 Main Street.

community-designhistoric-preservationzoningsconset
Thu Mar 25, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 20 Notices of Intent

The Nantucket Conservation Commission is meeting to conduct public hearings for 20 Notices of Intent and discuss amended orders of conditions. The body will also review minor modifications and certificates of compliance for various properties.

conservationland-usepublic-hearingenvironment
Thu Mar 25, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant Articles

The Finance Committee is meeting to review and discuss several articles for the 2021 Annual Town Meeting Warrant. The committee may adopt motions regarding appropriations, bylaw amendments, and a home rule petition.

budgetappropriationsbylawstown-meetingpublic-finance
Thu Mar 25, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property applications

The Historic District Commission is meeting to discuss and decide on a large volume of new and old business applications. These items primarily concern new dwellings, additions, and hardscaping projects across various Nantucket properties.

zoninghistoric-preservationhousingsolarconstruction
Thu Mar 25, 2021 · 00:00

Nantucket Water Commissioners

Nantucket Water Commission meeting cancelled

The meeting scheduled for March 25, 2021, has been cancelled. No items were decided or discussed.

water-commissionprocedural
Wed Mar 24, 2021 · 00:00

Select Board

Select Board to hold public hearing on 2021 seasonal liquor license renewals

The Select Board will conduct a public hearing regarding seasonal liquor license renewals and review requests for housing project permits and sewer project noise waivers. The board will also address a decision regarding rooftop solar panels at 83/85 Eel Point Road.

liquor-licenseshousingsewersolarzoning
Wed Mar 24, 2021 · 00:00

Select Board

Select Board to consider Waitt Drive reconstruction contract and liquor license renewals

The Select Board will discuss COVID-19 updates and review several departmental requests. The body is deciding on pending contracts and a noise bylaw waiver for sewer improvements. A public hearing is scheduled for seasonal liquor license renewals.

roadscontractsliquor-licensessewerhousingsolar
Wed Mar 24, 2021 · 00:00

County Commission

Commission considers temporary easement for Sheep Pond Road access

The County Commission is meeting to discuss a temporary easement agreement for land on Head of Plains Road. The body will also review payroll and treasury warrants for March 2021.

easementsroadsgovernment-operations
Wed Mar 24, 2021 · 00:00

County Commission

County considers temporary access easement for Sheep Pond Road

The County Commissioners are reviewing a temporary easement agreement to provide emergency and public access for residents of Sheep Pond Road after a portion of the road eroded into the ocean. The agreement involves land on Head of Plains Road and is intended to remain in place for up to 12 months while a permanent solution is developed.

roadseasementspublic-safetyenvironment
Wed Mar 24, 2021 · 00:00

One Time Event

Contract Review Committee meeting scheduled for March 24, 2021

The Contract Review Committee will meet via Zoom to conduct business. The agenda includes a discussion and determination regarding a new grant.

grantsgovernment-business
Wed Mar 24, 2021 · 00:00

Nantucket Historical Commission

Commission to discuss preservation planning for streets and sidewalks

The Nantucket Historical Commission is meeting to provide comments on preservation planning. The discussion focuses on streets and sidewalks within The Nantucket Island National Historic Landmark.

historic-preservationstreetssidewalksnational-historic-landmark
Wed Mar 24, 2021 · 00:00

Nantucket Historical Commission

Historical Commission urges Select Board to adopt historic pavement policy

The Nantucket Historical Commission is requesting to comment at a Select Board meeting regarding preservation planning for streets and sidewalks. The Commission is seeking the adoption of a formal policy to protect the island's historic character during public works projects.

historic-preservationsidewalksroadspublic-workszoning
Tue Mar 23, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review 2021 Annual Town Meeting Warrant Articles

The Affordable Housing Trust will meet via Zoom to review and discuss articles in the 2021 Annual Town Meeting Warrant. The body may also attend a meeting of the Finance Committee.

affordable-housingtown-meetingfinance
Tue Mar 23, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review climate projections and reports

The committee will receive a presentation on Massachusetts climate change and sea level rise projections from the Coastal Zone Management manager. Members will also review January and February reports from Arcadis and discuss the Baxter Road Alternative Access Option Study.

coastal-resilienceclimate-changesea-level-riseenvironmental-planninginfrastructure
Tue Mar 23, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee reviews progress on Nantucket Coastal Resilience Plan

The Coastal Resilience Advisory Committee is reviewing a February 2021 monitoring report from Arcadis regarding the Nantucket Coastal Resilience Plan. The meeting materials also include a draft agenda for a March 24 forum on the Chapter 91 Public Waterfront Act.

coastal-resilienceenvironmental-planningchapter-91public-waterfront
Tue Mar 23, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant articles

The Finance Committee will review and discuss several articles for the 2021 Annual Town Meeting. Discussion includes potential adoption of motions regarding housing funds and land bank fees.

housingbudgettown-meetingfinance
Tue Mar 23, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 4 Lincoln Ave projects

The commission is addressing carried-over business regarding properties on Lincoln Ave. No formal agenda was provided for this meeting.

historic-districtzoningbuilding-permits
Tue Mar 23, 2021 · 00:00

Finance Committee

Finance Committee reviews budget and land bank analysis

The Finance Committee is reviewing documents related to the Affordable Housing Trust budget and a land bank sensitivity analysis. The agenda consists of a list of supporting materials for discussion.

budgetaffordable-housingland-bankfinance
Tue Mar 23, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property and sign applications

The Historic District Commission is meeting to review a large volume of applications for residential alterations, new constructions, and signage. The body will decide on certificates of appropriateness for projects ranging from minor shed placements to new dwellings.

zoninghistoric-preservationresidential-constructionsignagesolar-energy
Tue Mar 23, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations and signage

The commission is reviewing a large volume of consent items and sign applications. These requests include residential additions, pool installations, and commercial signage across various properties.

zoninghistoric-preservationresidential-constructionsignagesolar
Tue Mar 23, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is addressing old business carried over from the March 16, 2021 meeting. The agenda consists of a list of property applications for review.

historic-districtzoninghousingland-use
Tue Mar 23, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property modifications

The commission is reviewing applications for renovations and construction at several residential properties. No formal agenda was provided, but documentation is available for specific addresses.

historic-districtzoningresidential-constructionnantucket
Tue Mar 23, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review 12 sign applications

The Sign Advisory Council is meeting to discuss and review various sign applications for properties across town. The council will also consider a vote regarding a construction sign letter to the Nantucket Builders Association.

signszoningland-use
Tue Mar 23, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews 12 signage applications

The Sign Advisory Council is reviewing applications for various wall, projecting, and public information signs. The body will evaluate requests for commercial and organizational signage across multiple locations.

signagezoningland-usepublic-info
Tue Mar 23, 2021 · 00:00

Sign Advisory Council (HDC)

HDC reviews various wall, projecting, and public information signs

The Historic District Commission is reviewing multiple sign applications for various locations across Nantucket. These items include wall signs, projecting signs, and trail signage.

signagehistoric-districtpublic-information
Mon Mar 22, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential construction and pool projects

The Sconset Advisory Board is reviewing several applications for new dwellings, pools, and hardscaping. The meeting focuses on residential property modifications in the Sconset area.

zoningresidential-constructionpoolssconset
Mon Mar 22, 2021 · 00:00

Conservation Commission

Conservation Commission to review Siasconset Beach Preservation Fund

The Nantucket Conservation Commission is meeting to conduct a 2019 annual review. The discussion focuses on the Siasconset Beach Preservation Fund.

conservationbeach-preservationenvironmental-review
Mon Mar 22, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 16 property modification requests

The Historic Structures Advisory Board is meeting to review new business applications for property alterations. The board will also discuss the "Resilient Nantucket" Community Design Guideline update.

historic-preservationzoningcommunity-designhousing
Mon Mar 22, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review 16 property modification requests

The Historic Structures Advisory Board is reviewing applications for exterior modifications to residential and commercial properties. The board will consider requests ranging from sidewalk and fence installations to building additions and demolition.

historic-preservationzoningbuilding-permitsnantucket
Mon Mar 22, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review dwelling and pool projects

The Madaket Advisory Board is meeting to discuss old and new business regarding residential property modifications. The board will review proposals for a new dwelling, additions, and pools.

land-useresidential-constructionmadaket
Mon Mar 22, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review golf business and property management

The Commission will conduct monthly reviews for Sconset and Miacomet golf courses. The agenda includes discussions on property management items, including lease amendments and infrastructure requests for Sustainable Nantucket.

golfproperty-managementreal-estateland-use
Mon Mar 22, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews pool and construction projects

The Sconset Advisory Board is reviewing nine new business applications for property modifications. The board will also discuss the Resilient Nantucket community design guidelines and the placement of a historic marker at 36 Main Street.

zoningconstructionhistoric-preservationcommunity-design
Fri Mar 19, 2021 · 00:00

Commission on Disability

Commission on Disability to review Coastal Resiliency and Hays Property plans

The Commission on Disability will meet to discuss the Town's Coastal Resiliency Plan and the Land Bank's Hays Property Plan. The body will also review and approve minutes from the December 21, 2020 meeting.

disability-servicescoastal-resiliencyland-bankplanning
Fri Mar 19, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission discusses preservation plans and town policies

The Nantucket Historical Commission is meeting to discuss grant applications, preservation incentives, and policies for town-owned historic resources. The body is reviewing proposals for rehabilitation and reuse, including a WPI student proposal and potential demolition delays.

historic-preservationzoningtown-policygrantsinfrastructure
Fri Mar 19, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss preservation grants and reuse plans

The Commission is meeting to review a grant application for a survey and develop a plan to promote the rehabilitation and reuse of historic buildings. The body will also discuss policies for preserving town-owned resources and incentives for home preservation.

historic-preservationgrantszoninginfrastructuretown-policy
Thu Mar 18, 2021 · 00:00

Board of Health

Board of Health reviews septic and sewer loans and COVID-19 updates

The Nantucket Board of Health will review loan applications for septic and sewer work and discuss emergency orders. The board will also receive a COVID-19 update.

healthsewersepticcovid-19
Thu Mar 18, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant articles

The Finance Committee is meeting to review and discuss specific articles for the 2021 Annual Town Meeting Warrant. The committee may adopt motions regarding these articles.

budgetbylawspensionsroadstown-meeting
Thu Mar 18, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous dwelling and renovation applications

The Historic District Commission is meeting to review a high volume of applications for new dwellings, additions, and exterior modifications. The body will also discuss policies regarding move/demo hearings, hardscaping, and the use of grey shingles in historic districts.

zoninghistoric-preservationhousingconstruction
Thu Mar 18, 2021 · 00:00

Nantucket Public School Committee

School Committee to review audit report and student support services

The Nantucket School Committee will discuss the Nantucket Public Schools Audit Report and receive updates on student support services and antiracism instructional leadership. The body will also vote on a donation for the NHS Culinary program.

educationauditstudent-servicesschool-budget
Thu Mar 18, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group discusses road improvements and signage requests

The group is reviewing several requests for traffic control changes, including a four-way stop, parking adjustments, and new signage. Members will also discuss potential road improvements on Macy Road and a proposed bylaw amendment regarding streets and sidewalks.

trafficroad safetyzoningparkingpublic works
Thu Mar 18, 2021 · 00:00

Quad-Council

Nantucket Public Schools Quad Council to discuss return to in-person learning

The NPS Quad School Council is meeting to discuss school operations and student policies. The agenda includes planning for the return to in-person learning and COVID-19 protocols for guests and field trips.

educationcovid-19school-policystudent-testing
Thu Mar 18, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee discusses tree removal requests and policy updates

The committee is reviewing various tree-related matters including removal requests, maintenance plans, and credit balances. Discussion topics include tree planting and credit policies, as well as a stump grinding contract.

treeszoningpublic-workspolicy
Thu Mar 18, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review signage and parking requests

The Traffic Safety Work Group is meeting to discuss several requests for parking changes and road signage. The group will also review a proposed bylaw amendment regarding streets and sidewalks for the 2021 Annual Town Meeting.

traffic-safetyparkingsignageroadsbylaws
Wed Mar 17, 2021 · 00:00

Historic District Commission

HDC and Select Board to hear appeal for 83/85 Eel Point Rd

The Historic District Commission and the Select Board are meeting to discuss an appeal regarding 83/85 Eel Point Rd (HDC2020-09-1638).

historic-districtappealland-use
Wed Mar 17, 2021 · 00:00

Select Board

Select Board discusses housing, contracts, and solar panel appeal

The Select Board will review a request to support Habitat for Humanity's inclusion of three housing units at 9A and 9B Benjamin Drive on the Subsidized Housing Inventory. The meeting also includes a public hearing regarding rooftop solar panels at 83/85 Eel Point Road and the approval of various town contracts.

