The Boring PartsFederalLocal · USLocal · Canada

Nantucket County, Massachusetts

Recent Nantucket County County Commission topics include roads & infrastructure, planning & zoning, contracts & procurement, budget & taxes, permits & licensing, water & utilities.

Topics found in recent meetings

Recent Nantucket County meeting summaries, agendas, and minutes

Get Nantucket County meeting alerts

One email when Nantucket County posts a new agenda or minutes. Free, unsubscribe anytime.

Upcoming

📅 Subscribe to Nantucket County meetings — new meetings appear in your calendar automatically
Wed Jul 22, 2026 · 17:30

County Commission

Public hearing on eminent domain for Tom Nevers Road multi‑use path easement

The Nantucket County Commission will hold a public hearing to consider taking temporary and permanent easements by eminent domain over the east side of Tom Nevers Road for a multi‑use path. The commission will also consider a petition to designate Egan Lane (Common Drive) as a public road and refer it to the Planning Board. Minutes from the June 24, 2026 meeting and July 2026 payroll and treasury warrants will be approved.

eminent-domaintransportationplanningfinancepublic-comment
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNTY COMMISSIONERS Day, Date, and Time WEDNESDAY, JULY 22, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/t4C7OZZ5Yn8 ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_xwVywEb0SZC96Yn-RbL6Og I. CALL TO ORDER II. ANNOUNCEMENTS 1. The County Commission Meeting is Being Audio and Video Recorded. III. PUBLIC COMMENT* IV. NEW BUSINESS** V. APPROVAL OF MINUTES AND WARRANTS 1. Approval of Minutes of June 24, 2026 at 5:30 PM. 2. Approval of Payroll and Treasury Warrants for July, 2026. VI. PUBLIC HEARINGS 1. Public Hearing to Consider the Taking by Eminent Domain of Temporary and Permanent Easements Over the East Side of Tom Nevers Road from Milestone Road to Tom Nevers Park for T [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026 · 17:30

Select Board

Select Board to approve pending contracts and grant agreements on July 22

The Nantucket Select Board will consider routine business such as accepting the agenda, approving minutes and payroll warrants, and voting on pending contracts and grant agreements listed in Exhibit 2. The board will also discuss housing matters, including an amendment to the Affordable Housing Trust Fund declaration to raise the AMI limit, and a review of the Chapter 40B housing production plan. Additional items include a request to petition the County Commission to designate Egan Lane as a public road, and a request for historic‑preservation restriction for the property at 6 Broadway.

budgethousingroadshistoric-preservationcommitteesgrants
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JULY 22, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/t4C7OZZ5Yn8 ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_xwVywEb0SZC96Yn-RbL6Og I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Announce Applications Received for 2026 Committee Vacancies – Round 2: Board of Health, Cannabis Advisory Committee, Coastal Resiliency Advisory Committee, Council for Human Services, Council on Aging, Cultural Council, Finance Committee, Nantucket Affordable Housing Trust, Town of Nantucket Scholarship Committee, Sign Advisory Council, Zoning Board of Appeals - [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026 · 17:30

African Meeting House Investigation Procurement Workgroup

Workgroup will attend Select Board meeting on African Meeting House report

The African Meeting House Investigation Procurement Workgroup will meet on July 22, 2026 at 5:30 PM in the PSF Community Room at 4 Fairgrounds Road and via Zoom. The workgroup’s agenda includes attending a Select Board meeting to review the African Meeting House Investigation Report and its issuance. The meeting will conclude with adjournment.

historic-preservationprocurementcommunitymeeting
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s African Meeting House Investigation Procurement Workgroup Day, Date, and Time Wednesday, July 22, 2026 at 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Dr. Malcolm MacNab, Chair WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/t4C7OZZ5Yn8 ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_xwVywEb0SZC96Yn-RbL6Og 1. Call to Order 2. Attend Select Board Meeting Regarding African Meeting House Investigation of the Investigation Report Issuance and Review. 3. Adjournment
Wed Jul 22, 2026 · 18:00

Sign Advisory Council (HDC)

Sign Advisory Council to review sign permits and enforcement

The Sign Advisory Council will meet to review temporary sign permits for properties on Main Street and Water Street, and to approve minutes from previous meetings. The meeting will be held remotely via Zoom.

signszoningpermitsremote-meetingland-use
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, July 28, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of Agenda 5. App [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 22, 2026 · 13:30

Nantucket Housing Authority

Nantucket Housing Authority to review July 2026 bills and payroll

The Nantucket Housing Authority will meet to approve the July 2026 warrant for bills and payroll. The board will also review the minutes from June 24, 2026, and receive a report from the Executive Director.

housingbudgetpayrolladministration
3 Manta Drive, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Housing Authority Day, Date, and Time Wednesday, July 22, 2026, 1:30 PM Location / Address 3 Manta Drive, Nantucket and or via hybrid remote participation Signature of Chair or Authorized Person Nancy Friend, Executive Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join: https://teams.microsoft.com/meet/290588616985737?p=uuPnpvBfFw9SNt888n Meeting ID: 290 588 616 985 737 Passcode: A67vy6UA AGENDA Open Session 1. Call to order/roll call 2. Approval of Agenda 3. Bill roll/Payroll Signing of Warrant July 2026 4. Minutes of June 24, 2026 5. Executive Director’s Report Other Business: Report from Other Committees: CPC, AHT, Habitat for Humanity, NP & EDC Adjournment:
Thu Jul 23, 2026 · 12:00

Council for Human Services

Council for Human Services will review FY27 grant funding for human services and substance misuse

The Council for Human Services meeting will establish quorum, approve prior minutes, and elect a chair and co‑chair. Members will appoint two CHS members to the Contract Review Committee, receive updates on the Community Needs Assessment, and review grant applications and FY27 grant funding for human services and substance misuse. A grant award ceremony is scheduled for September 18, 2026.

human-servicesgrantsappointmentscommunity-assessmentmeeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL FOR HUMAN SERVICES Day, Date, and Time THURSDAY, JULY 23RD, 2026, AT 12:00 PM Location / Address  131 PLEASANT ST: ROOM A  REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! JOIN ZOOM MEETING: https://us06web.zoom.us/j/82796789140?pwd=DxKSyqDecFaarU74BZnIlZP0jdbL9b.1 Meeting ID: 827 9678 9140 Passcode: 868111 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Approval of Minutes from 6/25/2026 IV. Public Comment V. Introduction of New Member of CHS and welcome back to returning members VI. Election of Chair and Co-Chair VII. Overview of Council for Human Services and Contract Review Committee. VIII. Appointment of two CHS members to Contract Review Committee IX. Update from Community Needs Assessment workgroup X. Grant Application Review and update of the Rubric XI. Grant funding for FY27 for Human Services and Substance Misuse X [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 23, 2026 · 14:00

Real Estate Assessment Committee

Real Estate Assessment Committee to discuss land subdivisions and conveyances

The Real Estate Assessment Committee will meet to approve minutes, discuss a subdivision recommendation for Lot G, and review a proposed conveyance of Parcel 14. The committee will also discuss a proposal for an alternate member and the status of the Yard Sale Program.

real-estatezoningland-usebudgetpublic-works
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s REAL ESTATE ASSESSMENT COMMITTEE Day, Date, and Time Thursday, July 23, 2026 at 2:00 PM Location / Address • 131 Pleasant Street, Trailer Room A and • REMOTE PARTICIPATION VIA ZOOM (See below) Signature of Chair or Authorized Person Tracy MacDonald, Real Estate Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA JULY 23, 2026 JOIN ZOOM MEETING: https://us06web.zoom.us/j/86742258172?pwd=bVhAREZJW0NKw0c99qoIeqiGWOKwWh.1 I. CALL TO ORDER II. APPROVAL OF THE AGENDA III. APPROVAL OF MINUTES OF MEETINGS FOR MAY 18, 2026 IV. PUBLIC COMMENT V. REAL ESTATE MATTERS (a) Update of previous continuance from February 13, 2026 and May 18, 2026 for recommendation to subdivide Lot G on Plan 2016-47 into 2 lots and release a request for proposals to abutters for the parcels in the Order of Taking recorded in Book 1546, Page 50. Lot G is currently a 7,000± sq. ft. lot. 2 (b) Recommendation for conveyance of Parcel 14 on Plan 2014-52 owned by the Town of Nantucket by virtue of Order of Taking dated September 10, 2014. The parcel is 8,978 +/- square feet [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 23, 2026 · 17:00

Nantucket Public School Committee

School Committee to vote on Superintendent's contract revisions

The Nantucket School Committee will hold a workshop session to discuss communication practices and district goals. The meeting includes an executive session to conduct strategy and contract negotiations with the Superintendent of Schools.

educationcontractssuperintendentschool-committee
56 Center Street
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting - Workshop/Executive Session Day, Date, and Time Thursday, July 23, 2026, 5:00 PM Location / Address Nantucket Community School Music Center, Conference Room 56 Centre Street Nantucket, MA 02544 Signature of Chair or Authorized Person WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda III. Motion to go into Workshop Agenda session IV. Hybrid Meeting Etiquette - Debora Goudemond, Committee Operations Coordinator V. School Committee Communication Practices - Debora Goudemond, Committee Operations Coordinator VI. District Updates VII. School Committee Goals aligned to DESE District Standards & Indicators VIII. Motion to go into executive session pursuant to M.G.L. c. 30A section 21(a) for the following purposes: IX. Topic of Discussion - EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) Purpose (2): to conduct strategy sessions in preparation for negotiations with nonunion personnel and to conduct contract negotiations with nonunion personnel (Superintendent of Schools). X. Ad [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Jul 24, 2026 · 09:00

Contract Review Committee, Human Services

Contract Review Committee to review FY 26 grants and FY 27 timeline

The Contract Review Committee will discuss the FY 26 grant process, application, and rubric. The body will also establish a timeline for FY 27 grants and plan a grant award ceremony for September 18, 2026.

grantshuman-servicesbudgetcommunity-needs
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CONTRACT REVIEW COMMITTEE Day, Date, and Time FRIDAY, JULY 24TH, 2025, AT 9:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM 131 PLEASNT STREET: ROOM B The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK AT-LARGE/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89353894175?pwd=atxLCxBj6eiTlEstTljgNizEmsb4yW.1 Meeting ID: 893 5389 4175 Passcode: 134482 AGENDA I. Call to Order II. Establish Quorum III. Acceptance of Agenda IV. Public Comment V. Approval of Minutes from 6/25/2026 VI. Update from Community Needs Assessment Workgroup VII. Review of FY 26 grants and discussion of any changes to grant process, application and rubric. VIII. Letter requesting funding for FY 27 and beyond. IX. Establish timeline for grant process FY 27 X. Grant Award Ceremony for Sept. 18, 2026 XI. New Business XII. Establish next meeting date XIII. Adjournment *FOR MATTERS NOT REASONABL [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Aug 5, 2026 · 15:00

Council on Aging

Council on Aging to discuss Seniors of the Year and Senior Expo

The Council on Aging will consider approval of minutes and hear updates on the Seniors of the Year and Senior Expo events. Reports from the Saltmarsh Senior Center coordinator and the Health and Human Services deputy director are also on the agenda. No votes on ordinances or contracts are scheduled.

council-on-agingseniorsnantucketmeeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, August 5,2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Erin Lynch, Vice Chair WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Approval of minutes of May 3,2026 V. Official business 1. Seniors of the Year Update - Robert Kucharavy and Mary Anne Easley 2 2. Senior Expo Update - Mary Anne Easley and Erin Lynch VI. Report - Coordinator, Saltmarsh Senior Center VII. Report - Deputy Director, Nantu [Excerpt truncated on this listing page; use the official record for the full text.]

Recent meetings

Tue Jul 21, 2026 · 10:00

Community Preservation Committee

Community Preservation Committee reviews $122,538 in fund requisitions

The Community Preservation Committee is meeting to review fund requisitions for town surveys and rental assistance. The body will also discuss preservation easements, project assignments, and the upcoming annual public forum.

community-preservationfundingsurveysrental-assistanceeasements
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time TUESDAY, JULY 21, 2026 10:00 AM Location / Address 131 PLEASANT STREET – ROOM A (HYBRID) Remote Participation via Zoom Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Linda Williams, Chair Eleanor Antonietti Joeph Topham, Vice, Chaira John Schafer Neville Richen Jesse Dutra Dawn Hill Holdgate Constance Patten Tim Soverino Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Approval of Minutes 6/23/2026 Public Comment Correspondence/Guest: None Guests: New Business: 1. Fund Requisitions: - Town of Nantucket/PIN – Main Street Streetscapes Survey FY 25 $50,000 (Williams) - Town of Nantucket/PIN – W. MonomoyNeighborhood Survey Phase 1 – FY 25 $60,000 - Interfaith Co [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 21, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review 33 Main St sign for The Hill House

The Sign Advisory Council will hold a public meeting to discuss and vote on a revised sign for 33 Main St (The Hill House), as well as approve minutes from prior meetings. No other substantive business is scheduled; the meeting includes public comment and commissioner comments.

signshistoric-districtnantucketpublic-hearing
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, July 21, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of Agenda 5. App [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 21, 2026 · 16:00

Transportation and Public Access Advisory Committee

Discussion of Tom Nevers Road Multiuse Path easement and construction plans

The Transportation and Public Access Advisory Committee will meet on July 21, 2026 to consider a range of transportation and public‑access topics. Items include updates on real‑estate encroachments, public way monuments, downtown sidewalk parking, bike‑path signage, and travel‑demand forecasting. The committee will review multi‑use path projects on Tom Nevers Road and Wauwinet Road, including public forum input, easement acquisition, and construction bidding. Additional updates will cover regional transportation plans, DPW stormwater work, and NRTA scheduling.

transportationpublic-accessmultiuse-pathparkingstormwaterplanning
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Transportation and Public Access Advisory Committee (TPAC) Day, Date, and Time Tuesday, July 21, 2026, at 4:00 pm Location / Address Room A, The Trailer, 131 Pleasant Street; or by Zoom: Join Zoom Meeting https://us06web.zoom.us/j/87669110695?pwd=mIL8nMalDNshfRZ9D5DiaDEjIs0ZP5.1 Meeting ID: 876 6911 0695 Passcode: 487956 Signature of Chair or Authorized Person Mike Burns WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Members: Gordon Auchterlonie, Edwin Claflin, Nelson (Snookie) Eldridge, Ian Golding, Michel Kremer, Nat Lowell, Mickey Rowland, and Lee Saperstein Ex Officio Members: Mike Burns, Drew Patnode, Bob Bystrowski, Tracy MacDonald, and Gary Roberts. 1. Call to Order, Roll Call, and Member Introductions; this meeting is being audio and video recorded: Mike Burns. 2. Election of Officers 3. Public Comments on Items not on the Agenda. 4. Approval of Minuting Notes: none to approve 5. Real Estate / Encroachment Issues: a. Wesco Lane access and monument installation [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 21, 2026 · 16:00

Historic District Commission

Historic District Commission to review 43 applications for permits

The Historic District Commission will meet to discuss and vote on 43 applications for historic district permits, including new dwellings, garage additions, and pool installations. The meeting will also include a public comment period and a question-and-answer session with the preservation planner.

historic-districtzoningpermitsconstructionhardscapepoolgaragemeeting
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday July 21, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_qotB6RfwTYieYAzCBcKOTw#/registration To watch live feed, click here: https://www.youtube.com/live/RWeo6WkWh8E Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantuc [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 20, 2026 · 11:00

Select Board

Public hearings on multiple utility infrastructure projects

The Select Board will review car rental medallion applications and hold public hearings on several utility petitions. The petitions involve installing new junction boxes, handholes, and conduit for electric service on Nobadeer Farm Road, Gray Avenue, Fairgrounds Road, and Sparks Avenue. One petition to relocate a joint-owned pole was withdrawn. No decisions are recorded in the agenda.

licensingelectrictelecominfrastructureconstructionpublic-hearing
REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, JULY 20, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/zrr3JWnr0N0 ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_-dmx3SMsRWWKIUbmkw9u7w I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Request for Review and Action on Car Rental Medallion Applications for Car Rental Medallion Waitlist Applicants. IV. LICENSING AND PETITIONS - PUBLIC HEARINGS 1. Public Hearing to Consider Utility Petition from Nantucket Electric Company/ National Grid, Plan #31183442 to Install New Junction Box at Pole 10 on Nobadeer Farm Road and Approximately 130’ of 2-4” Conduits Down and Across Nobadeer Farm Road for [Excerpt truncated on this listing page; use the official record for the full text.]
Sat Jul 18, 2026 · 10:00

Advisory Committee of Non-voting Taxpayers

Committee continues discussion on year-round resident property tax exemption increase

The Advisory Committee of Non-voting Taxpayers (ACNVT) will meet on July 18, 2026. The agenda includes a continued discussion on a potential increase to the year-round resident property tax exemption, a guest speaker from the Town Manager, and election of officers for FY2027. Other procedural items include approval of minutes and a special employee status request.

property-taxtax-exemptionyear-round-residentsadvisory-committeenantuckettown-meeting
PSF TRAINING ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Advisory Committee of Non-Voting Taxpayers Day, Date, and Time Saturday July 18, 2026 at 10 a.m. Location / Address IN PERSON IN THE TRAINING ROOM (2ND FL) OF THE SAFETY CENTER AT 4 FAIRGROUNDS RD AND REMOTELY VIA ZOOM; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/@nantucketgov/videos Signature of Chair or Authorized Person Kathy Baird, Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Meeting at: https://us06web.zoom.us/j/86417935491 Meeting ID: 864 1793 5491 Call to Order This meeting is being audio and video recorded - read statement for Remote Zoom Meeting Membership count for quorum Approval of Agenda for today’s meeting, if quorum present Approval of draft minutes for meeting of June 27, 2026 if quorum present Welcome to New Committee Members Guest Speaker – Libby Gibson (Town Manager) Special Employee Status Request 2 Committee of the Month – Newsletter [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Jul 17, 2026 · 10:00

Nantucket Historical Commission

Historical Commission to review survey projects and proposed survey forms

The Nantucket Historical Commission will discuss updates on the West Monomoy Survey Project and the Massachusetts Historical Commission FY23 Survey of Brant Point and Cliffside, as well as proposed survey forms for the future Wauwinet Bike Path. The meeting also includes public comment, election of officers, and approval of previous meeting minutes.

historical-commissionsurveyspreservationnantucketpublic-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, July 17, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Election of Officers • Staff update • West Monomoy Survey Project Update with Cleary Larkin, Preservation Institute Nantucket • Massachusetts Historical Commission FY23 Survey of Brant Point and Cliffside Update with Easton Architects • Proposed Survey Forms for Future Wauwinet Bike Path [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 16, 2026 · 13:00

Cannabis Advisory Committee

Cannabis advisory panel to discuss social consumption, DEA rescheduling

The Nantucket Cannabis Advisory Committee will consider DEA rescheduling of cannabis from Schedule I to III, new state cannabis reform legislation, ACK Natural deliveries, and continued discussions on social consumption. The committee will also appoint a Select Board representative and appointee.

cannabissocial-consumptionde-reschedulinglegislationcommittee-appointmentsnantucket
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Cannabis Advisory Committee (CAC) Day, Date, and Time Thursday July 16, 2026, 1:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Barry Rector WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Board Members: Barry G. Rector (Chair), Abby DeMolina (Vice-Chair), Joe Plandowski (Secretary), Dawn Hill, Jacques Zimicki Join Zoom Meeting https://us06web.zoom.us/j/84056571521?pwd=TzVQMVZXdkV6SGt6MmpmTFM5dm9rZz09 Meeting ID: 840 5657 1521 Find your local number: https://us06web.zoom.us/u/kZpvpnBWV One tap mobile +13092053325,,88677055726#,,,,*027151# US Dial by your location +1 309 205 3325 US +1 646 558 8656 US (New York) +1 301 715 8592 US (Washington DC) 2 AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. I. Call to Order II. Acceptance of Agenda III. Announcements a. The Cannabis Advisory Committee M [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 16, 2026 · 17:00

Conservation Commission

Conservation Commission holds public hearing on multiple development notices

The Nantucket Conservation Commission will conduct a public hearing on several Notice of Intent applications, both with and without required waivers. Items include development proposals for 73 Hulbert Avenue, 27 Nonantum Avenue, 19 North Water Street & 3 White Elephant Way, Polpis Harbor & Hither Creek dredging, and 27 Osprey Way. The meeting will also address amended orders of conditions, certificates of compliance, enforcement actions, and approval of minutes from the July 2 meeting.

conservationpublic-hearingdevelopmentzoningpermitsenvironment
131 Pleasant Street, Meeting Trailer Room A, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 JUL 06 PM 02:09 Original Posting Number: T 478 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, July 16, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: YouTube Link: https://youtube.com/live/HV7z5bbxQec Zoom Registration: https://us06web.zoom.us/webinar/register/WN_xyNgccriQnmy_qOMGKPXzw Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for July 16, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 16, 2026 · 17:00