housingzoningcontractspublic-hearinghuman-services
Wed Mar 17, 2021 · 00:00

Select Board

Select Board to review contracts, housing requests, and solar panel appeal

The Select Board will consider several professional service agreements and a request for support regarding Habitat for Humanity Nantucket housing units. A public hearing is scheduled to discuss an appeal regarding rooftop solar panels at 83/85 Eel Point Road.

housingsolarcontractspublic-hearinghuman-services
Tue Mar 16, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review mortgage subordination for 2 S. Pasture Lane

The Affordable Housing Trust will discuss a mortgage subordination for a Closing Cost Assistance Program application. The board will also consider amendments to the program's funding parameters and receive updates on the Housing Production Plan.

affordable-housingmortgageshousing-production-planreal-estate
Tue Mar 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 23 property modification requests

The Commission is reviewing a series of consent items for residential and commercial property changes. These requests include structural additions, demolition, and aesthetic modifications to various sites.

historic-districtzoningbuilding-permitscommercial-developmentresidential-modifications
Tue Mar 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing old business carried over from February 23, 2021. The meeting focuses on various residential additions, new dwellings, and landscaping requests.

historic-districtzoningresidential-constructionnantucket
Tue Mar 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple residential property alterations

The commission is reviewing a series of carried-over applications for residential additions, new dwellings, and exterior modifications. The agenda consists of a list of specific property addresses and proposed projects for review.

historic-districtzoningresidential-constructionbuilding-permits
Tue Mar 16, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses mortgage subordination and program amendments

The Affordable Housing Trust is considering a mortgage subordination for a property at 2 S. Pasture Lane. The board is also discussing proposed changes to the Closing Cost Assistance Program parameters.

affordable housingmortgagezoninggovernment-programs
Tue Mar 16, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews fund requisitions totaling over $206,000

The Community Preservation Committee is meeting to review several fund requisitions for local projects. The body will also discuss a budget report, a personnel issue, and an amendment to CPA legislation filed on Beacon Hill.

budgetfundinghistoric-preservationopen-space
Tue Mar 16, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant Articles

The Finance Committee is meeting to review and discuss various articles for the 2021 Annual Town Meeting Warrant. The committee may adopt motions regarding sewer district map changes, real estate transactions, and appropriations.

budgetsewerreal-estatetown-meetingzoning
Tue Mar 16, 2021 · 00:00

Harbor & Shellfish Advisory Board

Board to discuss boat regulations, oyster leases, and harbor health

The Harbor & Shellfish Advisory Board will review proposed amendments to boat Airbnb and liveaboard regulations. The board will also discuss oyster lease permits, abandoned boats, and the impact of lawn fertilizer on harbor health.

shellfishboatingwater-qualityharbor-management
Tue Mar 16, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a high volume of applications for new dwellings, additions, and renovations. The body will also discuss policies regarding move/demo hearings, hardscaping, and the use of grey shingles in historic districts.

zoninghistoric-preservationsolarconstructionhousing
Tue Mar 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews old business for multiple properties

The commission is reviewing old business items for various residential properties. The agenda consists of a list of addresses and associated project types for review.

historic-districtzoningresidential-constructionbuilding-permits
Tue Mar 16, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss charter examples and non-voting taxpayers

The committee is meeting to review unresolved items on their investigation list. Discussions will focus on how other town charters organize government and how other towns handle non-voting taxpayers.

town-governmentcharter-reviewtaxpayers
Tue Mar 16, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss charter examples and non-voting taxpayers

The committee is meeting to review unresolved items regarding the organization of government and the status of non-voting taxpayers. The session includes an update on discussions regarding the Nantucket Planning and Economic Development Commission (NPEDC).

town-chartergovernment-structuretaxpayersplanning-commission
Tue Mar 16, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss public way monuments and potential takings

The committee is meeting to discuss public access issues for a Chapter 91 Civic League Forum and the update of the Definitive Public/Private Way map. Members will also consider potential takings for Winn Street and the dirt portion of Friendship Lane.

roadsright-of-waypublic-accessinfrastructure
Mon Mar 15, 2021 · 00:00

Finance Committee

Finance Committee to review 2021 Annual Town Meeting Warrant Articles

The Finance Committee is meeting to review and discuss various articles from the 2021 Annual Town Meeting Warrant. The committee may adopt motions regarding these articles, which primarily concern zoning map changes and bylaw amendments.

zoningtown-meetingland-usesewer
Mon Mar 15, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews property renovations and additions

The Historic Structures Advisory Board is reviewing old and new business regarding property modifications. The board will also discuss updates to the Community Design Guideline as part of "Resilient Nantucket."

historic-preservationzoningbuilding-permitscommunity-design
Mon Mar 15, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 11 property renovation requests

The board is reviewing applications for renovations, additions, and hardscaping at various properties. The meeting focuses on structural changes and exterior modifications to historic sites.

historic-preservationzoningrenovationshardscape
Mon Mar 15, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to vote on new Transportation Manager position and area plan maps

The Nantucket Planning & Economic Development Commission will discuss transportation programming, a solar project at Wannacomet Water Co., and updates on Vineyard Wind. The body is scheduled to vote on creating a Transportation Manager position and adopting a final map for the new Town area plan.

transportationsolar-energyplanningwind-energyzoning
Mon Mar 15, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Planning Commission to vote on new Transportation Manager position

The Nantucket Planning & Economic Development Commission will discuss transportation programming and solar projects. The body is scheduled to vote on creating a new Transportation Manager position and adopting a final map for the Town area plan.

transportationzoningsolar-energywind-energyarea-planningstaffing
Mon Mar 15, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review residential construction and demolition requests

The board is reviewing several applications for new dwellings, additions, and outdoor improvements. The agenda consists of a series of property-specific project reviews.

zoningconstructionresidentialsconset
Fri Mar 12, 2021 · 00:00

Historic District Commission

Historic District Commission reviews draft design guidelines

The Historic District Commission will hold a special meeting to discuss the Resilient Nantucket project. The discussion includes a review of the third draft of design guidelines for the program.

zoningdesign-guidelinesresiliencehistoric-preservation
Fri Mar 12, 2021 · 00:00

Nantucket Historical Commission

Historical Commission to review Resilient Nantucket design guidelines

The Nantucket Historical Commission is holding a special meeting to review the third draft of design guidelines for the 'Resilient Nantucket; Designed for Adaptation' project. This project is funded by a grant from the Massachusetts Vulnerability Preparedness (MVP) Program.

resiliencydesign-guidelineshistoric-preservationmvp-program
Fri Mar 12, 2021 · 00:00

Senior Center Committee

Committee to discuss future options for Our Island Home

The Senior Center Committee will hold a meeting via Zoom. The session features a stakeholder-facilitated discussion with Herb Taylor regarding options for the future of Our Island Home.

senior-servicescommunity-planningour-island-home
Thu Mar 11, 2021 · 00:00

Conservation Commission

Nantucket Conservation Commission to hold public hearings on multiple land projects

The Conservation Commission is meeting to conduct public hearings for various Notices of Intent and Amended Orders of Conditions. The body will also review requests for determination and certificates of compliance for several properties.

conservationland-usepublic-hearingenvironmental-regulation
Thu Mar 11, 2021 · 00:00

Conservation Commission

Commission to discuss Siasconset Beach Preservation Fund project in executive session

The Nantucket Conservation Commission is meeting to conduct an executive session. The body will discuss real property values and litigation strategy regarding the Siasconset Beach Preservation Fund (SBPF) Geotextile Tube Project.

conservationlitigationbeach-preservationreal-estate
Thu Mar 11, 2021 · 00:00

Finance Committee

Finance Committee reviews 2021 Annual Town Meeting Warrant Articles

The Finance Committee is meeting to review and discuss several appropriation articles for the 2021 Annual Town Meeting Warrant. The committee may adopt motions regarding these funding requests.

budgetroadsinfrastructureappropriations
Thu Mar 11, 2021 · 00:00

Nantucket High School Council

Nantucket High School Council to review program of studies

The Nantucket High School Council will meet via Zoom to discuss school operations. The agenda includes updates on cohorts and hybrid learning, as well as a review of the program of studies.

educationhigh-schoolhybrid-learningcurriculum
Thu Mar 11, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review beach impacts and 2021 event planning

The Commission will hear presentations on coastal impacts at Children’s and Jetties Beaches and the 2021 event outlook. The body will also consider a request to use Children’s Beach for a dance festival in July.

beachescoastal-resiliencyeventsparks-and-recreationpublic-space
Thu Mar 11, 2021 · 00:00

Zoning Board of Appeals

Zoning Board to review setback relief and garage use changes

The Zoning Board of Appeals will hold public hearings to consider special permits for property setbacks and a change of use for a garage. The board will also address continued business regarding properties on Monohansett Road.

zoningsetbacksspecial-permitsland-use
Thu Mar 11, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals to hear setback and use permit requests

The Board will consider two new special permit requests regarding structure setbacks and usage changes. It will also address a continued public hearing for a property in Alger.

zoningspecial-permitssetbacksland-use
Thu Mar 11, 2021 · 00:00

Zoning Board of Appeals

Zoning Board of Appeals discusses setback intrusions and garage conversions

The Board will consider a request to validate an unintentional barn setback intrusion at 20 Miacomet Road. Additionally, the Board will review a request to modify prior relief to convert a garage into a studio at 8 Isobel's Way.

zoningsetbacksresidentialspecial-permits
Wed Mar 10, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss Polpis Cemetery lot layouts and brush removal

The Nantucket Cemetery Commission is meeting to approve recent lot sales and review maintenance updates. The body will discuss the layout of new lots at Polpis Cemetery and a plan for surveying monuments.

cemeteriesland-usemaintenancepublic-works
Wed Mar 10, 2021 · 00:00

One Time Event

Contract Review Committee meeting on March 10, 2021

The Contract Review Committee will meet via Zoom to conduct business including the approval of previous minutes. The committee is scheduled to discuss a new grant and review its report and recommendations for the Finance Committee.

financegrantsgovernment-operations
Wed Mar 10, 2021 · 00:00

Select Board

Select Board discusses housing funds and traffic safety recommendations

The Select Board will review COVID-19 updates, approve various warrants, and discuss upcoming Annual Town Meeting articles. The meeting also includes a public hearing regarding sewer district amendments and a report on traffic safety work group recommendations.

housingcovid-19trafficsewergovernment-finance
Wed Mar 10, 2021 · 00:00

Select Board

Select Board considers housing application for 31 Fairgrounds Road

The Select Board is reviewing a request to submit a Local Action Unit application to the state for a 22-unit rental development. The meeting also includes a public hearing on sewer district amendments and reports on COVID-19 and traffic safety.

affordable-housingsewertraffic-safetybudgetcovid-19
Tue Mar 9, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses housing production and local action unit application

The Affordable Housing Trust will receive an update on the Housing Production Plan, including a review of DHCD Strategy/Action Plan requirements. The board will also consider an application from the Local Action Unit for 31 Fairgrounds Road.

affordable housinghousing productionland usegovernment administration
Tue Mar 9, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review homeowners brochure and bridge works

The committee is meeting to discuss updates on infrastructure projects and review a draft homeowners brochure created by the Education Sub-committee. The session includes updates on coastal resilience events and a demonstration of a planning kit from Arcadis.

coastal-resilienceinfrastructureclimate-changepublic-educationbridges
Tue Mar 9, 2021 · 00:00

Coastal Resilience Advisory Committee

Nantucket releases self-guided toolkit for Coastal Resilience Plan

The Coastal Resilience Advisory Committee provided a self-guided meeting toolkit to educate residents on the Coastal Resilience Plan (CRP). The materials outline risks from sea level rise and erosion and solicit community feedback via discussion prompts and the Irys App.

coastal-resiliencefloodingerosionzoningpublic-engagementsea-level-rise
Tue Mar 9, 2021 · 00:00

Finance Committee

Finance Committee to review 2021 Annual Town Meeting Warrant articles

The Finance Committee will discuss and potentially adopt motions regarding several articles in the 2021 Annual Town Meeting Warrant. The meeting focuses on bylaw and charter amendments.

town-meetingbylawsnoiseairportroadscharter
Tue Mar 9, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property management and real estate acquisitions

The Nantucket Islands Land Bank Commission will review farm plans and ecological restoration proposals. The body will also address transfer business, financial warrants, and real estate acquisitions in executive session.

land-bankreal-estateconservationfinance
Tue Mar 9, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee discusses Summer 2021 programming

The committee is meeting to review reports and discuss summer programming. The agenda includes a conversation with the NHA Executive Director regarding the Macy Warehouse renovations.