Parks and Recreation Commission

Parks Commission to discuss FY'28 capital projects, Nobadeer update

The Nantucket Parks and Recreation Commission meets remotely to discuss capital project updates and planning for FY'28. Items include updates on the Nobadeer Project and Tom Nevers debris removal, as well as proposed playground renovations at Winter Park, Jetties, and Childrens Beach. The commission will also select officers for the new year and hear a report from the Cultural Affairs and Special Events Coordinator regarding an event at Summer Street Church.

parks-and-recreationcapital-projectsplaygroundsnobadeertom-neversbaseball-fieldscultural-affairs
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday, July 16, at 5:00 p.m. Location / Address REMOTE PARTICIPATION ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW.1 Meeting ID: 817 4815 2269 Passcode: 983395 Nantucket Parks and Recreation Commission Meeting Notice and Agenda Thursday, July 16 2026 Meeting to be held at 5:00 p.m. Remotely Via Zoom. 1. Call to Order 2. Reminder this meeting is being audio and video recorded 3. Selection of Officers for the new year. • Chair • Vice-Chair • Secretary 2 4. Approval of Agenda for July 16, 2026 5. Public Comment 6. Approval of Minutes from May 21, 2026 7. Culture and Tourism: Deana Weatherly -Cultural Affairs and Special Events Coordinator • Summer Street [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 16, 2026 · 16:00

Board of Health

Board of Health to hear appeal on sewer connection order at 49 Polpis Road

The Nantucket Board of Health will hold a regular meeting with updates from the Director and Environmental Contamination Administrator. The board will consider a revision to a septic system design plan at 13 Woodland Drive. Additionally, they will hear a continued appeal of an Order to connect to town sewer for 49 Polpis Road, allowing the property owner time to investigate costs and alternative payment options.

board-of-healthseptic-systemsewer-connectionpublic-healthnantucketappeal
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, July 16, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person Jerico Mele WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/cOQGm-nPDCs Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_ed__7okwTfSH94dscRU71A AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Board Members: Kerry McKenna, Robert DeCosta, Kate Garrette, Ernie Strang 1. Public announcement – This meeting is being audio and visual recorded 2. Election of Officers 3. Public comment 4. Approval of minutes (June 18, 2026) 5. Director’s Updates 6. Environmental Contamination Administrator update 7. 13 Woodland Drive – Revision to site plan for septic system design plan reviewed at February 19, 2026 meeting. 8. 49 Polpis Road - Appeal of Order to connect to town sewer.(Cont. fr [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 15, 2026 · 15:00

Tree Advisory Committee

Tree Advisory Committee to discuss Liberty Tree project and pest updates

The Tree Advisory Committee will meet to review old business and receive updates on local tree health and commemorative projects. The meeting includes a public comment period and a review of departmental requests.

environmenttreespest-controlpublic-projects
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time Wednesday July 15, 2026 AT 3PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance II. COMMITTEE ACCEPTANCE OF AGENDA III. COMMITTEE APPROVAL OF MINUTES IV. ANNOUNCEMENTS V. PUBLIC COMMENT /DISCUSSION VI. CITIZEN/DEPARTMENTAL REQUESTS VII. OLD BUSINESS - 250th Anniversary Liberty Tree Project (Mary Longacre)- Follow-up - W. Creek Elms- Update - Southern Pine Beetle Update - Emerald Ash Borer Update 2 XI. ADJOURNMENT
Tue Jul 14, 2026 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to hold public hearing on ramp parking and APU rules

The Nantucket Memorial Airport Commission will hold a public hearing to amend rules regarding ramp parking and APU use. The body will also consider several multi-year contracts for engineering, planning, and security services, and discuss FY2028 capital project requests.

airportpublic-hearingcontractsbudgetaviation-rules
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, July 14, 2026 at 5:00 PM Location / Address HYBRID 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_da6F0Bv5TIuQtmJ4nh-8rQ Signature of Chair or Authorized Person Preston Harimon, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_da6F0Bv5TIuQtmJ4nh -8rQ To view the meeting only, see link below: https://youtube.com/live/jjit3yjqolQ 1. Announcements: a. Vice Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 06/09/26 Draft Minutes c. Ratify 06/03/26, 06/10/26 and 06/24/26 Warrants 3. Public Comment 4. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 5. 071426-01 Election of Officers/Assign Sub [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 14, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review four sign applications

The Sign Advisory Council is meeting to discuss several sign requests, including hanging and projecting signs. The body will review applications for properties on Main Street and Broad Street.

signsland-usemain-street
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JUL 08 PM 02:21 Original Posting Number: T 485 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, July 14, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINE [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 14, 2026 · 16:00

Historic District Commission

HDC to review sign permits and old business for 8 properties

The Historic District Commission will hold a hybrid meeting to review old business items for eight properties, including fenestration changes, a new dwelling, and additions. They will also consider sign applications for four properties at locations such as 45 Main St and 15 Broad St. The meeting includes commissioner comments, a Q&A with the preservation planner, and approval of previous minutes.

historic-district-commissionsignsold-businessfenestrationnew-dwellingadditionspreservation
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JUL 10 AM 10:04 Original Posting Number: T 490 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, July 14, 2026, at 4:00pm – no later than 8:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist https://us06web.zoom.us/webinar/register/WN_j3mZmt37Ryq4Kz1LcxM_eQ To watch live feed, click here: https://www.youtube.com/live/MEmLXqb3Pkw Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpub [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 14, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank to discuss Lily Pond Park contracts, Sankaty Road park, and bike path funding

The Commission will discuss park management at 7 & 9 W. Sankaty Road and the Field of Dreams, consider contract amendments and a construction services contract for Horsley Witten Group at 8 Wesco Place/Lily Pond Park, and discuss funding for the Tom Nevers Bike Path. Consent items include warrant authorizations for FY26 cash disbursements and property use requests for special events. The Commission will then enter executive session to discuss litigation and real property matters.

land-bankparkscontractsbike-pathlitigationproperty-management
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, July 14, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/88281510463?pwd=H2FqSiq9rsBmsKb14p5kV6Vt4cuZ62.1  Webinar ID: 882 8151 0463  Passcode: 260385  Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. PROPERTY MANAGEMENT a. 7 & 9 W. Sankaty Road and 31B & 31C New Street/Field of Dreams – Park Discussion b. 8 Wesco Place/Lily Pond Park – Contract Amendment for Horsley Witten Group c. 8 Wesco Place/Lily Pond Park – Construction Services Contract for Horsley Witten Group d. Tom Nev [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 13, 2026 · 16:00

Planning Board

Planning Board to discuss 2027 ATM and re-advertise public hearing

The Planning Board will meet to discuss the 2027 Annual Town Meeting (ATM) and re-advertise a public hearing for a project at 30 North Beach Street. The meeting will also include the election of officers and the appointment of a member to the Coastal Resiliency Advisory Committee.

planning-boardatmpublic-hearingcoastal-resiliencyelectionshousingzoning
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, Liza Hatton and Brian Borgeson Alternates: Abby De Molina, Howard Matz, and Dylan Metsch-Ampel Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 07-13-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: Zoom Registration – July 13, 2026 To view the meeting only, see link below: YouTube Live Meeting Link – July 13, 2026 Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, July 13, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Zoom Registration – July 13, 2026 Meeting Packet Link 2026 Meeting Packet Link Sig [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jul 13, 2026 · 16:00

Finance Committee

Finance Committee to review 33B and reserve fund transfers

The Finance Committee will meet to review and approve 33B Transfers and Reserve Fund Transfers, elect a chair and vice chair, and make committee appointments. The agenda also includes public comment and other business. The meeting is largely procedural.

financecommitteestransfersnantucket
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time MONDAY, JULY 13, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/83567044967?pwd=EkJquP5WtdHXVguNE1Jarr5FFSlaaj.1 Meeting ID: 835 6704 4967 Passcode: 155804 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review and approval of 33B Transfers and Reserve Fund Transfers 6. Elect Chair & Vice Chair 7. Committee Appointments 8. Other Business 9. Adjournment
Mon Jul 13, 2026 · 09:30

Select Board

Select Board meeting set for July 13, 2026

The Select Board is scheduled to meet on July 13, 2026, at the Nantucket Atheneum Great Hall. The agenda includes a call to order and a participation item regarding the Nantucket Civic League Annual Summer Forum.

select-boardmeetingpublic-forumnantucket
1 India Street
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, JULY 13, 2026, 9:30 AM Location / Address NANTUCKET ATHENEUM GREAT HALL, 1 INDIA STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CALL TO ORDER II. PARTICIPATE IN NANTUCKET CIVIC LEAGUE ANNUAL SUMMER FORUM III. ADJOURNMENT
Mon Jul 13, 2026 · 09:00

Select Board

Select Board to vote on FY2026 year-end budget transfers

The Select Board will consider a single substantive item: a request from the Finance Department to approve year-end budget transfers for fiscal year 2026. The remainder of the agenda is procedural, including a call to order and adjournment.

budgetfinanceselect-board
16 Broad Street; Town Building Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, JULY 13, 2026, 9:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM, 16 BROAD ST Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CALL TO ORDER II. CITIZEN/DEPARTMENTAL/COMMITTEE REQUESTS/REPORTS 1. Finance Department: Request for Approval of FY 2026 Year End Budget Transfers. III. ADJOURNMENT
Fri Jul 10, 2026 · 09:00

Airport Commission, Nantucket Memorial

Aviation Fuel Subcommittee to discuss supply, waivers, and RFP specs

The Nantucket Memorial Airport Commission's Aviation Fuel Subcommittee is meeting to discuss updates on fuel supply and sales, progress on converting non-fuel purchasers, and development of a customer database. They will also consider a fuel farm engineering task order, a MEPA hardship waiver, public-private requirements, procurement exemptions, and fuel supply RFP specifications. No votes or decisions are recorded in the agenda; all items are listed for discussion.

airportaviation-fuelmepaprocurementpublic-privaterfp
14 Airport Road, Unit 1, Administration Building 2nd Floor Conference Room, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission – Aviation Fuel Subcommittee Day, Date, and Time Friday, July 10, 2026, at 9:00 AM Location / Address HYBRID 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 and Remote Participation Via Zoom https://us06web.zoom.us/j/87447881867 Signature of Chair or Authorized Person Preston Harimon, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Zoom Link to Virtually Attend Meeting: https://us06web.zoom.us/j/87447881867 Meeting ID: 874 4788 1867 The meeting will be posted at a later date on YouTube. 1. Call to Order 2. Review and Approve: a. Agenda b. 06/04/26 Draft Minutes 3. 071026-01 – Discussions Regarding Aviation Fuel: a. Fuel Supply and Sales Update b. Converting Non-Fuel Purchasers Update c. Customer Database Development d. Fuel Farm Engineering Task Order e. MEPA Hardship Waiver f. MEPA Public-Private Requirements g. Applicability of Chapter 30B(29) Procurement Exemptions h. Fuel Supply RFP Specifications Update 4. Public Comment 5. Adjourn
Thu Jul 9, 2026 · 08:00

Nantucket Water Commissioners

Nantucket Water Commissioners to review water quality and pending contracts

The Nantucket Water Commissioners will meet to review production, billing, and rainfall reports. The board will discuss water quality, drought conditions, and storm/waste water projects. They will also consider the amendment and execution of personnel or vendor contracts pending from the finance department.

water-utilityinfrastructurecontractsenvironmental-monitoring
1 Milestone Road, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, July 9, 2026, at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Nantucket Water Commission Regular Meeting – in person at the Water Company conference room 1 Milestone Road, Nantucket, MA 02554 Thursday, July 9, 2026, at 8:00 AM 1. Call Meeting to Order 2. Acceptance of Agenda 3. Public Comment 4. Review of Minutes of May 14, 2026 meeting. 5. Production, Billing and Rainfall Reports 6. Director’s review and updates: a. Water Quality b. Drought Conditions c. Storm Water/Waste Water Projects d. Staff 7. Discussion, amendment and execution of any personnel or vendor contracts - pending from finance department. 8. Commissioner’s Comments and Reserved for Unforeseen Items for Discussion not anticipated. 9. Adjournment Next Regular Commission meeting Thursday, August 13, 2026, at 8 AM
Thu Jul 9, 2026 · 13:00

Zoning Board of Appeals

Board to decide if Surfside Crossing can use alternative curbing without public hearing

The Zoning Board of Appeals will consider a request from Surfside Crossing, LLC to determine whether switching from vertical granite to concrete curbing at 3-9 South Shore Road is an insubstantial change to a comprehensive permit, which could avoid a public hearing. The board will also hear two other cases: a lot-line adjustment at 11-12 Jonathan Way to install a septic system, and a variance request for a swimming pool at 13 Fawn Lane.

zoningvariancespecial-permitcomprehensive-permitland-usepublic-hearing
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, July 09, 2026, at 1:00 PM Location / Address 4 Fairgrounds Road, Nantucket, MA 02554 PSF COMMUNITY ROOM & REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Nicky Sheriff, Land Use Specialist WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA (Subject to Change) The meeting will be recorded and archived at www.nantucket-ma.gov. ZOOM WEBINAR REGISTRATION LINK: https://us06web.zoom.us/webinar/register/WN_qgq5qzMkQGmcrCeCgxh3Hg To view the LIVE broadcast of the meeting, see YouTube Link at https://youtube.com/live/mDeJjTMIzWc BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CALL TO ORDER: II. APPROVAL OF THE AGENDA: III. PUBLIC COMMENT for items not listed on the agenda: IV. APPROVAL OF MINUTES: • APRIL 09, 2026 • JUNE 11, 2026 2 V. REQUEST FOR DETERMINATION OF INSUBSTANTIAL CHANGE (VOTES MAY BE TAKEN) 25-24 Surfside Crossing, LLC 3, 5, 7, and 9 [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 8, 2026 · 17:30

Select Board

Select Board to consider $69.8M in bonds and notes for projects

The Select Board will consider approving the sale of $19,620,000 in general obligation bonds and $50,229,504 in bond anticipation notes for projects including general fund, sewer, water, affordable housing, airport, and solid waste. The board will also accept applications for committee vacancies, recognize retiring employees and swear in new police officers, and receive an update on the investigation of African Meeting House vandalism. Several contracts and leases for town employee housing are pending approval.

select-boardbudgetbondshousingpublic-safetypolicecommitteesdrought
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - AMENDED MEETING POSTING Original posting date: 7/2/2026 Original Posting # T 477 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JULY 8, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/1nLU6Gb7T6Y ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_FApgMyh1Rgu3FFYka4huyA I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Recognition of Retiring Town of Nantucket Employees: Fernella Phillips (26 Years of Service) and Debra Bechtold (28 Years of Service) from Our Island Home; and, Lt. Daniel Mack (32 Years of Service) and Lt. Brendan Coakley (24 Years of Service) from Nantucket Police Department; Swearing-in of Newly Pro [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jul 8, 2026 · 15:00

Cemetery Commission

Cemetery Commission to discuss historic Juneteenth unveiling, lot sales, and reorganization

The Nantucket Cemetery Commission will meet to discuss and potentially act on several items, including a historic ceremony at the Coloured Cemetery unveiling markers for Absalom Boston and Hannah Cook Boston on Juneteenth, the reorganization of the commission through election of officers, and approval of lot sales at Polpis Cemetery. Updates will also be provided on the Monument Restoration Project at New North Cemetery and the legal status of Newtown Cemetery.

cemeteryhistoricjuneteenthreorganizationlot-salesmonument-restorationnewtown-cemeterypolpis-cemetery
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cemetery Commission Day, Date, and Time Wednesday, July 8, 2026, at 3:00 p.m. Location / Address DPW Conference Area, 188 Madaket Road Signature of Chair or Authorized Person Allen B. Reinhard, Chairman AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85669907430?pwd=UCtIdFlPSE9VTitrU05CVTJyOWkydz09 Meeting ID: 856 6990 7430 Passcode: 021411 Nantucket Cemetery Commission Meeting Notice and Agenda Wednesday, July 8, 2026 Meeting to be held at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. 1. Public and Commissioners Comments. 2. Approval of Minutes from June 10, 2026. 3. Historic Coloured Cemetery ceremony for unveiling of Absalom Boston and Hannah Cook Boston on Juneteenth. Many Thanks to Fran Karttunen and Scott McIver for making this event happen. 4. Commission reorganization: Election of Officers 5. Approval of lot sales at Polpis, Lot J 31 to Jannett Rose Hudson, G2 to Sofia Leiburg. 2 6. Monument Restoration Project update: New North Cemetery 7. Newtown Cemetery legal status update. 8. Polpis Cemetery updates: Layout of new lots, and new map. 9. Old, New or Ot [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 7, 2026 · 12:30

Affordable Housing Trust

Affordable Housing Trust to consider real estate purchases and trust amendments

The Affordable Housing Trust will review a trust fund amendment and property documents for 1 Webster Road and 158 Madaket Road. The board will also consider the purchase or lease of three specific properties during executive session.

affordable-housingreal-estatetrust-fundcontracts
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, July 7, 2026, at 12:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, JULY 7, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. PUBLIC COMMENT* V. NEW BUSINESS** VI. APPROVAL OF MINUTES 1. Approval of Minutes of June 16, 2026, at 12:30 PM VII. HOUSING DEPARTMENT REQUESTS - 2 - 1. Request for Approval of Third Amendment to [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 7, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review projecting sign at 34 Center St

The Sign Advisory Council will meet to conduct procedural business and review a sign application. The council is scheduled to discuss a projecting sign request for a property at 34 Center St.

signsland-usecenter-st
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, July 07, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young, Paul Wolf, Mark Cutone, Kevin Kuester 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of Agenda 5. Approval [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jul 7, 2026 · 16:00

Historic District Commission

Commission to consider new dwelling and shed applications on 25 Nobadeer Ave

The Historic District Commission will review and vote on a range of consent applications for demolition, new construction, and alterations to historic properties. Items include garage and shed demolitions, new garages, fences, solar installations, and new dwelling proposals at several addresses. The commission will also address pending and incomplete applications, approve meeting minutes, and discuss future topics related to historic preservation.

historic-preservationconstructionpermitssolarfencesnew-dwellings
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JUL 01 PM 02:08 Original Posting Number: T 473 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday July 07, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_9hKVHPWpQ5G-HvOm4XH0PQ To watch live feed, click here: https://www.youtube.com/live/PvM6e314m8w Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, click [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 2, 2026 · 18:16

Tree Advisory Committee

Tree Advisory Committee will consider dedicating the Liberty Tree

The Nantucket Tree Advisory Committee will meet on July 2, 2026 at the Nantucket Public School pool parking lot. After taking attendance, the committee will discuss the dedication of the Liberty Tree.

treescommunityceremony
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time THURSDAY, JULY 2, 2026, AT 6:16PM Location / Address NANTUCKET PUBLIC SCHOOL POOL PARKING LOT Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR AGENDA I. CALL TO ORDER 1. Committee Attendance II. DEDICATION OF THE LIBERTY TREE
Thu Jul 2, 2026 · 17:00

Conservation Commission

Public hearing on development projects like Polpis Harbor dredging and Sparks Avenue

The Nantucket Conservation Commission will hold a public hearing on several Notice of Intent applications, some requiring waivers. attendees will consider orders of conditions for projects such as 240 Polpis Road and various waterfront and roadway plans. The meeting will also review certificates of compliance and provide updates on enforcement actions.

zoningdevelopmentdredgingroadscomplianceenforcement
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 JUN 22 PM 01:54 Original Posting Number: T 462 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, July 2, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://youtube.com/live/ASfJm_7eUYo Zoom Registration: https://us06web.zoom.us/webinar/register/WN_ioPMxkAkTvGQX9BuTr1Z9w Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for July 2, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the PSF Community Room, Fairgrounds Road Remote participation via Zoom Webinar (Register [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jul 2, 2026 · 09:00

Select Board/County Commissioners

Select Board to enter executive session for litigation, real estate, labor talks

The Select Board/County Commissioners will convene in open session and immediately move into executive session to discuss pending litigation, real property transactions, and collective bargaining. No public action items are scheduled; all substantive matters are reserved for closed session.

litigationreal-estatelaborexecutive-sessionoffshore-windpublic-employeesselect-board
16 Broad Street; Town Building , NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, JULY 2, 2026 AT 9:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of June 4, 2026 at 9:00 AM. 2. Purpose 3: To Discuss Strategy with Respect to Pending Litigation Where an Open Meeting may Have a Detrimental Effect on the Litigating Position of the Select Board and the Chair so declares, as follows: a. Russo as Trustee of 43A Union Street Trust v. Select Board and Historic District Commission, Nantucket Superior Court C.A. No. 2675CV00049. b. Schwartz Family Trust (21 Nonantum) v. Select Board and Historic District Commission, Nantucket [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 30, 2026 · 16:00

Historic District Commission

HDC reviews 22 old-business items including new homes, pool, fence

The Historic District Commission will vote on 22 old-business applications for work such as new dwellings, additions, pools, and fences. The agenda also includes five consent items (window/door change, roof change, shed re-site, fence alterations, deck expansion) and one consent-with-conditions item for a pool at 8 Hedge Row. Future discussion topics include brick distinctions, street tree mapping, and move/demo hearing policies.