visitor-servicestourismpublic-worksprogramming
Tue Mar 9, 2021 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to review PFAS soil testing and water main extension

The Nantucket Memorial Airport Commission will discuss PFAS investigation updates and a consultant presentation on soil testing and water main extensions. The body will also review 2021 Annual Town Meeting Warrant Articles and a draft response to the MEPA Certificate.

airportenvironmentpfastown-meetinginfrastructure
Remote Participation Via Zoom
Mon Mar 8, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review 2021 Annual Town Meeting Warrant Articles

The Affordable Housing Trust is meeting to review and discuss articles from the 2021 Annual Town Meeting Warrant. The body will also summarize recommendations voted upon during its March 2, 2021, meeting.

affordable-housingtown-meetinghousing-trust
Mon Mar 8, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust reviews 2021 Town Meeting Warrant articles

The Affordable Housing Trust is meeting to discuss 2021 Annual Town Meeting Warrant articles and summarize recommendations from a March 2 meeting. The body is also coordinating attendance at a Finance Committee meeting to review funding and housing stabilization proposals.

affordable-housingbudgettown-meetingappropriationszoning
Mon Mar 8, 2021 · 00:00

Finance Committee

Finance Committee reviews housing fund appropriations and land bank fees

The Finance Committee is reviewing and discussing several 2021 Annual Town Meeting Warrant Articles. The body may adopt motions regarding funding for housing stabilization and affordable housing trusts.

affordable-housingbudgettown-meetingland-bank
Mon Mar 8, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential exterior projects

The Historic Structures Advisory Board is meeting to review several property modification requests. The board will discuss a range of projects including new construction, roofing, and exterior color changes.

historic-preservationzoningresidential-constructionnantucket
Mon Mar 8, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential property alterations

The board is reviewing several applications for exterior modifications to residential properties. These items include new construction, structural repairs, and aesthetic changes.

historic-preservationzoningresidential-constructionbuilding-permits
Mon Mar 8, 2021 · 00:00

Planning Board

Planning Board to review zoning amendment for 10 Clifton Street

The Planning Board will hold public hearings on several land-use permits and review applications for second dwellings and garage apartments. The board will also discuss a citizen-petitioned zoning map amendment for a property on Clifton Street.

zoninghousingpublic-hearingsland-use
Mon Mar 8, 2021 · 00:00

Planning Board

Planning Board to review secondary dwelling and garage apartment applications

The Planning Board will review multiple applications for secondary dwellings and garage apartments. The meeting includes public hearings for several properties and a review of zoning articles for the Annual Town Meeting.

zoninghousingpublic-hearingsland-use
Mon Mar 8, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews property work and historic sign placement

The Sconset Advisory Board is conducting preliminary reviews for two property projects. The board will also discuss the placement of a historic marker at 36 Main Street and the Sconset Advisory Area Plan.

historic-preservationzoningsconsetplanning
Sat Mar 6, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to discuss Town Warrant Articles

The committee is meeting to discuss Town Warrant Articles and potential advocacy. The group will also follow up on a noise ordinance and the use of Zoom for meetings.

town-warrantnoise-ordinancetransportationparkingenergy
Fri Mar 5, 2021 · 00:00

Historic District Commission

Historic District Commission to review projects at 2 Stone Alley

The Historic District Commission will discuss organizational items including Zoom streamlining and the HDC Background Summary. The commission will also review two applications for the property at 2 Stone Alley.

historic-preservationzoningland-usehardscaping
Fri Mar 5, 2021 · 00:00

Historic District Commission

Historic District Commission reviews hardscape at 2 Stone Alley

The commission is meeting to review a hardscape proposal for 2 Stone Alley. No formal agenda was provided, but supporting documents for this specific address were submitted.

historic-districthardscapezoning
Thu Mar 4, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous building and sign applications

The Historic District Commission is meeting to discuss and decide on a large volume of applications for new dwellings, additions, and signage. The body will also review revisions to the HDC Background Summary for the town web page and discuss policies regarding Move/Demo hearings.

zoninghistoric-districtsbuilding-permitssolar-energysignage
Thu Mar 4, 2021 · 00:00

Historic District Commission

Historic District Commission reviews signs and exterior changes

The commission is reviewing several requests for signage and exterior modifications. These items include changes to trim, roofs, doors, and the relocation of projecting signs.

historic-districtsignagezoningexterior-modifications
Thu Mar 4, 2021 · 00:00

Select Board

Select Board to discuss real property and personnel contract negotiations

The Select Board/County Commissioners will meet via Zoom to conduct executive sessions. These sessions include discussions regarding real property transactions and strategy for contract negotiations with the Town Manager.

real-estatepersonnelgovernment-operationscontract-negotiations
Thu Mar 4, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss short-term rental licensing bylaw

The Affordable Housing Trust will meet via Zoom to review and discuss 2021 Annual Town Meeting Warrant Article #90. This article, sponsored by Tobias Glidden, concerns a bylaw for the licensing of short-term rentals.

affordable-housingshort-term-rentalsbylawszoning
Thu Mar 4, 2021 · 00:00

Finance Committee

Finance Committee reviews short-term rental licensing bylaw

The Finance Committee is meeting to review and discuss articles for the 2021 Annual Town Meeting Warrant. This includes a specific review of a bylaw regarding the licensing of short-term rentals.

financeshort-term-rentalstown-warrantlicensing
Wed Mar 3, 2021 · 00:00

Select Board

Select Board to consider $10.25 million bond sale for affordable housing

The Select Board will discuss COVID-19 updates, approve various warrants and contracts, and review several departmental requests. The meeting includes a review of a five-year lease agreement for Jetties Beach concessions and long-term solid waste planning.

affordable-housingbudgetcovid-19contractspublic-healthreal-estate
Wed Mar 3, 2021 · 00:00

Select Board

Select Board to consider $10.25 million bond for affordable housing

The Select Board will discuss COVID-19 updates, public health metrics, and various departmental requests. The body is deciding on several contracts, real estate documents for Mill Hill Court, and a request for affordable housing funding.

affordable-housingcovid-19public-healthcontractszoningbudget
Wed Mar 3, 2021 · 00:00

Council on Aging

Council on Aging to plan 2021 Seniors of the Year

The Council on Aging is meeting to discuss planning for the 2021 Seniors of the Year and review community coverage in the Inquirer & Mirror. The body will also receive reports on pandemic-related impacts to human services and Saltmarsh programs.

seniorscovid-19community-servicespublic-health
Tue Mar 2, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss oyster leases and harbor dredging

The board will review reports from the Marine and Natural Resources departments. Members will discuss oyster lease permits, dredging plans for sand in scallops, and abandoned boats in the harbor.

shellfishharbor-managementdredgingenvironment
Tue Mar 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review mortgage discharge for 3 Hull Lane

The Affordable Housing Trust will consider approving a mortgage discharge and new mortgage for a CCAP recipient at 3 Hull Lane. The board will also discuss 2021 Town Meeting Warrant Articles regarding year-round community housing.

affordable-housingmortgagestown-meeting-warrant
Tue Mar 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses mortgage discharge and 2021 Town Meeting articles

The Trust will consider discharging a mortgage for 3 Hull Lane and approving a new mortgage for Emily Millington. Members will also discuss 2021 Town Meeting warrant articles regarding year-round community housing.

affordable-housingmortgagestown-meetinghousing-policy
Tue Mar 2, 2021 · 00:00

Finance Committee

Finance Committee meeting cancelled

The Finance Committee meeting scheduled for March 2, 2021, was cancelled.

finance
Tue Mar 2, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign applications for six properties

The Sign Advisory Council is meeting to discuss sign installations and relocations at various addresses. The council may also vote on a construction sign letter addressed to the Nantucket Builders Association.

signszoningbusiness-permitsland-use
Tue Mar 2, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews six sign installation and relocation requests

The Sign Advisory Council is reviewing applications for projecting and wall signs at various locations. The body will consider requests for sign relocations and new installations.

signszoningbusiness-permitsnantucket
Mon Mar 1, 2021 · 00:00

Finance Committee

Finance Committee to hold public hearing on June 5 Annual Town Meeting Warrant Articles

The Finance Committee will conduct a public hearing regarding the June 5, 2021 Annual Town Meeting Warrant Articles. The body will review and discuss articles carried over from 2020 and specific 2021 budget and bylaw items.

budgetzoningreal-estatepublic-hearingbylaws
Mon Mar 1, 2021 · 00:00

Finance Committee

Finance Committee holds public hearing on 2021 Annual Town Meeting Warrant Articles

The Finance Committee is conducting a public hearing regarding the June 5, 2021 Annual Town Meeting Warrant Articles. The body will also review and discuss various articles carried over from the 2020 warrant and specific 2021 budget and bylaw items.

budgetzoningpublic-hearingreal-estatebylaws
Mon Mar 1, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will consider requests for new dwellings, additions, rooftop solar installations, and exterior modifications to ensure compliance with historic standards.

zoninghistoric-preservationhousingsolar-energy
Mon Mar 1, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing a series of applications for property alterations. These items include requests for additions, window and door replacements, and new outdoor installations.

historic-districtzoningresidential-constructionpermits
Mon Mar 1, 2021 · 00:00

Historic District Commission

No agenda available for the March 1, 2021 meeting

There is no formal agenda provided for this meeting. The record contains a list of items carried over from February 16, 2021, regarding various residential projects.

zoningresidentialhistoric-districtconstruction
Mon Mar 1, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing old business carried over from February 23, 2021. The meeting focuses on various residential construction and landscaping applications.

historic-districtzoninghousingconstruction
Mon Mar 1, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 16 property modification requests

The Historic Structures Advisory Board is meeting to discuss new business regarding property alterations. The board will review a variety of requests ranging from color changes and landscaping to new construction and demolition.

historic-preservationzoningconstructionsolardemolition
Mon Mar 1, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 17 property modification requests

The board is reviewing applications for exterior changes, additions, and new constructions at various addresses. The agenda consists of a series of property-specific reviews for approval.

historic-preservationzoningconstructionsolarhousing
Mon Mar 1, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review four property projects

The Madaket Advisory Board will meet via Zoom to discuss new business regarding four specific property requests. The board will also review the minutes from the January 25, 2021 meeting.

zoningsolarbuilding-permitsmadaket
Mon Mar 1, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review new dwellings and additions

The Sconset Advisory Board is meeting to discuss several property development requests, including new dwellings and additions. The board will also discuss the Sconset Area Plan and the placement of a historic marker at 36 Main Street.

zoninghousinghistoric-preservationsconset
Mon Mar 1, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews six residential project applications

The Sconset Advisory Board is reviewing applications for new construction, additions, and building relocations. The board will consider proposals for several properties within the district.

zoningresidential-constructionsconsetbuilding-permits
Fri Feb 26, 2021 · 00:00

Historic District Commission

HDC to review draft design guidelines for Resilient Nantucket project

The Historic District Commission will hold a special meeting to review the second draft of design guidelines for the 'Resilient Nantucket; Designed for Adaptation' project. This project is funded by a grant from the Massachusetts Vulnerability Preparedness (MVP) Program.

historic-districtresiliencydesign-guidelinesmvp-grant
Fri Feb 26, 2021 · 00:00

Nantucket Historical Commission

Commission reviews draft design guidelines for Resilient Nantucket

The Nantucket Historical Commission is holding a special meeting to review the second draft of design guidelines for the 'Resilient Nantucket; Designed for Adaptation' project. This project is funded through a grant from the Massachusetts Vulnerability Preparedness (MVP) Program.

resilient-nantucketdesign-guidelinesmvp-programhistoric-preservation
Thu Feb 25, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 12 Notices of Intent

The Nantucket Conservation Commission will conduct public hearings for several Notices of Intent and discuss the issuance of Orders of Conditions. The body will also review requests for minor modifications and a certificate of compliance.

conservationenvironmentpublic-hearingland-use
Thu Feb 25, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review applications for new dwellings, additions, and exterior modifications. The body will also discuss revisions to the HDC Background Summary for the town web page and review policies regarding Move/Demo hearings.

zoninghistoric-preservationhousingconstruction
Thu Feb 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews pool and structure modifications

The commission is reviewing several applications for property modifications, including pools and window or door changes. No formal agenda was provided, but specific project documents were submitted for consent.

historic-districtzoningresidential-permitsnantucket
Thu Feb 25, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential property modifications

The commission is reviewing carried-over applications for residential exterior changes. The meeting focuses on specific property modifications including a pool, an addition, and solar panels.