historic-district-commissionold-businessconsent-itemspublic-hearingsnantucket
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, June 30, 2026, at 4:00pm – no later than 8:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn. Land Use Specialist https://us06web.zoom.us/webinar/register/WN_-V9li37eSKOC18eHpZHaSQ#/registration To watch live feed, click here: https://www.youtube.com/live/P3GAdWxF1sw Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket -ma.gov. **Comments are due by 8:00am the Monday prior to the meet [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes June 30, 2026; adopted July 21, 2026 HISTORIC DISTRICT COMISSION Minutes June 30, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Holly Backus and Fiona Johnson Meeting called at 4:03pm by Ray Pohl Carrie Thornewill made the motion to approve the agenda Motion carries In person: Pohl, Oliver, MacLeod and Patten Zoom: Paul and Thornewill Camp arrived at 5:28 PM I. COMMISSIONERS COMMNETS AND DISCUSSION OF HDC ORGANIZATIONAL MEETING • The board discussed resuming periodic organizational meetings after the July 4 holiday to address broader policy and procedural issues outside of regular application reviews. Members supported holding the meetings every four to six weeks, with commissioners asked to submit agenda topics and priorities to staff for organization. The board also discussed preferred meeting days and times, whether to meet during a regular Tuesday session or as a separate Thursday meeting, and potential meeting locations, with staff directed to coordinate logistics and confirm availability. It was noted that the meetings would be recorded (but not livestreamed), and staff will report back once scheduling preferences and available meeting space are confirmed. II. CONSENTS Property owner name Street Addres [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 30, 2026 · 14:00

Zoning Board of Appeals

Zoning Board to discuss litigation strategy in executive session

The Zoning Board of Appeals will convene in open session and then move into an executive session to discuss litigation strategy regarding Surfside Crossing, LLC v. Nantucket Zoning Board of Appeals.

zoninglitigationexecutive-sessionboard-meetingremote-participation
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Tuesday, June 30, 2026, at 2:00 PM Location / Address Remote Participation via Zoom https://us06web.zoom.us/j/85735444596?pwd=y6buREwUVKkYbKJV7baEJOAPcdH1MR.1 Signature of Chair or Authorized Person William Saad, Zoning Administrator WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE -BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION , NOT TO RETURN TO OPEN SESSION, Pursuant to MGL C. 30A §21(A): (Votes may be taken). Purpose 3: To Discuss Strategy with Respect to Litigation Regarding Surfside Crossing, LLC v. Nantucket Zoning Board of Appeals, H.A.C. No. 2019-07, where an Open Meeting May have a Detrimental Effect on the Litigating Position of the Zoning Board of Appeals and the Chair so Declares. III. ADJOURNMENT (VOTE WILL BE TAKEN)
Mon Jun 29, 2026 · 17:00

Nantucket Planning & Economic Development Commission

NP&EDC to appoint member and approve planning contracts

The Nantucket Planning & Economic Development Commission will appoint an at-large member and discuss transportation models and public outreach. The body will also authorize employment agreements and contract amendments for the Director and Deputy Director of Planning.

planningtransportationbudgetcontractsemploymentpublic-works
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Monday, June 29, 2026 at 5:00 pm Location / Address Hybrid – Meeting Trailer at 131 Pleasant Street, Room A and Remote Participation via Zoom https://us06web.zoom.us/webinar/register/WN_XAi9d9DERpWHPZA7y796hg#/registration Signature of Chair or Authorized Person Leslie Snell, AICP, Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGEN DA To participate in the meeting, use the registration link below: https://us06web.zoom.us/webinar/register/WN_XAi9d9DERpWHPZA7y796hg#/registration To view the meeting only: https://www.youtube.com/watch?v=hfA1D-4OwGg This meeting is being audio/video recorded and will be uploaded to the Town of Nantucket YouTube page at a later date. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Public Comment for items not included on the agenda: V. Minutes A. June 23, 2025 B. November 17, 2025 C. May 28, 2026 [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 29, 2026 · 17:00

Scholarship Committee

Scholarship Committee to decide on 2026 recipients and funding

The Nantucket Scholarship Committee will determine the total amount of funds available for 2026 scholarships and then, after a closed executive session to review student transcripts, vote on individual Town Scholarship and Thomas F. Curley Scholarship recipients. The committee will also nominate and elect officers for the 2026-27 term and approve minutes from the prior meeting.

scholarshipseducationtownexecutive-sessionstudent-privacy
9B Bayberry Court
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TOWN OF NANTUCKET SCHOLARSHIP COMMITTEE Day, Date, and Time MONDAY, June 29, 2026 AT 5:00 PM Location / Address Community Foundation Nantucket, 9B Bayberry Court Signature of Chair or Authorized Person REBECCA WOODLEY-OLIVER, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting 1. Call to Order in Open Session. 2. Open Session a. Approve minutes of June 26, 2025 meeting b. Nominate and vote of officers for 2026-27 c. Determine the amount of funds to offer in Scholarships for 2026 3. Executive Session pursuant to MGL C. 30A 21 (A) a. Purpose 7: To review student transcript information or other highly personal information to comply with the provision of G.L. c 214, s. 1B, the Right of Privacy Law 4. Call to return to Open Session a. Discuss and decide on scholarship recipients for Town Scholarships b. Discuss and decide on recipient of Thomas F. Curley Scholarship c. Review how letters and funding will go out d. Other Business 5. Adjournment
Sat Jun 27, 2026 · 10:00

Advisory Committee of Non-voting Taxpayers

Discuss potential impacts of increasing year‑round resident property tax exemption

The Advisory Committee of Non‑Voting Taxpayers will review a presentation on the potential impacts of a year‑round resident property tax exemption increase, referencing recent news articles. The meeting will also cover approval of the agenda and draft minutes, welcome new members, and feature a Public Relations Committee presentation of a new PR plan. Public comment and any unanticipated business may be addressed before adjournment.

taxesproperty-taxpublic-relationsbudgetpublic-comment
✓ Decided: Committee confirmed summer guest speaker schedule, including Libby Gibson on July 18

The committee approved the meeting agenda and the minutes from the May 2, 2026 meeting, both unanimously. Members confirmed the initial summer guest‑speaker schedule, with Libby Gibson slated for a July 18 in‑person/hybrid session and additional dates set for August. The meeting was adjourned unanimously at 11:55 am.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Advisory Committee of Non-Voting Taxpayers Day, Date, and Time Saturday June 27, 2025 at 10 a.m. Location / Address REMOTELY VIA ZOOM; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/@nantucketgov/videos Signature of Chair or Authorized Person Kathy Baird, Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81681188728 Meeting ID: 816 8118 8728 Call to Order This meeting is being audio and video recorded - read statement for Remote Zoom Meeting Membership count for quorum Approval of Agenda for today’s meeting, if quorum present Approval of draft minutes for meeting of May 2, 2026 if quorum present Welcome to New Committee Members Public Relations (PR) Committee Presentation of New PR Plan and Associated Issues 2 Potential Impacts of Year-Round Resident Property Tax Exemption Increase (NYT Article) (Nantucket Current Articl [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADVISORY COMMITTEE OF NON-VOTING TAXPAYERS Minutes of Public meeting 10:00 am, Saturday, June 27, 2026 1. Attending members: Kathy Baird, Lou Bassano, Gene Briskman, Patti Deuster, Lynn Filipski, Peter Halle, Donna Martino, Steve Perelman. Newly appointed 2027 members: Jon Delano, Eric Krauetler, Bob Vidoni. Members absent: Michael Cody, Bill Gardner, Don Green, Peter Kahn, Pamela Suan, Scott Ulm, Renee Johannensen (Alternate) 2. Chair Peter Halle convened the meeting at 10:04 am and read the Virtual Meeting Script, confirming a quorum was present. 3. The Agenda for today’s meeting was moved for approval, seconded and passed unanimously. 4. Approval of the minutes from the May 2, 2026 meeting was moved, seconded and passed unanimously. 5. Peter H. welcomed new committee members and provided an overview of the purpose and responsibilities of the ACNVT. 6. Steve P. provided an overview of the ACNVT Public Relations (PR) Committee work on the PR Plan and members discussed associated issues and provided feedback to move it forward with next steps. Ideas included creating a list of volunteer members with professional skill sets that may be of use to the town, an ACNVT newsletter or regular column in local press, outreach to the Nantucket Civic League’s neighborhood associations. A productive meeting with Town Manager Libby Gibson yielded an offer of town staff assistance on ACNVT webpage enhancements and public outreach. In addition, Peter H. will contact the [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 25, 2026 · 12:00

Council for Human Services

Council to review Human Services Needs Assessment and Postvention Plan

The Council for Human Services will hear presentations on the Nantucket Human Services Needs Assessment and the Community Postvention Plan for behavioral health. They will also receive a Director's report and review the grant schedule for fiscal year 2028.

human-servicesneeds-assessmentbehavioral-healthgrantsfy28nantucket
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL FOR HUMAN SERVICES Day, Date, and Time THURSDAY, JUNE 25TH, 2026, AT 12:00 PM Location / Address  131 PLEASANT ST: ROOM A  REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! JOIN ZOOM MEETING: https://us06web.zoom.us/j/82796789140?pwd=DxKSyqDecFaarU74BZnIlZP0jdbL9b.1 Meeting ID: 827 9678 9140 Passcode: 868111 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Approval of Minutes from 4/23/26 IV. Public Comment V. Presentation of Nantucket Human Services Needs Assessment by Kulik Strategic Advisors VI. Presentation of Nantucket Community Postvention Plan, Rosemary McLaughlin of Community Solutions for Behavioral Health VII. Human Services Director Report VIII. Community Human Services items for by CHS members IX. Review Grant Schedule for FY 28 X. New Business* XI. Next meeting date XII. Adjournment *FOR MATTERS NOT RE [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 25, 2026 · 12:00

Contract Review Committee, Human Services

Contract Review Committee hears Human Services Needs Assessment

The Nantucket Contract Review Committee meets to receive a presentation on the Human Services Needs Assessment from Kulik Strategic Advisors. The agenda also includes approval of previous meeting minutes and public comment. No votes or decisions are listed.

human-servicescontract-reviewneeds-assessmentnantucketpublic-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CONTRACT REVIEW COMMITTEE Day, Date, and Time THURSDAY, JUNE 25TH, 2026, AT 12:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM 131 PLEASNT STREET: ROOM A The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK AT-LARGE/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/82796789140?pwd=DxKSyqDecFaarU74BZnIlZP0jdbL9b.1 Meeting ID: 827 9678 9140 Passcode: 868111 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Approval of Minutes from 4/24/26 IV. Public Comment V. Presentation of Nantucket Human Services Needs Assessment by Kulik Strategic Advisors VI. Next meeting date VII. Adjournment *FOR MATTERS NOT REASONABLY ANTICIPATED 48 HOURS PRIOR TO THE MEETING
Wed Jun 24, 2026 · 17:30