historic-districtzoningresidentialsolar-panels
Wed Feb 24, 2021 · 00:00

Nantucket Housing Authority

Nantucket Housing Authority to discuss building projects and heater policy

The Nantucket Housing Authority is meeting to review financial certifications and the status of specific building projects. The board will also consider a policy prohibiting the use of portable space heaters.

housingpublic-healthbuilding-maintenancefinancepolicy
Tue Feb 23, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee discusses Baxter Road engineering assessment and homeowners brochure

The Coastal Resilience Advisory Committee is meeting to review a draft homeowners brochure from the Education Sub-committee. The body will also discuss the role of the committee regarding a new Arcadis contract for the Baxter Road Engineering Feasibility Assessment.

coastal-resilienceengineeringclimate-changepublic-engagementbaxter-road
Tue Feb 23, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee reviews Baxter Road engineering feasibility assessment

The Coastal Resilience Advisory Committee is discussing a scope of work for an engineering feasibility assessment of Baxter Road. The project aims to address bluff erosion and public infrastructure impacts from Sankaty Lighthouse to Butterfly Lane.

coastal-resilienceinfrastructureerosionbaxter-roadengineering
Tue Feb 23, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss real estate acquisition and coastal resiliency

The Nantucket Islands Land Bank Commission will review monthly reports for the Sconset and Miacomet golf courses and a proposal from a coastal resiliency consultant. The commission will also hold an executive session to discuss real estate acquisition.

real-estatecoastal-resiliencygolf-coursesfinance
Tue Feb 23, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission is meeting to review a large volume of applications for property modifications, new dwellings, and demolitions. The body will address consent items, new business, and old business regarding historic preservation standards.

zoninghistoric-preservationdemolitionhousingsolar-energy
Tue Feb 23, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 14 property modification requests

The commission is reviewing a series of applications for exterior changes to residential properties. These items are listed under consent and consent with conditions.

historic-districtzoningbuilding-permitsresidential
Tue Feb 23, 2021 · 00:00

Historic District Commission

Historic District Commission reviews old business for multiple properties

The commission is reviewing old business items related to various residential projects. The agenda consists of a list of properties under consideration for dwellings, additions, and other structures.

historic-districtzoninghousingconstruction
Tue Feb 23, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no formal agenda provided for this Historic District Commission meeting. The record contains only project documents related to 11 Mill Hill Lane and 80 Millbrook Road.

zoningresidentialhistoric-district
Mon Feb 22, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple property renovations and additions

The Historic Structures Advisory Board will discuss several carried-over new business items regarding property modifications. The agenda includes various residential projects involving additions, demolitions, and hardscaping across Nantucket.

zoninghistoric-preservationresidentialconstruction
Mon Feb 22, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review dwelling and hardscape applications

The Sconset Advisory Board is meeting to discuss several carried-over new business items and one old business item. The board will review requests for new dwellings, garages, and hardscape modifications at various properties.

zoninghousinghistoric-preservationland-use
Mon Feb 22, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews residential demolition and construction requests

The board is reviewing several property applications including new dwellings, garages, and hardscaping. The agenda includes a demolition and move-off request for 7 North Gully Road.

zoningdemolitionconstructionresidentialsconset
Mon Feb 22, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews multiple property renovations and additions

The Historic Structures Advisory Board is reviewing various applications for residential alterations, including additions, demolitions, and hardscape projects. These items include garage door replacements, gas vent installations, and garden structures across several locations.

zoningresidentialhistoric-preservationconstruction
Mon Feb 22, 2021 · 00:00

Nantucket Planning & Economic Development Commission

Commission to discuss MassDOT safety measures and Safe Routes to School

The Nantucket Planning & Economic Development Commission will meet to accept 2021 safety performance measures from MassDOT. The body will also discuss updates and readiness for the FFY 22-26 Safe Routes to School program.

transportationsafetymassdotschools
Fri Feb 19, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss coastal resiliency and downtown pavement

The commission is meeting to discuss coastal resiliency with consultant Arcadis and review policies for downtown street furniture and historic pavement. The body will also address a grant application for a survey plan and plan a 2022 preservation exhibit.

historic-preservationcoastal-resiliencyzoninginfrastructuregrants
Fri Feb 19, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission discusses resiliency and preservation

The Commission will discuss coastal resiliency with consultant Arcadis and review a survey grant application. Members will also review Section 106 reviews regarding Sparks, Pleasant, and Williams properties and sewer main sidewalk work.

preservationcoastal-resiliencyinfrastructurezoninggovernment-policy
Thu Feb 18, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses mortgage subordination and grant requests

The Trust will discuss several housing programs, including the Covenant Formation Assistance Program and a closing cost grant request. Members will also receive updates on the Housing Production Plan and Land Bank donations.

affordable-housinggrantsmortgagesreal-estate
Thu Feb 18, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses 31 Fairgrounds Road project and mortgage subordination

The Trust is reviewing a grant and loan structure for the 31 Fairgrounds Road rental project. Members are also discussing assistance for the Covenant Formation Assistance Program at 22A Evergreen Way.

affordable-housinggrantsmortgagesreal-estatehousing-development
Thu Feb 18, 2021 · 00:00

Board of Health

Board of Health reviews septic variances and emergency orders

The Board of Health is reviewing variance requests for several properties and the Faraway Hotel. The meeting also includes documents regarding emergency orders for outdoor dining and masks.

health-boardsepticvariancespublic-healthemergency-orders
Thu Feb 18, 2021 · 00:00

Cyrus Peirce Middle School

Cyrus Peirce Middle School Council to decide on parent-teacher conference date

The CPS School Council will meet to decide on parent-teacher conferences for March 17. The body will also discuss ideas for an additional encore position for the next school year.

educationschool-councilstaffingparent-teacher-conferences
Thu Feb 18, 2021 · 00:00

Historic District Commission

Historic District Commission to review 72 new and old business applications

The Historic District Commission is meeting to discuss a high volume of property applications, including new dwellings, demolitions, and renovations. The body will also review revisions to the HDC Background Summary for its web page and discuss minimum maintenance for 6 Fair Street.

zoninghistoric-preservationdemolitionhousingsolar
Thu Feb 18, 2021 · 00:00

Board of Health

Board of Health to review septic loans and swimming pool standards

The Board of Health will consider septic loan requests and variance applications for several properties. The board will also continue a public hearing on minimum standards for swimming pools and discuss COVID-19 emergency orders regarding outdoor dining and gathering limits.

septiczoningpublic-healthcovid-19swimming-pools
Thu Feb 18, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on donations and School Opportunity Act submission

The Nantucket School Committee will discuss the COVID-19 vaccine rollout for staff, technology safety, and the 2022-2023 school calendar. The body will vote on three specific donations and a submission to the Department of Education.

educationbudgetdonationscovid-19school-calendar
Thu Feb 18, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee meeting cancelled

The Tree Advisory Committee meeting scheduled for February 18, 2021, was cancelled.

treescancelled-meeting
Wed Feb 17, 2021 · 00:00

One Time Event

Contract Review Committee meets February 17, 2021

The Contract Review Committee is meeting to approve minutes from December 2020 and conduct deliberations. The agenda consists primarily of procedural items.

contractstown-administration
Wed Feb 17, 2021 · 00:00

County Commission

County Commission to discuss Sheep Pond Road erosion

The County Commissioners will meet to receive an update on erosion and alternative access for Sheep Pond Road. The body will also review payroll and treasury warrants for February 2021.

roadsinfrastructurecounty-budget
Wed Feb 17, 2021 · 00:00

County Commission

County Commissioners to discuss Sheep Pond Road erosion

The County Commissioners will meet to receive an update on erosion and alternative access for Sheep Pond Road. The body will also review payroll and treasury warrants for February 2021.

roadsinfrastructurebudget
Wed Feb 17, 2021 · 00:00

Planning Board

Planning Board discusses zoning map amendments for various properties

The Planning Board will review several proposed zoning map amendments related to citizen petitions for the 2021 ATM. These items involve changing property districts on Bartlett Farm Road, Evergreen Way, Chatham Road, and Mayflower Circle.

zoningland useresidentialcommercial
Wed Feb 17, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss report for Town Meeting

The committee is meeting to review unresolved investigation items and determine the next steps for a report to the Town Meeting. The session includes updates on meetings with Town Administration and the Advisory Committee of Non-Voting Taxpayers.

government-studytown-meetingadministration
Wed Feb 17, 2021 · 00:00

Town Government Study Committee

Town Government Study Committee to discuss report for Town Meeting

The committee is meeting to determine the next steps for a report to the Town Meeting. Members will discuss unresolved investigation topics and receive updates regarding meetings with Town Administration and the Advisory Committee of Non-Voting Taxpayers.

town-governmentcharter-reviewadministrationpublic-report
Wed Feb 17, 2021 · 00:00

Select Board

Select Board to review COVID-19 updates and utility petitions

The Select Board will receive reports on COVID-19 metrics and vaccine distribution. The body will also hold public hearings on utility installations and alcohol license amendments, and consider several real estate easement releases.

covid-19utilitieslicensingreal-estatebudget
Wed Feb 17, 2021 · 00:00

Select Board

Select Board to consider $153,500 COVID-19 small business grant

The Select Board will review a grant for the Nantucket Island Chamber of Commerce to assist local businesses with pandemic impacts. The meeting also includes public hearings for utility petitions and liquor license amendments.

budgetcovid-19utilitieslicensingreal-estate
Tue Feb 16, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews fund requisitions and copier lease

The Community Preservation Committee is meeting to review fund requisitions for tennis and interfaith projects. The body will also discuss a Field House update and the authorization of a new Ricoh copier lease.

budgetcommunity-preservationpublic-facilitiescontracts
Tue Feb 16, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board meeting on February 16, 2021

The board will discuss several harbor-related topics including oyster lease permits and scallop dredging plans. Additional discussions include lawn fertilizer use and abandoned boats in the harbor.

harborshellfishmarine-resourcesnatural-resourcesoysters
Tue Feb 16, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alteration requests

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property modifications. The body will consider requests for new dwellings, additions, garages, and hardscaping across various Nantucket locations.

zoninghistoric-districtbuilding-permitsresidential-development
Tue Feb 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews carried-over property applications

The commission is reviewing old business carried over from February 1, 2021. The items consist of various applications for new dwellings, additions, and hardscaping across multiple properties.

historic-districtzoningconstructionhousing
Tue Feb 16, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 21 property modification requests

The commission is reviewing applications for additions, pools, and structural changes at various residential and commercial addresses. The agenda consists of a list of property-specific project documents for review.

historic-districtzoningbuilding-permitssolar-energyresidential-construction
Tue Feb 16, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss public access and potential takings

The committee will review updates on the Greenway Project and discuss public access issues related to Chapter 91. Members will also consider a potential takings list for Winn Street and the dirt portion of Friendship Lane.

roadspublic-accessgreenwayzoning
Tue Feb 16, 2021 · 00:00

Select Board

Select Board to discuss litigation strategy in executive session

The Select Board and County Commissioners will meet via Zoom. The primary purpose of the meeting is to enter an executive session to discuss legal strategy regarding a specific lawsuit.

litigationexecutive-sessionlegal-strategy
Tue Feb 16, 2021 · 12:00

Airport Commission, Nantucket Memorial

Airport Commission to discuss rental car warrant article

The Nantucket Memorial Airport Commission is meeting to review a proposed draft warrant article for the FY2021 Annual Town Meeting. The discussion focuses on rental cars.

airportrental-carstown-meetingbudget
Remote Participation Via Zoom
Fri Feb 12, 2021 · 00:00

Council for Human Services

Council for Human Services to discuss 'Parenting Through COVID' forum

The Council for Human Services will meet via Zoom to discuss a forum titled 'Parenting Through COVID'.

human-servicesparentingcovid-19
Fri Feb 12, 2021 · 00:00

Historic District Commission

HDC to review draft design guidelines for Resilient Nantucket project

The Historic District Commission will meet to review draft design guidelines for the "Resilient Nantucket; Designed for Adaptation" project. This project is funded through a grant from the Massachusetts Vulnerability Preparedness (MVP) Program.

historic-districtdesign-guidelinesresiliencymvp-program
Fri Feb 12, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda available for this meeting. The record refers users to the meeting minutes.

historic-district-commissiondesign-guidelinesresilience
Thu Feb 11, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss property requests and housing funds

The Trust will meet to discuss a request from NHA Properties Inc. regarding 31 Fairgrounds Road and conduct a financial discussion. The meeting also includes an executive session to consider real property transactions.

affordable housingreal estatefinancegovernment-business
Thu Feb 11, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust meeting scheduled for February 11, 2021

The Affordable Housing Trust will meet via Zoom to discuss several items including a request from NHA Properties Inc. regarding 31 Fairgrounds Road. The meeting also includes a financial discussion and an executive session regarding real property.

affordable-housingreal-estatefinance
Thu Feb 11, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple land use notices

The Nantucket Conservation Commission will conduct public hearings regarding Notices of Intent for several properties. The body will also review requests for determination and certificates of compliance.

conservationland-usepublic-hearingzoning
Thu Feb 11, 2021 · 00:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council to review improvement plan progress

The Nantucket Intermediate School Council is meeting to discuss the progress of the midyear improvement plan. The meeting is being conducted via remote participation.

educationschool-councilimprovement-plan
Thu Feb 11, 2021 · 00:00

Select Board

Select Board to discuss Siasconset Beach Preservation Fund litigation

The Select Board and County Commissioners will meet via Zoom to approve previous minutes and enter executive session. The board will discuss legal strategy regarding the Siasconset Beach Preservation Fund (SBPF) v Conservation Commission case in Nantucket Superior Court.

litigationbeach-preservationconservation-commissionexecutive-session
Thu Feb 11, 2021 · 00:00

Zoning Board of Appeals

ZBA to hear appeal regarding short-term rental use at 14 New Mill Street

The Zoning Board of Appeals will hold public hearings on property use and variance requests. The board will consider an appeal regarding whether a short-term rental business is a prohibited commercial use in a residential zone.

zoningshort-term-rentalsvariancespublic-hearings
Thu Feb 11, 2021 · 00:00

Zoning Board of Appeals

Zoning Board to hear appeal on short-term rental use at 14 New Mill Street

The Zoning Board of Appeals will hold public hearings regarding a short-term rental appeal and a request to modify a prior variance for a secondary dwelling. The board will also address a continued hearing for properties on Monohansett Road.

zoningshort-term-rentalsvarianceshousing
Thu Feb 11, 2021 · 00:00

Zoning Board of Appeals

Zoning Board discusses short-term rental use and dwelling modifications

The Zoning Board of Appeals will hear an appeal regarding whether a property at 14 New Mill Street is being used as a prohibited commercial short-term rental. The board will also consider a request to modify a prior variance at 35 Washington Street to allow for a secondary dwelling. Additionally, the board will review minutes from the January 14, 2021 meeting.

zoningshort-term rentalsresidentialhousingappeals
Wed Feb 10, 2021 · 00:00

Select Board

Select Board reviews $157,978 Baxter Road access study contract

The Select Board is meeting to discuss COVID-19 updates and the 2021 Annual Town Meeting warrant. The board is reviewing a professional services agreement for a road feasibility study and a lease for Jetties Beach facilities.

roadscontractscovid-19beach-managementhousingenvironment
Wed Feb 10, 2021 · 00:00

One Time Event

Contract Review Committee meeting scheduled for February 10, 2021

The Contract Review Committee will meet via Zoom to approve previous minutes and conduct deliberations. The agenda includes the approval of minutes from December 1st, 7th, and 9th.

government-administrationmeetings
Wed Feb 10, 2021 · 00:00

Select Board

Select Board to review Jetties Beach lease and PFAS risk assessment

The Select Board will receive updates on COVID-19 metrics and vaccine distribution. The body is reviewing a five-year lease proposal for Jetties Beach concessions and a town-wide PFAS risk assessment report.

public-healthenvironmentbeach-managementroadshousingcontracts
Wed Feb 10, 2021 · 00:00

Cemetery Commission

Cemetery Commission to discuss monument surveys and Polpis Cemetery lot layouts

The Nantucket Cemetery Commission will discuss plans for surveying monuments at five cemeteries and the layout of new lots at Polpis Cemetery. The board will also review updates on signage and burial ground maintenance.

cemeteriesland-managementpublic-worksmonuments
Tue Feb 9, 2021 · 05:00

Airport Commission, Nantucket Memorial

Airport Commission to discuss PFAS investigation and land acquisition

The Nantucket Memorial Airport Commission will review a PFAS investigation update and a proposal for land acquisition. The body will also discuss the declaration of surplus property for the Bunker Road Parcel and a MassDOT grant award.

airportenvironmentland-usebudgetgrants
Remote Participation Via Zoom
Tue Feb 9, 2021 · 00:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to discuss Summer 2021 scenario planning

The committee is meeting to review reports and discuss scenario planning for the Summer 2021 season with town staff. The meeting includes a conversation with the Licensing Administrator and Events Coordinator.

visitor-servicestourismplanningsummer-2021
Tue Feb 9, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review coastal resiliency proposal and real estate acquisitions

The Nantucket Islands Land Bank Commission will discuss property project prioritization and review a proposal from a coastal resiliency consultant. The body will also consider a new debit card policy and discuss real estate acquisitions in executive session.

real-estatecoastal-resiliencyfinanceland-bank
Tue Feb 9, 2021 · 00:00

Coastal Resilience Advisory Committee

Feasibility assessment for Baxter Road engineering

The Coastal Resilience Advisory Committee is reviewing a scope of work by ARCADIS to assess engineering alternatives for Baxter Road from Sankaty Lighthouse to Butterfly Lane. The project focuses on addressing bluff erosion and coastal hazards through stakeholder engagement and technical analysis.

coastal-resilienceinfrastructurebaxter-roaderosionengineering
Tue Feb 9, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review homeowners brochure and storm effects

The committee is meeting to discuss flooding and erosion from Winter Storm Orlena and review a draft homeowners brochure. Members will also discuss feedback from a recent virtual open house and the town's application to become a Certified Local Government.

coastal-resiliencefloodingerosionenvironmental-planningpublic-outreach
Tue Feb 9, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust meeting cancelled

The meeting scheduled for February 9, 2021, was cancelled. The agenda had included a request from NHA Properties Inc. regarding 31 Fairgrounds Road and a financial discussion.

affordable-housingreal-estate
Mon Feb 8, 2021 · 00:00

Planning Board

Planning Board to review zoning amendments and multiple dwelling applications

The Planning Board is meeting to discuss second and tertiary dwelling applications and review several After-the-Fact (ANR) plans. The board will also hold public hearings on various land-use permits and consider multiple zoning map and bylaw amendments.

zoningland-usepublic-hearingshousingplanning
Mon Feb 8, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust meeting for February 8, 2021, cancelled

The scheduled special meeting of the Affordable Housing Trust was cancelled. The agenda had included a request from NHA Properties Inc. regarding 31 Fairgrounds Road and a financial discussion.

affordable-housingreal-estatecancelled-meeting
Mon Feb 8, 2021 · 00:00

Planning Board

Planning Board to review secondary dwelling requests and subdivision plans

The Planning Board is reviewing applications for secondary dwellings at multiple residential addresses. The meeting includes reviews of After Neighborhood Record (ANR) plans and public hearings for several specific properties. The board will also address ATM articles.

zoninghousingland-usepublic-hearings
Sat Feb 6, 2021 · 00:00

Finance Committee

Finance Committee to review FY22 operating budgets

The Finance Committee is meeting to review and discuss the FY22 operating budgets for the General Fund, Enterprise Funds, and Special Revenue Funds.

budgetfinancefy22
Sat Feb 6, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers to hear from Town Government Study Committee

The committee will receive a presentation and Q&A session with John Brescher, Chair of the Town Government Study Committee. Members will also discuss the proposed ACK Now Short Term Rental Bylaw and virtual attendance authority for post-pandemic meetings.

town-governmentshort-term-rentalspublic-meetingsbylaws
Thu Feb 4, 2021 · 00:00

Planning Board

Planning Board to hold public hearings on 2021 Annual Town Meeting zoning articles

The Planning Board is conducting public hearings on various proposed zoning map and bylaw amendments. These include articles proposed by the board and those submitted via citizen petition for the 2021 Annual Town Meeting.

zoningpublic-hearingsland-usetown-meeting
Thu Feb 4, 2021 · 00:00

Nantucket Elementary School Council

No meeting agenda provided

The provided text is a gubernatorial order from March 12, 2020, regarding Open Meeting Law suspensions during COVID-19. It contains no specific agenda items, decisions, or discussion topics for the Nantucket Elementary School Council meeting on February 4, 2021.

procedural
Thu Feb 4, 2021 · 00:00

Historic District Commission

Historic District Commission to review multiple new dwelling and renovation requests

The Historic District Commission is meeting to discuss new and old business applications for property modifications. The body will review requests for new dwellings, additions, and hardscaping across various Nantucket properties.

zoninghistoric-preservationhousingdemolition
Thu Feb 4, 2021 · 00:00

Finance Committee

Finance Committee to review FY 2022 County Budget and Town Meeting articles

The Finance Committee will review the FY 2022 County Budget. The body will also discuss several 2021 Annual Town Meeting Citizen Warrant Articles regarding drinking water safety, a charter amendment, and road construction bylaws.

budgetdrinking-watercharter-amendmentroad-constructiontown-meeting
Thu Feb 4, 2021 · 00:00

Select Board

Select Board to discuss litigation strategy and real estate in executive session

The Select Board and County Commissioners will meet via Zoom to conduct an executive session. The body will discuss legal strategies regarding specific property appeals and potential litigation, as well as the value or purchase of real property.

litigationreal-estateexecutive-sessionproperty-value
Wed Feb 3, 2021 · 00:00

Select Board

Select Board reviews PFAS water contamination and budget amendments

The Select Board is discussing a presentation on PFAS water contamination and cost recovery. The body is also reviewing a proposed FY 2022 General Fund Budget amendment and potential funding for the Affordable Housing Trust.

budgetpublic-healthliquor-licensesaffordable-housingcontracts
Wed Feb 3, 2021 · 00:00

Select Board

Select Board to hold liquor license hearings and review COVID-19 updates

The Select Board will discuss COVID-19 metrics, vaccine distribution, and a PFAS special counsel recommendation. The body is also reviewing the FY 2022 General Fund Budget amendment and 2021 Annual Town Meeting warrant development.

covid-19liquor-licensesbudgetpublic-healthcontracts
Wed Feb 3, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee to review three property conveyances

The committee is meeting to discuss the conveyance of easement areas and parcels to private owners. These items include the release of easements and the sale of a parcel based on previous Town Meeting authorizations.

real-estateeasementsconveyanceszoning
Wed Feb 3, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee discusses property conveyances

The committee will review several property conveyance and easement matters. These items include roadway acquisitions and easement releases for specific properties on Gladlands Ave, White St, and Pocomo Rd.

real estateeasementsconveyancesland use
Wed Feb 3, 2021 · 00:00

Council on Aging

Council on Aging discusses human services and pandemic programming

The Council on Aging will review reports regarding human services, COVID-19 task force updates, and Saltmarsh programs. Members will also receive updates on Elder Services of Cape Cod & the Islands and NCEA activities.

human-servicescovid-19senior-servicesgovernment-reports
Tue Feb 2, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on Fiscal Year 2022 Budget Education Appropriation

The Nantucket School Committee will consider the Fiscal Year 2022 budget appropriation and the 2021-2022 school calendar. The body will also review several donations to school programs and the district bullying report.

budgeteducationschool-calendardonations
Tue Feb 2, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss Petrel Landing and oyster leases

The Harbor & Shellfish Advisory Board will review reports from the Marine and Natural Resources departments. The board is scheduled to discuss several ongoing issues regarding harbor management and shellfish permits.

shellfishharbor-managementenvironmentdredgingmaritime
Tue Feb 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss mortgage subordination and funding strategies

The Trust is meeting to approve a mortgage subordination for 17 Clarendon Street and discuss guidance for 2021 Town Meeting Warrant Articles. The body will also receive a presentation on a proposed Affordable and Year-round Housing Stabilization Fund.

affordable-housingmortgagestown-warrantreal-estatefunding
Tue Feb 2, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss mortgage subordination for 17 Clarendon Street

The Affordable Housing Trust will meet to discuss mortgage subordination for a property at 17 Clarendon Street and review guidance for 2021 Town Meeting Warrant Articles. The board will also receive a presentation on a proposed stabilization fund for affordable and year-round housing.

affordable-housingmortgagestown-warrantreal-estate
Mon Feb 1, 2021 · 00:00

Council for Human Services

Council for Human Services plans 'Parenting Through COVID' community forum

The Council for Human Services will discuss the structure and outreach for a community forum scheduled for February 12. The body will also receive updates on the Director of Diversity, Equity & Inclusion position and the COVID Resources Response Team.

human-servicescovid-19community-forumdiversity-equity-inclusion
Mon Feb 1, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous residential construction applications

The Historic District Commission is meeting to review a large volume of applications for new dwellings, guest houses, and hardscaping. The body will also discuss minimum maintenance for 6 Fair Street and review policies regarding move/demo hearings for new dwellings.