Select Board

Select Board to consider $104M contract amendment for new Our Island Home facility

The Select Board will consider a contract amendment adding $103,658,240 to the construction manager contract for the new Our Island Home facility, bringing the total to $104,147,601. The board will also discuss a quitclaim deed for 50 Altar Rock Road to the Nantucket Conservation Foundation, the residential exemption, and an update on the African Meeting House vandalism investigation. Pending contracts include software license renewals and grant agreements, and the board will review a request to extend the borrowing term for a replacement fire engine. The Community Claims Fund, launched as part of the GEV blade failure settlement, has a June 26 deadline for filing claims.

select-boardhousingreal-estatepublic-safetybudgetcontractscommunity-claims
✓ Decided: Board approves $850,000 fire engine borrowing and Altar Rock land transfer

The Nantucket Select Board approved routine financial items and several pending contracts during its June 24 meeting. The board authorized $850,000 in borrowing with a 20-year term to fund a replacement fire engine for the community. It also finalized a quitclaim deed transferring 50 Altar Rock Road to the Nantucket Conservation Foundation while preserving existing public access stipulations. Discussions on residential tax exemptions and an ongoing vandalism investigation were noted, but no actions were taken.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JUNE 24, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/NvO-J1rKFNE ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_y0wBi0FTTOeVogkvCjj6MQ I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Community Claims Fund Launched on Monday, January 26, 2026 to Accept Claims. This Fund was Created as Part of the Blade Failure Settlement with GEV. Verus, LLC, the Administrator of the Fund, has Created a Dedicated Website with More Information and Instructions for How to File a Claim: www.NantucketBladeSettlement.com. Claims Must be Filed No Later than June [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of June 24, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of June 24, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Robert DeCosta, Matt Fee, and Jill Vieth. Brooke Mohr joined the meeting later as noted. I. CALL TO ORDER Chair Hill called the meeting to order at 5:32 PM following a meeting of the County Commissioners. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Community Claims Fund Launched on Monday, January 26, 2026 to Accept Claims. This Fund was Created as Part of the Blade Failure Settlement with GEV. Verus, LLC, the Administrator of the Fund, has Created a Dedicated Website with More Information and Instructions for How to File a Claim: www.NantucketBladeSettlement.com. Claims Must be Filed No Later than June 26, 2026. For Questions, Please Contact the Verus Support Team at [email protected] or 508-305-7225. 3. 2026 Committee Vacancies – Round 2: Cannabis Advisory Committee, Coastal Resiliency Advisory Committee, Council for Human Services, Council on Aging, Cultural Council, Finance Committee, Nantucket Affordab [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 24, 2026 · 17:30

County Commission

County Commission to approve June payroll warrants and May minutes

The Nantucket County Commission will hold a routine meeting with no major policy items. The board will vote to approve the minutes from its May 27 meeting and authorize payroll and treasury warrants for June 2026. A public comment period is included, but no new business or substantive decisions are on the agenda.

county-commissionminutes-approvalpayroll-warrantspublic-commentprocedural
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNTY COMMISSIONERS Day, Date, and Time WEDNESDAY, JUNE 24, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/NvO-J1rKFNE ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_y0wBi0FTTOeVogkvCjj6MQ I. CALL TO ORDER II. ANNOUNCEMENTS 1. The County Commission Meeting is Being Audio and Video Recorded. III. PUBLIC COMMENT* IV. NEW BUSINESS** V. APPROVAL OF MINUTES, WARRANTS AND PENDING CONTRACTS 1. Approval of Minutes of May 27, 2026, at 5:30 PM. 2. Approval of Payroll and Treasury Warrants for June 2026. VI. COMMISSIONERS REPORTS/COMMENTS VII. ADJOURNMENT *Public Comment: please see attached Public Comment Policy which can also be found at https://www.nantucket- ma.gov/Documen [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 24, 2026 · 13:30

Nantucket Housing Authority

Nantucket Housing Authority to sign contracts and approve minutes

The Nantucket Housing Authority will meet to approve the minutes from May 27, 2026, and sign the payroll warrant for June 2026. The agenda includes the approval of contracts with Rise Engineering and Fenton Ewald & Associates, as well as a Memorandum of Understanding with the Nantucket Island Fair.

housingcontractsminutespayrollpublic-housing
3 Manta Drive, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Housing Authority Day, Date, and Time Wednesday, June 24, 2026 1:30 PM Location / Address 3 Manta Drive, Nantucket and or via hybrid remote participation Signature of Chair or Authorized Person Nancy Friend, Executive Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join: https://teams.microsoft.com/meet/276931399347558?p=qF3jr8kflvlu0fN8F0 Meeting ID: 276 931 399 347 558 Passcode: Qo7RL3R7 AGENDA Open Session 1. Call to order/roll call 2. Approval of Agenda 3. Bill roll/Payroll Signing of Warrant June 2026 4. Minutes of May 27, 2026 5. National Grid Residential Multifamily Program Contract between Rise Engineering and Nantucket Housing Authority 6. Memorandum of Understanding NHA & Nantucket Island Fair for use of Tom Nevers Property 9/12/26 & 9/13/26 7. Fenton Ewald & Associates Contract for Services January 1, 2026 – December 31, 2026 8. Executive Director’s Report Other Business: Report from Other Committees: CPC, AHT, Habitat for Humanity, NP & EDC Adjournment:
Tue Jun 23, 2026 · 09:00

Community Preservation Committee

Committee to consider $250k for pickleball/padel courts and other fund requests

The Community Preservation Committee will decide on several fund requisitions totaling over $340,000, including $250,000 for pickleball/padel courts, $67,271.39 for NISDA Heifer Barn work, and $23,695 for rental assistance. They will also discuss office move/staffing updates, preservation easement costs, project assignments for FY2025 and FY2026, grant deadline extensions, signage requirements, and set a date for the annual public forum.

community-preservationfundingpickleballrental-assistancehistoric-preservationgrantsinfrastructure
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time TUESDAY, JUNE 23 2026 9:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM ONLY Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Linda Williams, Chair Eleanor Antonietti Joeph Topham, Vice, Chaira John Schafer Neville Richen Jesse Dutra Dawn Hill Holdgate Constance Patten Tim Soverino Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Approval of Minutes 5/1/2026 & 5/19/2026 Public Comment Correspondence/Guest: None Guests: New Business: 1. Fund Requisitions: - NISDA - Heifer Barn roofing/engineering septic/foundation work – FY2024 - $42,514.03 & Heifer Barn structural support/waterproof foundation – FY2024 - $24,757.36 (Richen) - Nantucket Racket Sports A [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
7C Hanabea Lane, Nantucket, MA. 02554 508-325-6682 Community Preservation Committee Meeting Minutes for 06/23/2026 YouTube Link: https://www.youtube.com/watch?v=GuFtYNspGZY&list=PL49sKqpy7VAgNqvUrCmKyflEPFjn75blS Meeting Opening and Agenda Approval - The committee convened remotely with a quorum and welcomed a new select board representative, Dawn. The minutes from previous meetings (May 1 and May 19) were reviewed. - Minor edits to the minutes were noted and incorporated prior to approval. - The committee unanimously approved the minutes with amendments. Public Comment – Maria Mitchell Association - No public comments or correspondence were presented at this time. Funding Approvals and Financial Updates - Several grant applications were discussed and approved for fiscal years 2024 and 2026. These reflect ongoing support for various community projects and organizations. (Nantucket Island School of Design & Arts, NISDA Heifer Barn, Nantucket Racket Sports Association (NRSA), & Interfaith Council. Organization | Fiscal Year | Cash Appd. | Project/Notes -----------------|----------------|------------------|-------------------------------------------------| NISDA | FY2024 | $42,514.33 | Structural roof and foundation | Heifer Barn | FY2024 | $24,757.36 | Structural & roof support | NRSA | FY2026 | $250,000.00 | Nearly finalized funding | Interfaith Ccl.| FY2026 | $23,695.00 | Rental assistance | - Some applications were initially incorrect but later corrected for approval. - Motions [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 23, 2026 · 10:45

Coastal Resilience Advisory Committee

Committee to decide which floodplain overlay regulations to present at Harbor Forum

The Coastal Resilience Advisory Committee will discuss the Model Floodplain Overlay District Zoning Bylaw and choose specific regulations to forward for community feedback at the State of the Harbor Forum on July 14, 2026. It will also review a proposal from the Nantucket Land and Water Council regarding the Optional Higher Standards bylaw. The committee will consider scheduling options for July, August, and September meetings, including whether to move the July 14 meeting to the Harbor Forum. Additional reports from various town boards and commissions will be shared for information.

coastal-resiliencezoningfloodplainmeetingsharborplanning
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, June 23, 2026, at 10:45 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, June 23, 2026, at 10:45 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes 5. Discussion with Nantucket Land and Water Council about the State of the Harbor Forum, their list of provisions from the O [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 23, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank to discuss chicken coop, MOU with Sconset Trust for Sankaty Road

The Nantucket Islands Land Bank Commission will convene to review golf course operations, consider a chicken coop at 19 Wauwinet Road, and discuss a Memorandum of Understanding with the Sconset Trust for properties at 7 & 9 W. Sankaty Road/Field of Dreams. The commission will also enter executive session to discuss litigation in Corey v. Nantucket Islands Land Bank and potential real property transactions. Consent items include monthly financial reports and warrant authorizations.

land-bankproperty-managementagriculturegolflitigationnantucketexecutive-session
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, June 23, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/86717794694?pwd=CQQJdJvyPgcRIM8mpliPX5FkKwcXhz.1  Webinar ID: 867 1779 4694  Passcode: 090577    Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. GOLF BUSINESS a. Sconset Golf Course – Monthly Review b. Miacomet Golf Course – Monthly Review c. Warrant Authorization – Golf Capital Funds Transfer Request 4. AGRICULTURAL MANAGEMENT a. 19 Wauwinet Road – Chicken Coop Discussion 5. PROPERTY MANAGEMENT a. 7 & 9 W. Sankaty R [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 23, 2026 · 16:00

Historic District Commission

Historic District Commission to review new dwellings and property alterations

The Historic District Commission is reviewing numerous applications for residential construction, renovations, and landscaping. The body will decide on consents for various home improvements and hear new business regarding several new dwelling proposals.

zoninghistoric-preservationhousingconstruction
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JUN 18 PM 02:23 Original Posting Number: T 459 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday June 23, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_FMRiA_zjQx65cThIyZdMFQ#/registration To watch live feed, click here: https://www.youtube.com/live/iUP58CygDXc Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting Vi [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes June 23, 2026; adopted July 14, 2026 HISTORIC DISTRICT COMISSION Minutes June 23, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice- Chair) Stephen Welch, Abby Camp, Val Oliver Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Land Use Specialist, Holly Backus, Preservation Planner, and Fiona Johnson, Administrative Specialist In person: Pohl, Welch, Oliver, Patten and Camp Zoom: MacLeod, Paul and Thornewill Early departures: MacLeod at 6:24pm Meeting called to order at 4:00pm by Ray Pohl Board: Pohl, Welch, MacLeod, Oliver and Camp Welch made the motion to approve the agenda Motion carries unanimously Backus Left at 5:45pm • Board: Pohl, Welch, Camp, Oliver and Patten; Alternates: MacLeod, Thornewill, Paul • Ray Pohl proposed modifying the agenda by moving the pool application at 164 Hummock Pond Road to the Consent with conditions that the pool is not visible at the time of inspection and remain screened thereafter. • The Chair also proposed reordering the agenda so that 38 Main Street (Sconset) would be heard as the first item of new business • Welch made the motion to approve amended agenda • Motion carries unanimously I.COMMISSIONER COMMENTS • Oliver requested to add the discussion of a future organizational meeting. II. RATIFY VOTE – CONSENT WITH CONDITIONS 6/09/2026- ADDRESS CORRE [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 18, 2026 · 16:00

Board of Health

Board of Health to decide on septic variance for 27 Osprey Way

The Nantucket Board of Health will meet on June 18, 2026, at 4:00 PM. The agenda includes a public hearing on a septic variance for 27 Osprey Way, a discussion of abutter notification requirements for irrigation and geothermal wells, and updates on environmental contamination and the Vito Capizo Stadium renovation project. The board will also consider releasing Administrative Consent Order funds for 4 S. Cambridge Street.

healthseptic-systemswellsenvironmental-contaminationvariancespublic-hearingsconstruction-projects
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, June 18, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person Ann Smith WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/MkIA4R5839Y Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_29WfvUJsSWSeWEAtzpGYCw AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Robert DeCosta 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Approval of minutes (May 21, 2026) 4. Director’s Updates 5. Environmental Contamination Administrator update 6. 4 S. Cambridge St- Release of ACO (Administrative Consent Order) funds 7. 27 Osprey Way - Septic Variance for setbacks to coastal bank, property lines, and structures. 8. Upd [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 18, 2026 · 17:00

Conservation Commission

Conservation Commission to hold hearings on dredging and land bank projects

The Nantucket Conservation Commission will hold public hearings and meetings regarding several Notice of Intent applications. The body will also review a minor modification for the Maria Mitchell Association and a certificate of compliance for 27 North Liberty Street.

conservationdredgingland-usepublic-hearingsenvironment
✓ Decided: Conservation Commission continued several project reviews until July 2, 2026

The Commission continued discussions regarding the Greenhill Revocable Trust and the Town of Nantucket dredging plan. Members also discussed a proposed pool installation at 240 Polpis Road and invasive species management via pig grazing at Nantucket Islands Land Bank properties.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 JUN 05 PM 01:31 Original Posting Number: T 423 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, June 18, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://youtube.com/live/h6z1q8jKrxg Zoom Registration: https://us06web.zoom.us/webinar/register/WN_bgg1_gh4Q8-OI5byDtTPnw Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for June 18, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at link below) Information [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes June 18, 2026, adopted July 2, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, June 18, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/h6z1q8jKrxg Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Braine, Misurelli, Schafer, Turcotte, Plandowski and Williams Absent Members: - Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:40) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Williams) Vote: Vote Carried: 7:0: Engelbourg, Braine, Misurelli, Plandowski, Schafer, Turcotte, and Williams (aye) III. Announcements Discussion: (00:02:43) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:03:02) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:03:06) Burton Balkind, Nantucket Coastal Conservancy - Asks if the Baxter Road Geotube project is going to be a public discussion or just amongst Commission members. Engelbourg - I’m [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
accept the agenda
7 yea
Engelbourg yea · Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
Thu Jun 18, 2026 · 13:00

Cannabis Advisory Committee

Cannabis Advisory Committee to discuss social consumption and DEA rescheduling

The Cannabis Advisory Committee will meet to discuss the future of social consumption on Nantucket and the DEA's rescheduling of cannabis from Schedule I to Schedule III. The body will also review cannabis reform legislation signed by Governor Healey and ACK Natural deliveries.

cannabisdrug-policypublic-healthregulation
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Cannabis Advisory Committee (CAC) Day, Date, and Time Thursday June 18, 2026, 1:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Barry Rector WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Board Members: Barry G. Rector (Chair), Abby DeMolina (Vice-Chair), Joe Plandowski (Secretary), Dawn Hill, Jacques Zimicki Join Zoom Meeting https://us06web.zoom.us/j/84056571521?pwd=TzVQMVZXdkV6SGt6MmpmTFM5dm9rZz09 Meeting ID: 840 5657 1521 Find your local number: https://us06web.zoom.us/u/kZpvpnBWV One tap mobile +13092053325,,88677055726#,,,,*027151# US Dial by your location +1 309 205 3325 US +1 646 558 8656 US (New York) +1 301 715 8592 US (Washington DC) 2 AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. I. Call to Order II. Acceptance of Agenda III. Announcements a. The Cannabis Advisory Committee M [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 17, 2026 · 15:00

Tree Advisory Committee

Tree Advisory Committee to review tree removals and anniversary project

The Tree Advisory Committee will discuss updates on several tree-related projects and specific tree health issues. The body will also consider a new tree removal request for a town parking area.

treesenvironmentpublic-workslandscaping
188 Madaket Road, DPW Conference , Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time Wednesday June 17, 2026, 3:00PM Location / Address DPW CONFERENCE ROOM OR REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance II. COMMITTEE ACCEPTANCE OF AGENDA III. COMMITTEE APPROVAL OF MINUTES IV. ANNOUNCEMENTS V. PUBLIC COMMENT /DISCUSSION VI. CITIZEN/DEPARTMENTAL REQUESTS VII. OLD BUSINESS - 250 th Anniversary Liberty Tree Project (Mary Longacre)- Update - 7 Pleasant St. Sugar Maple (Dale) - 4 Easy St. English Oaks (Dale) - W. Creek Elms Update 2 - Coffin Park Norway Maples (Dale) - Emerald Ash Borer Update (Dale VIII. NEW BUSINESS - 14 Silver St.- Tree Removal Request @ Silve [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 16, 2026 · 16:00

Historic District Commission

Historic District Commission to review new dwellings and signage requests

The Historic District Commission is meeting to review a series of old business applications for new dwellings, additions, and hardscaping. The body will also consider several sign approvals and hold a Q&A session with the Preservation Planner.

zoninghistoric-preservationhousingsignsland-use
✓ Decided: HDC approves several residential projects and continues others for revisions

The Historic District Commission approved various residential additions, dwellings, and site changes. Several applications were held for further revisions regarding scale, massing, and documentation.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JUN 10 AM 10:20 Original Posting Number: T 433 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, June 16, 2026, at 4:00pm – no later than 8:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist https://us06web.zoom.us/webinar/register/WN_yfH2pltCS6KngMuq8Nqhqw#/registration To watch live feed, click here: https://www.youtube.com/live/9bzB9fAjaak Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be se [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes June 16, 2026; adopted 7-14-26 HISTORIC DISTRICT COMISSION Minutes June 16, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Ray Pohl (Chair), Angus MacLeod (Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johsnon Meeting called at 4:00pm by Ray Pohl Val made the motion to approve the agenda. Approved by Pohl, Oliver, MacLeod , Camp and Patten In person: Pohl, Oliver, Camp, MacLeod and Patten Zoom: Paul and Thornewill Absent: Welch Camp left at 7:50PM I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Michelle Honey 14813 71 Baxter Rd Roof change 49/26.1 Self Commissioners: Pohl, Oliver, Camp, MacLeod, Patten; Alternates: Thornewill, Paul Motion to approve a submitted made by Val. Carries unanimously II. SIGNS Property owner name Street Address Scope of work Map/Parcel Agent 1. Linda Loring Found 14416 110 Eel Point Rd OB- Quarter board sign 32/33 Kelly Emery • Sign Advisory Council recommends approval. 2. Linda Loring Found 14418 110 Eel Point Rd OB- entrance sign 32/33 Kelly Emery • Sign Advisory Council recommends approval with the fence sign to be placed on the top rail of the split rail fence and the Li nda Loring Foundation text be removed on the existing rock sign. 3. 19 Washington St LLC 14720 19 Washington St OB- projec [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
5 yea
Pohl yea · Oliver yea · MacLeod yea · Camp yea · Patten yea
approve with blue portion of sports court changing to green and the sports court not to be seen at time of inspection and in perpetuity
1 nay
Abby nay
Tue Jun 16, 2026 · 12:30

Affordable Housing Trust

Trust will consider purchase or lease of properties at 27 Old South Road and 158 Madaket Road

The Affordable Housing Trust will discuss several items, including approval of a mortgage discharge for 45A Beach Grass Road and a review of a housing application at 1 Webster Drive. The board will receive an update on the Housing Production Plan from Barrett Planning Group LLC and a project audit for Wiggles Way at 31 Fairgrounds Road. In executive session, members will consider the purchase, exchange, lease, or value of real property at 27 Old South Road and 158 Madaket Road.

affordable-housingmortgageproperty-purchasehousing-planauditexecutive-session
✓ Decided: Trust approves closing cost loan and mortgage discharge