zoninghistoric-preservationhousingconstruction
Mon Feb 1, 2021 · 00:00

Historic District Commission

Historic District Commission reviews hardscaping and home modifications

The commission is reviewing several applications for exterior modifications to residential properties. These items are listed under consent or consent with conditions.

historic-districtzoningresidential-modificationsnantucket
Mon Feb 1, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple property alterations

The commission is reviewing carried-over new business regarding various residential and commercial property modifications. These items include requests for new dwellings, guest houses, and hardscape changes.

historic-districtzoningbuilding-permitshousing
Mon Feb 1, 2021 · 00:00

Historic District Commission

Historic District Commission reviews multiple residential construction projects

The commission is reviewing old business regarding various residential additions, new dwellings, and landscaping projects. No formal agenda was provided, but the record lists several specific property reviews.

historic-districtzoningresidential-constructionlandscaping
Mon Feb 1, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board to review property alterations and new dwellings

The Historic Structures Advisory Board is meeting to discuss new business and old business regarding specific property modifications. The board will review requests for hardscaping, foundations, sheds, and new dwellings.

historic-preservationzoningbuilding-permitsnantucket
Mon Feb 1, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential property modifications

The board is reviewing applications for structural changes and new construction at several properties. The agenda consists of a list of project documents for review.

historic-preservationzoningconstructionresidential
Mon Feb 1, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board to review property work and historic sign placement

The Sconset Advisory Board is meeting to review a project at 4 Shell Street and discuss the placement of a historic marker. The board will also address procedural business and public comment.

historic-preservationzoningsconset
Mon Feb 1, 2021 · 16:00

Historic District Commission

Historic District Commission reviews residential construction and alterations

The Historic District Commission is reviewing several applications for residential work, including new dwellings and home improvements. The meeting materials include project plans and abutter lists for the proposed changes.

zoninghistoric-districtconstructionsolarresidential
Sat Jan 30, 2021 · 00:00

Finance Committee

Finance Committee meeting cancelled

The Finance Committee meeting scheduled for January 30, 2021, was cancelled.

finance
Fri Jan 29, 2021 · 00:00

One Time Event

Contract Review Committee to review 2nd Quarterly Reports

The Contract Review Committee is meeting to discuss 2nd Quarterly Reports. The session includes time for deliberations on these reports.

contractsoversightreporting
Fri Jan 29, 2021 · 00:00

Nantucket Historical Commission

Historical Commission to review grant applications and historic pavement preservation

The Nantucket Historical Commission is meeting to review a final draft of the MHC Survey grant application and discuss 2021 objectives. The body will also address the preservation of historic pavement and the Section 106 Review for Sparks and Sewer.

historic-preservationgrantsinfrastructurepavement
Fri Jan 29, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss historic pavement and grant applications

The commission is meeting to review a grant application for the MHC Survey and discuss the Certified Local Government Application. The body will also address the preservation of historic pavement and the 'Sparks and Sewer' Section 106 Review.

historic-preservationgrantsinfrastructurezoninggovernment-certification
Thu Jan 28, 2021 · 00:00

Coastal Resilience Advisory Committee

Committee discusses attendance at Coastal Resilience Plan virtual open house

The Coastal Resilience Advisory Committee is meeting to discuss committee attendance at the Nantucket Coastal Resilience Plan Virtual Open House.

coastal-resilienceplanningenvironment
Thu Jan 28, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on 18 notices of intent

The Nantucket Conservation Commission will conduct a series of public hearings regarding notices of intent and amended orders of conditions. The body will also review requests for determination and certificates of compliance for various properties.

conservationpublic-hearingszoningenvironmenttown-maintenance
Thu Jan 28, 2021 · 00:00

Finance Committee

Finance Committee reviews FY22 budget and capital project recommendations

The Finance Committee will review and discuss proposed FY22 General Fund Budget recommendations. The committee is also scheduled to review motions for Capital Project Articles intended for the 2021 Annual Town Meeting.

budgetfinancetown-meetinggovernment-operations
Thu Jan 28, 2021 · 00:00

Historic District Commission

Historic District Commission reviews various property applications

The Historic District Commission is reviewing several dozen new business items including residential construction and demolition requests. The agenda includes discussions on the consent agenda, minimum maintenance policies, and move/demo hearing policies.

zoninghistoric-preservationresidentialconstruction
Thu Jan 28, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review programming and coastal resilience

The Commission will discuss spring and summer programming and review the Expedition Blue! educational panel. The meeting includes updates from the Department of Public Works and an announcement regarding a Coastal Resilience Plan open house.

parks-and-recreationcommunity-programmingcoastal-resiliencepublic-works
Thu Jan 28, 2021 · 00:00

Parks and Recreation Commission

Parks and Recreation Commission to review Expedition Blue educational panel

The Parks and Recreation Commission will meet to discuss spring and summer programming and receive a Department of Public Works update. The meeting includes a review of the Expedition Blue educational panel by the Director of Culture and Tourism.

parks-and-recreationtourismpublic-workscoastal-resilienceprogramming
Wed Jan 27, 2021 · 00:00

Capital Program Committee

Capital Program Committee presents FY2022 project recommendations

The Capital Program Committee will present its recommended capital projects for Fiscal Year 2022 to the Select Board. The meeting is scheduled to take place remotely via Zoom.

budgetcapital-projectsgovernment-finance
Wed Jan 27, 2021 · 00:00

County Commission

County Commission to review FY 2022 budget and land use agreement

The County Commission will meet to review and adopt the FY 2022 County Budget. The body is also considering a license agreement for the use of parking easement land for the Coast to Coast Trail.

budgetland-useparkingcoast-to-coast-trail
Wed Jan 27, 2021 · 00:00

County Commission

Commission to discuss trail license and FY 2022 budget

The County Commission will review the FY 2022 County Budget and consider a license agreement for the Nantucket Islands Land Bank. This agreement would allow the Land Bank to manage a parking easement on Hoicks Hollow Road for the Coast to Coast Trail.

budgetland-usetrailsgovernment-operations
Wed Jan 27, 2021 · 00:00

Select Board

Select Board to review real estate transfers and public land takings

The Select Board will discuss COVID-19 metrics, vaccine distribution, and FY 2022 capital project recommendations. The body is considering the sale of town-owned parcels and the taking of several paper streets for public use.

real-estatepublic-healthbudgetzoninginfrastructuresolar-energy
Wed Jan 27, 2021 · 00:00

Select Board

Select Board discusses real estate transfers and coastal resilience

The Select Board will review several real estate matters including land parcel agreements and loan discharges. The meeting also includes a presentation on FY 2022 capital project recommendations and a COVID-19 weekly update.

real estatezoningpublic workshousingcovid-19budget
Tue Jan 26, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission is meeting to review a large volume of applications for residential and commercial property changes. The body will decide on requests ranging from minor hardscape and window updates to new dwellings and demolitions.

zoninghistoric-preservationdemolitionhousinghardscape
Tue Jan 26, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations and signage

The commission is reviewing a series of applications for hardscaping, signage, and structural changes to residential and commercial properties. These items are listed under consent and consent with conditions.

historic-districtzoninghardscapingsignagebuilding-permits
Tue Jan 26, 2021 · 00:00

Historic District Commission

No agenda available for the January 26, 2021 meeting

There is no agenda provided for this meeting. The record indicates that business from previous meetings was carried over to this session.

historic-preservationzoningresidential
Tue Jan 26, 2021 · 00:00

Historic District Commission

Historic District Commission reviews numerous property alterations

The Historic District Commission is reviewing a large volume of new business applications for residential and commercial property changes. These items include requests for new dwellings, pools, and structural modifications across various Nantucket addresses.

zoninghistoric-districthousingdemolitionconstruction
Tue Jan 26, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss real estate acquisitions and property management

The Nantucket Islands Land Bank Commission will review golf course reports and property management updates. The body will also discuss a Town license agreement for parking and a funding request for a deer/tick study. An executive session is scheduled to discuss real estate acquisitions.

real-estateproperty-managementparkingfinanceenvironment
Tue Jan 26, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review three sign requests

The Sign Advisory Council is meeting to discuss sign applications for three properties. The body will review requests for projecting signs and the relocation of existing signs.

signsland-usepermits
Tue Jan 26, 2021 · 16:00

Historic District Commission

Historic District Commission reviews residential construction and alterations

The Historic District Commission is reviewing applications for new dwellings, home additions, and exterior modifications. The meeting includes several requests for new main houses and guest houses, as well as site improvements like pools and solar installations.

zoninghousinghistoric-districtconstruction
Mon Jan 25, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board discusses property alterations and demolitions

The Historic Structures Advisory Board will meet via Zoom to review several property projects. Discussion includes hardscaping, additions, demolitions, and structural revisions across various locations.

historic-preservationzoningresidentialconstruction
Mon Jan 25, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews 17 property modification requests

The board is reviewing applications for alterations, demolitions, and hardscaping at various properties. The meeting focuses on maintaining historic standards for residential and commercial sites.

historic-preservationzoningdemolitionhardscapebuilding-permits
Mon Jan 25, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board discusses new dwellings, spas, and sheds

The Madaket Advisory Board will review several property scope of work items. Discussion includes a new dwelling on Baltimore Street and additions at Starbuck Road and Midland Avenue.

zoningresidentialland-use
Mon Jan 25, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board reviews residential dwelling and pool projects

The board is reviewing applications for new construction and modifications to existing properties. The agenda includes requests for a new dwelling and a shed, as well as a pool addition.

zoningresidential-constructionmadaketbuilding-permits
Mon Jan 25, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board discusses various residential renovations and new dwellings

The Sconset Advisory Board will review several property applications including pools, fences, windows, and new dwellings. The board will also discuss Codfish Park damage and a historic sign at 36 Main Street.

zoningresidentialconstructionhistoric-preservation
Mon Jan 25, 2021 · 00:00

Sconset Advisory Board (HDC)

Sconset Advisory Board reviews multiple residential property applications

The Sconset Advisory Board (HDC) is reviewing several requests for residential changes, including new dwellings, additions, and renovations. The agenda includes various projects involving pools, garages, windows, and decks across several streets.

zoningresidentialconstructionhousing
Sat Jan 23, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee of Non-voting Taxpayers meeting on January 23, 2021

The committee will hear a presentation by ACK Now Executive Director Julia Lindner and Executive Chairman Tobias Glidden. Members will also discuss potential future topics including Harbor Place, parking management, and energy initiatives.

transportationparkingenergyhousinggovernment-oversight
Fri Jan 22, 2021 · 00:00

One Time Event

Contract Review Committee meets to discuss quarterly reports

The Contract Review Committee will meet via Zoom to conduct business. The agenda includes the discussion of second quarterly reports and other deliberations.

government-operationsquarterly-reports
Thu Jan 21, 2021 · 00:00

Board of Health

Board of Health reviews septic permit for 167 Hummock Pond Rd

The Board of Health is meeting to review a septic permit application and associated plans for 167 Hummock Pond Rd. The agenda also includes a proposal for the Town of Nantucket Local Board of Health.

healthsepticpermitspublic-health
Thu Jan 21, 2021 · 00:00

Capital Program Committee

Capital Program Committee to discuss FY22 capital recommendations

The committee is meeting to discuss FY22 capital recommendations and the associated report. Members will also review and discuss funding sources.

budgetcapital-improvementsfinance
Thu Jan 21, 2021 · 00:00

Cyrus Peirce Middle School

Cyrus Peirce Middle School Council to discuss parent conferences and staffing

The CPS School Council is meeting to discuss planning for parent-teacher conferences and a potential additional encore position for the next school year. The body will also review feedback regarding weekly parent updates.

educationschool-staffingparent-engagement
Thu Jan 21, 2021 · 00:00

Historic District Commission

Historic District Commission to review residential construction and alterations

The Historic District Commission is meeting to discuss various property modifications, including new dwellings and hardscaping. The body will also review revisions to the HDC Background Summary for the town web page.

zoninghistoric-preservationresidential-constructionsolar
Thu Jan 21, 2021 · 00:00

Nantucket Public School Committee

School Committee to vote on School Opportunity Act and private donations

The Nantucket School Committee is meeting to discuss the 2021-2022 school calendar, the Pathways to Diversity Program, and the district bullying report. The body will vote on a submission to the Department of Education and several donations for school programs.

educationbudgetdonationsschool-calendar
Thu Jan 21, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review parking and signage requests

The Traffic Safety Work Group is meeting to review several requests for new parking signs, yellow curb lines, and traffic calming devices. The body will also consider a curb cut application and a proposal for a new bus stop.

parkingtraffic-safetysignagepublic-workstransportation
Thu Jan 21, 2021 · 00:00

Traffic Safety Work Group

Traffic Safety Work Group to review parking and signage requests

The Traffic Safety Work Group is meeting to review several requests regarding parking restrictions, signage, and traffic calming. The group will also consider a Department of Public Works proposal for a bus stop.

traffic-safetyparkingsignagepublic-transportroads
Thu Jan 21, 2021 · 00:00

Tree Advisory Committee

Tree Advisory Committee to review tree policies and credit balances

The Tree Advisory Committee is meeting to discuss the town's tree maintenance plan, planting and credit policies, and a tree inventory update. The body will also review suggested changes to Chapter 132 language regarding trees and shrubs for the Town Council.

treesenvironmentpublic-workspolicy
Thu Jan 21, 2021 · 00:00

Board of Health

Nantucket Board of Health discusses septic loans and pool standards

The Board of Health will review minutes from December 17, 2020, and address several septic-related matters. The meeting includes a continued public hearing regarding swimming pool minimum standards and a variance request for 167 Hummock Pond.

septicpublic-healthswimming-poolscovid-19zoning-variance
Wed Jan 20, 2021 · 00:00

Select Board

Select Board to consider $5.8M sewer construction contract

The Select Board will review COVID-19 metrics and vaccine distribution plans. The body is deciding on several town contracts and hearing a request to transfer a liquor license. Members will also review FY 2021 second quarter and FY 2022 enterprise fund budget reports.

sewerbudgetcovid-19liquor-licensescontractsmarine
Wed Jan 20, 2021 · 00:00

Select Board

Select Board to consider liquor license transfer for The Islander

The Select Board will hold a public hearing regarding a liquor license transfer for a package store at 15 Old South Road. The meeting also includes COVID-19 updates and reviews of FY 2021 and FY 2022 budget reports.

liquor-licensesbudgetsewerpublic-healthcontracts
Tue Jan 19, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review Habitat request for $85k

The Affordable Housing Trust is meeting to discuss funding requests and housing projects. The body will review a CFAP application and a request for additional funds for a duplex project.

affordable-housingfundinghousing-production
Tue Jan 19, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to review Habitat for Humanity funding request

The Affordable Housing Trust will discuss a request for $85,000 from Habitat for Humanity and review a Covenant Formation Assistance Program application. The body will also provide updates on the Housing Production Plan and a request for proposals.

affordable-housinggrantshousing-production-planreal-estate
Tue Jan 19, 2021 · 00:00

Community Preservation Committee

Community Preservation Committee reviews three fund requisitions

The Community Preservation Committee is meeting to discuss fund requisitions and a CPC bylaw amendment. The body will also address a CPC voting issue.

community-preservationfundingbylawsgrants
Tue Jan 19, 2021 · 00:00

Finance Committee

Finance Committee to review Nantucket Public School FY2022 budget

The Finance Committee is meeting to discuss the Nantucket Public School budget for Fiscal Year 2022. The body will also review and potentially adopt motions regarding the 2021 Annual Town Meeting Citizen Warrant Articles.

budgetschoolstown-meetingfinance
Tue Jan 19, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to hear Coastal Resilience Plan presentation

The Harbor & Shellfish Advisory Board will discuss marine and natural resources reports and review several old business items. The meeting includes a presentation from Arcadis, a consultant for the Town Coastal Resilience Plan.

harbor-managementshellfishcoastal-resilienceenvironmentzoning
Tue Jan 19, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new dwellings

The Historic District Commission is meeting to discuss a high volume of applications for residential and commercial property changes. The body will review requests for new dwellings, sheds, solar panels, and hardscaping across various Nantucket addresses.

zoninghistoric-preservationhousingsolarconstruction
Tue Jan 19, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 18 property modification requests

The Commission is reviewing a series of consent items for property alterations. These requests include sheds, fences, additions, and roof changes across various residential addresses.

historic-districtzoningbuilding-permitsresidential-modifications
Tue Jan 19, 2021 · 00:00

Historic District Commission

Historic District Commission reviews two property applications

The commission is reviewing carried-over new business from January 4, 2021. The meeting focuses on two specific property applications.

historic-districtzoningbuilding-permits
Tue Jan 19, 2021 · 00:00

Historic District Commission

Historic District Commission reviews old business for multiple properties

The commission is reviewing old business items related to residential construction and alterations. The agenda lists various property modifications including new dwellings, solar installations, and pool structures.

historic-districtzoningconstructionsolarresidential
Tue Jan 19, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential projects at multiple properties

The commission is reviewing applications for new dwellings, patios, and hardscaping. The meeting includes several requests for work at 218 Cliff Road. No formal agenda was provided beyond the list of project documents.

historic-districtzoningresidential-constructionhousing
Tue Jan 19, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss real estate acquisition in executive session

The Nantucket Islands Land Bank Commission will meet to hear public comment and staff announcements. The commission will then enter an executive session to discuss the acquisition of real estate.

real-estateland-bankacquisition
Tue Jan 19, 2021 · 00:00

Roads and Right of Way Committee

Roads and Right of Way Committee to discuss downtown sidewalks and Chapter 91 goals

The committee is meeting to review the status of downtown sidewalk improvements and establish goals for Chapter 91 properties. The session includes a review of the outstanding projects list, which covers monuments, bike paths, and the Harbor Walk.

roadssidewalkszoningpublic-worksbike-paths
Sat Jan 16, 2021 · 00:00

Advisory Committee of Non-voting Taxpayers

Committee to discuss future of Our Island Home

The Advisory Committee of Non-voting Taxpayers will hold a facilitated discussion on the future of Our Island Home with consultant Herb Taylor and administrators. The committee will also receive an update on the Noise Abatement Committee.

our-island-homenoise-abatementenergytransportationshort-term-rentals
Fri Jan 15, 2021 · 00:00

One Time Event

Contract Review Committee meeting cancelled

The Contract Review Committee meeting scheduled for January 15, 2021, was cancelled. The agenda contained only procedural boilerplate.

contract-review-committeecancelled
Fri Jan 15, 2021 · 00:00

Historic District Commission

HDC to review coastal resilience and adaptation project updates

The Historic District Commission will hear presentations from consultants regarding two resilience projects. The meeting includes an update on the 'Resilient Nantucket: Designed for Adaptation' MVP project and an introduction to the Nantucket Coastal Resilience Plan.

coastal-resiliencehistoric-districtadaptationplanning
Fri Jan 15, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission discusses coastal resilience projects

The Nantucket Historical Commission is holding a special meeting to receive project updates. The session includes presentations on the Resilient Nantucket toolkit and the Nantucket Coastal Resilience Plan.

coastal-resilienceplanninghistoric-preservation
Fri Jan 15, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss 2021 goals and historic pavement

The commission is meeting to establish its 2021 objectives and key results. Members will discuss the preservation of historic pavement and the Section 106 Review for Sparks and Sewer.

historic-preservationinfrastructuregrantsplanning
Fri Jan 15, 2021 · 00:00

Nantucket Historical Commission

Nantucket Historical Commission to discuss 2021 goals and historic pavement

The commission is meeting to establish its 2021 objectives and review projects related to historic street preservation. The body will also discuss a proposed museum exhibit on the history of preservation on Nantucket.

historic-preservationzoninginfrastructuremuseum-exhibitgrant-application
Fri Jan 15, 2021 · 00:00

Nantucket Public School Committee

School Committee to hold public hearing on FY2022 budget

The Nantucket School Committee is meeting to hold a public hearing and discuss the FY2022 budget. The meeting is being conducted remotely via Zoom and YouTube.

educationbudgetpublic-hearing
Thu Jan 14, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to hold financial discussion

The Affordable Housing Trust will meet via Zoom to conduct a financial discussion. The meeting also includes time for public comment and the scheduling of a subsequent meeting.

affordable-housingfinance
Thu Jan 14, 2021 · 00:00

Finance Committee

Finance Committee to review 2021 Annual Town Meeting Citizen Warrant Articles

The Finance Committee is meeting to review and discuss articles for the 2021 Annual Town Meeting Citizen Warrant. The body may adopt motions regarding these warrant articles.

financetown-meetingshort-term-rentalslicensing
Thu Jan 14, 2021 · 00:00

Historic District Commission

Historic District Commission to review residential construction and demolition requests

The Historic District Commission is meeting to review various property modification applications. The body will consider requests for new dwellings, demolitions, and additions, as well as discuss updates to the commission's background summary for the web page.

zoninghistoric-preservationhousingdemolition
Thu Jan 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 15 property modification requests

The commission is reviewing a series of consent items for property alterations. These requests include new dwellings, additions, and exterior renovations.

historic-districtzoningbuilding-permitsresidential
Thu Jan 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations and new construction

The commission is reviewing applications for property changes and new construction. The agenda includes several items related to a pool at 9 Maine Ave and a new dwelling at 50 Eel Point Road.

historic-districtzoningconstructionresidential
Thu Jan 14, 2021 · 00:00

Historic District Commission

Historic District Commission reviews several dwelling and structure modifications

The commission is reviewing carried-over new business regarding demolition and construction projects. The agenda lists several specific properties for review, including a demolition performed without approval.

historic-districtzoningdemolitionconstructionhousing
Thu Jan 14, 2021 · 00:00

Nantucket Cultural Council

Nantucket Cultural Council to vote on 2021 grant awards

The council will review grant applications and discuss the state financial award. Members are scheduled to vote on grant recipients and the specific financial awards for the 2021 funding round.

grantsarts-and-culturefundingtourism
Thu Jan 14, 2021 · 00:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council to discuss hybrid learning and communications

The Nantucket Intermediate School Council is meeting to discuss the transition back to hybrid learning and school communications.

educationhybrid-learningschool-communications
Thu Jan 14, 2021 · 00:00

Zoning Board of Appeals

ZBA to consider permit for dwelling extension at 16 Western Avenue

The Zoning Board of Appeals will hold public hearings to determine permit requests for residential modifications. The board will decide on a modification request for 6 Fox Grape Lane and hear a new application for 16 Western Avenue.

zoningresidential-permitspublic-hearings
Thu Jan 14, 2021 · 00:00

Zoning Board of Appeals

Zoning Board to review bedroom counts and home extensions

The Zoning Board of Appeals will hold public hearings to determine if a modification to a comprehensive permit is substantial and to consider a special permit for a home extension. The board will also address a continued hearing for a property in Alger.

zoningspecial-permitpublic-hearinghousing
Thu Jan 14, 2021 · 00:00

Zoning Board of Appeals

ZBA to review bedroom count ratification and home extensions

The Zoning Board of Appeals is meeting to determine if a bedroom count modification at 6 Fox Grape Lane is substantial. The board will also consider a special permit for home and garage alterations at 16 Western Avenue.

zoningspecial-permitresidentialhousing
Wed Jan 13, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee to review property conveyances and easements

The committee is meeting to discuss the order of taking easements for the Town and the conveyance of several land parcels. The body will review specific property transfers authorized by previous Annual Town Meetings.

real-estateeasementsland-transferzoning
Wed Jan 13, 2021 · 00:00

Select Board

Select Board to hold hearing on beach regulations regarding shark attraction

The Select Board will conduct a public hearing on amending regulations for town-owned beaches and pond areas to address activities that attract sharks. The board will also review FY 2022 Enterprise Fund budget presentations and FY 2021 second quarter budget reports.

public-safetybudgethousingsewerbeaches
Wed Jan 13, 2021 · 00:00

Select Board

Select Board to hold public hearing on shark-attracting activities at beaches

The Select Board will discuss COVID-19 updates, budget presentations for enterprise funds, and a strategic plan update. The body is also considering fee waivers for affordable housing and support for a 64-unit rental development.

public-safetyhousingbudgetsewerenvironment
Wed Jan 13, 2021 · 00:00

Cemetery Commission

Cemetery Commission to review lot purchase and monument procedures

The Nantucket Cemetery Commission is meeting to approve procedures for lot purchases, monument placement, and inurnment. The body will also discuss specific site updates and layouts for local cemeteries.

cemeteriespublic-worksland-usemonuments
Wed Jan 13, 2021 · 00:00

One Time Event

Contract Review Committee meeting scheduled for January 13, 2021

The agenda for this meeting consists of procedural boilerplate. No specific contracts or substantive items are listed for deliberation.

contractstown-government
Wed Jan 13, 2021 · 00:00

Real Estate Assessment Committee

Real Estate Assessment Committee to review land takings and conveyances

The committee will discuss orders of taking for town easements and the conveyance of several parcels of land. These items include specific properties on White Street, South Shore Road, and Blueberry Lane.

real-estateland-useeasementsconveyances
Tue Jan 12, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss facility replacement and beach planning

The Nantucket Islands Land Bank Commission is meeting to discuss property management and financial business. The body will review proposals for a storage building and planning for Cathcart Beach.

real-estateproperty-managementlitigationpublic-worksfinance
Tue Jan 12, 2021 · 00:00

Select Board

Select Board to hold Facilities Master Plan Workshop #2

The Select Board is meeting via Zoom to conduct the second workshop regarding the Facilities Master Plan. No other substantive items are listed for decision or discussion.

facilitiesplanningtown-management
Tue Jan 12, 2021 · 00:00

Select Board

Select Board to hold Facilities Master Plan workshop

The Select Board is conducting a second workshop to develop a Facilities Master Plan. This session focuses on public services, amenities, employee housing, and other town-owned facilities.

facilities-planningemployee-housingpublic-amenitiestown-operations
Tue Jan 12, 2021 · 16:00

Airport Commission, Nantucket Memorial

Airport Commission to hold public meeting on Draft Environmental Impact Report

The Nantucket Memorial Airport Commission is conducting a public meeting to discuss the Draft Environmental Impact Report and Environmental Assessment. The body will also review airport lighting policy and the declaration of surplus property at 14 Airport Road.

airportenvironmentzoningtransportationpublic-safety
Remote Participation Via Zoom
Tue Jan 12, 2021 · 00:00

Affordable Housing Trust

Nantucket holds public session on Housing Production Plan update

The Affordable Housing Trust is conducting a public information session to discuss updating the Town's Housing Production Plan. Project consultants will lead interactive activities to identify housing needs, challenges, and opportunities.

affordable-housinghousing-production-planpublic-hearingzoning
Tue Jan 12, 2021 · 00:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee to review plan updates and toolkits

The Coastal Resilience Advisory Committee is meeting to receive updates on the Coastal Resilience Plan and the Resilient Nantucket project. The body will discuss data collection, public outreach, and adaptation designs.

coastal-resilienceenvironmental-planningpublic-outreachadaptation
Mon Jan 11, 2021 · 00:00

One Time Event

Contract Review Committee meets January 11, 2021

The Contract Review Committee is meeting via Zoom. The agenda consists of procedural boilerplate items.

contractsprocedural
Mon Jan 11, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to discuss pool application for 9 Maine Avenue

The Madaket Advisory Board will meet via Zoom to conduct procedural business and review minutes from November 2020 and January 2021. The board will also hold a discussion and vote regarding a pool application for 9 Maine Avenue.

zoninghousingpools
Mon Jan 11, 2021 · 00:00

Planning Board

Planning Board to review coastal resiliency and multiple property applications

The Planning Board will receive a presentation on coastal resiliency from Arcadis and review several applications for second dwellings and ANR plans. The board will also hold public hearings for various property sites and discuss Harbor Place.

coastal-resiliencyzoninghousingpublic-hearingsland-use
Mon Jan 11, 2021 · 00:00

Planning Board

Planning Board reviews second dwelling requests and land subdivisions

The Planning Board is meeting to review applications for second dwellings and After Neighborhood Review (ANR) plans. The board will also hold public hearings for several specific properties and discuss Harbor Place.

zoningland-usehousingpublic-hearings
Mon Jan 11, 2021 · 00:00

Finance Committee

Finance Committee to review Citizen Warrant Articles

The Finance Committee is meeting to discuss Citizen Warrant Articles, including a bylaw change regarding the safety of drinking water. The committee will also confirm member assignments for the FY22 budget review.

financedrinking-waterbudgetwarrant-articles
Fri Jan 8, 2021 · 00:00

Historic District Commission

HDC reviews addition at 27 N Liberty Street

The Historic District Commission is holding a special meeting to discuss old business and administrative updates. The body will review a specific property addition and discuss internal policy and maintenance issues.

historic-districtzoningmaintenancepolicy
Fri Jan 8, 2021 · 00:00

Historic District Commission

No meeting agenda available

There is no agenda available for this meeting. The record contains various documents related to 27 N. Liberty St, but no formal list of actions or decisions.

historic-district-commissionnantucket
Thu Jan 7, 2021 · 00:00

Capital Program Committee

Capital Program Committee to vote on Airport FY22 capital requests

The Capital Program Committee will discuss and vote on capital requests for the Airport for fiscal year 2022. The committee will also review minutes from December 2020 meetings.

airportpublic-safetycapital-budget
Thu Jan 7, 2021 · 00:00

Conservation Commission

Conservation Commission to hold public hearings on multiple project intents

The Nantucket Conservation Commission is meeting to conduct public hearings on several Notices of Intent and Amended Orders of Conditions. The body will also review Requests for Determination and provide a Coastal Resiliency plan update.

conservationenvironmentpublic-hearingzoningcoastal-resiliency
Thu Jan 7, 2021 · 00:00

Select Board

Select Board to discuss PFAS legal strategies and real estate transactions

The Select Board and County Commissioners will meet via Zoom to conduct executive sessions. Discussions will focus on legal strategies regarding Polyfluoroalkyl Substances (PFAS) and the value or purchase of specific real properties.

legal-claimspfasreal-estateexecutive-session
Thu Jan 7, 2021 · 00:00

Historic District Commission

Historic District Commission to review multiple residential construction applications

The Historic District Commission is meeting to review applications for new dwellings, demolitions, and exterior modifications. The body will also discuss policies regarding move/demo hearings and the HDC Background Summary for the web page.

zoninghistoric-preservationdemolitionhousingsigns
Thu Jan 7, 2021 · 00:00

Nantucket Elementary School Council

Nantucket Elementary School Council to discuss FY'22 budget and remote learning

The Nantucket Elementary School Council will meet to receive updates on remote learning and the FY'22 budget process. The council also intends to approve meeting minutes from November 4, 2020.

educationbudgetremote-learningschool-council
Wed Jan 6, 2021 · 00:00

Council on Aging

Council on Aging to discuss future options for Our Island Home

The Council on Aging will meet via Zoom to approve previous meeting minutes and hold a facilitated discussion. Herb Taylor and Michelle Munroe will lead the discussion regarding options for the future of Our Island Home.

senior-serviceshousingcommunity-planning
Wed Jan 6, 2021 · 00:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss real estate acquisition in executive session

The Nantucket Islands Land Bank Commission will meet to hear public comment and staff announcements. The body will then enter an executive session to discuss the acquisition of real estate.

real-estateland-bankacquisition
Wed Jan 6, 2021 · 00:00

Select Board

Select Board to hold public hearing on proposed FY 2022 General Fund Budget

The Select Board is meeting to conduct a public hearing on the proposed FY 2022 General Fund Budget and receive COVID-19 updates. The board will also review the 2021 Annual Town Meeting and Election timeline and consider several municipal contracts.

budgetcovid-19contractspublic-healthtown-meeting
Wed Jan 6, 2021 · 00:00

Select Board

Select Board to hold public hearing on proposed FY 2022 General Fund Budget

The Select Board will conduct a public hearing on the proposed FY 2022 General Fund Budget and receive an update on the Nantucket Coastal Resilience Planning Process. The body will also review COVID-19 metrics and the 2021 Annual Town Meeting timeline.

budgetcovid-19coastal-resiliencecontractspublic-health
Wed Jan 6, 2021 · 00:00

One Time Event

Contract Review Committee to interview human services agencies

The Contract Review Committee is meeting to conduct interviews and discussions with human services agencies requesting town funding. The committee will also receive an update on Gosnold.

human-servicestown-fundingcontractsgosnold
Tue Jan 5, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust discusses housing production and property assets

The Affordable Housing Trust will discuss updates to the Housing Production Plan and RFPs. Members will also hold a preliminary discussion regarding 7 Amelia Drive and potential Land Bank donations.

affordable-housinghousing-productionland-bankreal-estate
Tue Jan 5, 2021 · 00:00

Affordable Housing Trust

Affordable Housing Trust to discuss 7 Amelia Drive and RFP approvals

The Affordable Housing Trust is meeting to approve RFPs and discuss the Housing Production Plan. The body will also hold a preliminary discussion regarding 7 Amelia Drive and a potential Land Bank donation of a building at 15 Commercial Wharf.

affordable-housingreal-estateland-bankhousing-production-planrfp
Tue Jan 5, 2021 · 00:00

Conservation Commission

Nantucket Conservation Commission meeting cancelled

The meeting scheduled for January 5, 2021, was cancelled. The agenda had included a 2019 annual review for the Siasconset Beach Preservation Fund.

conservationbeach-preservationenvironmental-review
Tue Jan 5, 2021 · 00:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss dredging and oyster permits

The Harbor & Shellfish Advisory Board will meet to review reports from the Marine and Natural Resources departments. The board will discuss several ongoing harbor and shellfish management issues.

shellfishharbor-managementdredgingenvironmental-policycoastal-resilience
Tue Jan 5, 2021 · 00:00

Nantucket Historical Commission

Historical Commission to discuss Wilkes Square and historic pavement preservation

The Nantucket Historical Commission will provide an update on preservation planning for the Wilkes Square and Harbor Place redevelopment. The body will also review historic pavement preservation and the Sparks and Sewer Section 106 review.

historic-preservationurban-planninginfrastructuregrants
Tue Jan 5, 2021 · 00:00

Nantucket Historical Commission

Historical Commission to discuss Wilkes Square and Harbor Place redevelopment

The Nantucket Historical Commission is meeting to provide updates on preservation planning for the Wilkes Square / Harbor Place parcel. The body will also discuss historic pavement preservation and a survey grant application.

preservationzoninginfrastructurehistoric-pavementredevelopment
Tue Jan 5, 2021 · 00:00

Nantucket Public School Committee

School Committee to review FY22 budget and vote on donations

The Nantucket Public School Committee will discuss the FY22 budget development and receive updates on COVID-19 and enrollment. The body will vote on several donations and an amendment to the social media policy.

educationbudgetdonationscovid-19policy
Tue Jan 5, 2021 · 00:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign requests for 137A Orange Street

The Sign Advisory Council is meeting to discuss sign applications and enforcement. The body will review requests for wall and projecting signs at a specific Orange Street address.

signszoningland-use
Mon Jan 4, 2021 · 00:00

Council for Human Services

Council for Human Services to plan January 25 community forum

The Council for Human Services will receive an update on the COVID Resources Response Team. Members will also discuss planning for a community forum on January 25, focusing on outreach, panelists, and translation services.

human-servicescovid-19community-forumpublic-outreach
Mon Jan 4, 2021 · 00:00

Historic District Commission

Historic District Commission to review numerous property alterations and new dwellings

The Historic District Commission is meeting to discuss and decide on a variety of residential applications, including new dwellings, demolitions, and exterior renovations. The body will also review revisions to the HDC Background Summary for the town web page.

zoninghistoric-preservationhousingdemolition
Mon Jan 4, 2021 · 00:00

Historic District Commission

Historic District Commission reviews property alterations

The commission is reviewing several requests for property changes, including roof modifications and additions. The agenda lists items for consent or consent with conditions.

historic-districtzoningproperty-alterationsnantucket
Mon Jan 4, 2021 · 00:00

Historic District Commission

Historic District Commission reviews residential projects at multiple addresses

The commission is reviewing carried-over new business from December 22, 2020. The meeting focuses on various residential alterations, additions, and hardscape projects.

historic-districtzoningresidential-constructionhardscape
Mon Jan 4, 2021 · 00:00

Historic District Commission

Historic District Commission reviews 10 property modification requests

The Commission is reviewing applications for new dwellings, additions, and structural changes at various properties. The body will also address a demolition performed without approval at 1 Morgan Square.

historic-districtzoningbuilding-permitsdemolition
Mon Jan 4, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential projects at 218 Cliff Road and others

The Historic Structures Advisory Board is meeting to discuss old and new business regarding property modifications. The board will review proposals for new construction, additions, and structural changes at several residential addresses.

historic-preservationzoningresidential-constructionnantucket
Mon Jan 4, 2021 · 00:00

Historic Structures Advisory Board (HDC)

Historic Structures Advisory Board reviews residential construction projects

The board is reviewing applications for residential alterations, new construction, and additions. The agenda consists of several property-specific project documents for review.

zoninghistoric-preservationresidential-constructionbuilding-permits
Mon Jan 4, 2021 · 00:00

Madaket Advisory Board

Madaket Advisory Board to review pool project on Maine Ave

The Madaket Advisory Board is meeting to conduct procedural business and review one new business item. The board will consider a scope of work for a pool at 10-2033 9 Maine Ave.

land-useresidential-improvementmadaket
Mon Jan 4, 2021 · 00:00

Capital Program Committee

Capital Program Committee meeting cancelled

The Capital Program Committee meeting scheduled for January 4, 2021, was cancelled.

capital-program-committee