The Trust approved a $15,000 closing cost assistance loan for 1 Webster Drive. Members also authorized a $9,519.08 mortgage discharge for 45A Beach Grass Road and reviewed a draft audit of the Wiggles Way project.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, June 16, 2026, at 12:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, JUNE 16, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89243722122?pwd=q3T4GrZVBtz4GUbOxWUJu68vfEqoNK.1 Meeting ID: 892 4372 2122 Passcode: 461305 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. UPDATE ON PUBLIC COMMENT QUESTIONS FROM PRIOR MEETINGS V. PUBLIC COMMENT* VI. NEW BUSINESS** VII. APPROVAL OF MINUTES 1. Approval of Minutes of June 2, 2026, at 12:30 PM VIII. CLOSING COST ASSIST [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on June 16, 2026, at 12:30PM Approved the 7th day of July 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, June 16, 2026 Remote Meeting via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice- Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Brian Sullivan, Penny Dey, Brooke Mohr, Forest Bell, Brooke Mohr, Shantaw Bloise-Murphy, and Abby De Molina. Staff members present: Kristie Ferrantella (Housing Director ), Dylan Metsch-Ampel (Deputy Housing Director) , Caroline Ferguson (Administrative Specialist) , Sue Carmel (Deputy Finance Director), Tracy MacDonald (Real Estate Manager), Rick Sears (Deputy Town Manager), Vicki Marsh (Town Counsel), John Giorgio (Town Counsel) Speaker(s) present: Tony Duong (Barrett Planning Group LLC), Kevin Wright (CBIZ), Diane Morrison (CBIZ), Hilaire Johnson (CBIZ) All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order at 12:34 PM. II. ACCEPTANCE OF AGENDA Brooke Mohr made a MOTION to approve the agenda . Penny Dey seconded the motion; by roll call vote: Brooke Mohr – Aye; Penny Dey – Aye; Shantaw Bloise-Murphy – Aye; Brian Sullivan– Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. UPDATE ON PUBLIC COMMENT QUESTIONS FROM PRIOR MEETINGS There was no update to public comment. V. PUBLIC COMMENT Th [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
4 yea
Brooke Mohr yea · Penny Dey yea · Shantaw Bloise-Murphy yea · Brian Sullivan yea
approve the open session minutes of June 2, 2026
4 yea
Shantaw Bloise-Murphy yea · Penny Dey yea · Brooke Mohr yea · Brian Sullivan yea
approve Alison and Richard Stravato’s application and award up to $15,000 as a loan for closing cost assistance at 1 Webster Drive and any unused funds to be returned to the Trust
5 yea
Penny Dey yea · Brooke Mohr yea · Forest Bell yea · Shantaw Bloise- Murphy yea · Brian Sullivan yea
authorize and for the Chair or Vice -Chair to execute the discharge for the full principal payment of $9,519. 08
5 yea
Penny Dey yea · Shantaw Bloise-Murphy yea · Forest Bell yea · Brooke Mohr yea · Brian Sullivan yea
Tue Jun 16, 2026 · 10:00

Community Preservation Committee

Community Preservation Committee meeting cancelled

The Community Preservation Committee meeting scheduled for June 16, 2026, has been cancelled.

community-preservation
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date _June 12, 2026_ Original Posting Number _T 428_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COMMUNITY PRESERVATION COMMITTEE Day, Date, and Time TUESDAY JUNE 16, 2026 AT 10:00 AM Location / Address 131 PLEASANT STREET- ROOM A (HYBRID) Remote Participation via Zoom Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR THIS MEETING HAS BEEN CANCELLED
Tue Jun 16, 2026 · 19:40

Nantucket Public School Committee

Nantucket School Committee meeting cancelled

The meeting scheduled for June 16, 2024, has been cancelled. The agenda had included a potential vote on revisions to the Superintendent’s contract for 2026-2027.

schoolssuperintendent-contractpersonnel
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CANCELLED MEETING POSTING Original Posting Date __06/12/2026 Original Posting Number __T443 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting - Executive Session Day, Date, and Time Tuesday, June 16, 2024, 7:40 PM Location / Address Nantucket High School, Conference Room 10 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Katie Bedell THIS MEETING HAS BEEN CANCELLED I. Call to Order II. Welcome and approval of agenda III. Motion to go into executive session by roll call pursuant to M.G.L. c. 30A section 21(a) for the following purposes: The Committee will adjourn to Open Session IV. Topic of Discussion - EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) Purpose (2): to conduct strategy sessions in preparation for negotiations with nonunion personnel and to conduct contract negotiations with nonunion personnel (Superintendent of Schools). V. Adjournment by roll call from Executive Session VI. Motion to go into Open Session VII. Vote on potential revisions to the Superintendent’s contract for 2026-2027 VIII. Adjournment 1 C A N C E L L E D
Tue Jun 16, 2026 · 18:00

Nantucket Public School Committee

School Committee will vote to ratify the 2026‑2029 Teachers’ Association contract

The Nantucket Public School Committee will hold votes on several items, including ratifying the 2026‑2029 Nantucket Teachers’ Association collective bargaining agreement and approving a GPA change in the high school handbook. The committee will also consider multiple cash donations to support school programs. Updates from the superintendent, facilities, athletics, wellness, and vision screening will be presented before the votes.

educationcontractsdonationsathleticsfacilities
10 Surfside Road, Nantucket High School, LGI, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, June 16, 2026, 6:00 PM Location / Address HYBRID - Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road · Nantucket, MA 02544 https://zoom.us/webinar/register/WN_YDeUlPBISxGjbazf-Ih1Hg Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA To virtually attend the meeting, register using the Zoom Webinar link below: https://zoom.us/webinar/register/WN_YDeUlPBISxGjbazf-Ih1Hg To watch meeting live, click here: https://youtube.com/live/KrjBrepfgzw I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. End-of-Year Activities b. Hiring Update c. Additional Updates VI. Presentations and discussions of issues to the Committee a. Educational Technology Department Update - Stephanie Hoban, Director of Ed Tech. b. Facilities Update/End-of-Year Usage - Chip Clunie, Director of Facilities c. Athletics Department Annual Update - Travis Lombardi, Athletic Director & Matt Hunt, [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 16, 2026 · 17:30

Harbor & Shellfish Advisory Board

Oyster growout sites and Chapter 91 licensing discussion

The Harbor & Shellfish Advisory Board will consider an on-the-water viewing of potential oyster growout sites in Nantucket Harbor and discuss Chapter 91 licensing, safe diesel fuel transfer, and a bay scallop catch reporting app. The board will also review draft letters to the Select Board and HSAB-related Town Meeting articles.

shellfishharborlicensingcommercial-fishingpublic-comment
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 Posting - HSA MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, June 16, 2026 at 5 p.m. in the meeting trailer at 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: https://us06web.zoom.us/j/84060739727?pwd=RcOKtdx0FXtuPz52zf92S2Kbu961oZ.1 Meeting ID: 840 6073 9727 Password: 346417 Location / Address REMOTE PARTICIPATION VIA ZOOM Pursuant to Governor Baker’s March 12, 2020 Order Regarding Open Meeting Law (Attached); the meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, June 16, 2026 at 5:30 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/84060739727?pwd=RcOKtdx0FXtuPz52zf92S2Kb u961oZ.1 Meeting ID: 840 6073 9727 Passwor [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 16, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review five sign applications and discuss Nantucket Island Resorts

The Sign Advisory Council will consider five sign applications, including a quarter board sign and entrance sign for Linda Loring Foundation at 110 Eel Point Rd, a projecting sign for Be ACK at 19 Washington St, a temporary sign for American Legion at 21 Washington St, and a projecting sign for On a Whim at 34 Center St. The council will also hold a discussion with Nantucket Island Resorts, take public comment, and address enforcement matters.

signssign-permitsnantuckethistoric-districtpublic-hearingenforcement
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, June 16, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC SAC Minutes June 16, 2026; adopted July 7, 2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday June 16, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:01 am. Attending members: Chris Young, Ben Normand, Kevin Kuester, Mark Cutone Absent members: Paul Wolf Late arrivals: Cutone at 9:04am Early Departures: none. Motion to amend agenda removing the discussion with NIR made by Kuester; seconded by Normand. Vote: Carried unanimously. Approval of Minutes: 6/9/26- N/A II. Public Comment -none III. Commissioner Comments- none IV. New Business Approved HDC Sign Advisory Council minutes 6/16/26; adopted 7/7/2026 Signs 1. Linda Loring Found 14416 110 Eel Point Rd OB- Quarter board sign 32/33 Kelly Emery Applicants: Seth Engelborg (Director of Education and Interpretation at LLNF and Kelly Emery, Nantucket Signs Discussion- Quarter board relocated to east exposure to align with new public entrance. Color scheme has been revised to differentiate the foundation from other conservation nonprofits on Nantucket. Kuester- purple should be subdued. Normand- background color appears to be the same color of the building. Makes it difficult to see. Cutone- no concerns. Young- Chantilly lace is not white- more cream-like color. Motion to approve made by Normand; seconded by Young. Carr [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve 19 Washington St LLC 14720 19 Washington St OB- projecting sign
1 nay
Kuester nay
Tue Jun 16, 2026 · 16:00

Roads and Right of Way Committee

Roads and Right of Way Committee to hold final meeting

The committee will meet to discuss transportation and real estate issues, including the status of Stone Alley and encroachment policy amendments. The meeting will include a history of the committee and updates on the Annual Road Works program. A statement regarding the Harbor Plan's progression to the Select Board will be entered into the record.

roadstransportationreal-estatepublic-worksharbor-plan
131 Pleasant Street, Meeting Trailer Room A, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Roads and Right of Way Committee Day, Date, and Time Tuesday, June 16, 2026, at 4:00 pm Location / Address Room A, The Trailer, 131 Pleasant Street; or by Zoom: Join Zoom Meeting https://us06web.zoom.us/j/87669110695?pwd=mIL8nMalDNshfRZ9D5DiaDEjIs0ZP5. 1 Meeting ID: 876 6911 0695 Passcode: 487956 Signature of Chair or Authorized Person Lee W. Saperstein WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Expected Attendance: Members: Rick Atherton, Gordon Auchterlonie, Ed Gillum, Nelson (Snookie) Eldridge, Nat Lowell, Rob Ranney, Allen Reinhard, Lee Saperstein, and Phil Smith; ex officio: Mike Burns, Drew Patnode, Bob Bystrowski, Tracy MacDonald, and Gary Rogers. 1. Call to Order and Roll Call; this meeting is being audio and video recorded: Lee Saperstein. 2. Public and Commissioners’ Comments on Items not on the Agenda including agenda approval. Comments from the Chair about final meeting of the Committee on Roads and Right of Way. Allen Reinhard will give committee’s his [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 15, 2026 · 11:00

Select Board

Select Board to consider alcohol licensing and utility petitions

The Select Board will discuss potential temporary extensions of alcohol sales hours and review several license holder requests. The meeting includes public hearings for liquor license amendments and three utility petitions from Nantucket Electric Company/National Grid.

licensingalcoholutilitiespublic-hearings
✓ Decided: Select Board approves several licensing and utility petitions

The Select Board approved multiple liquor license amendments, entertainment modifications, and utility petitions. The Board declined to proceed with a proposal for extended daily alcohol service hours.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, JUNE 15, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/ei7OhVosYks ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_Cr2yXPVZToqGpRMy8DArMg I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Discussion Regarding Alcoholic Beverages Control Commission (ABCC) Advisory Regarding Local Licensing Authority’s (LLA) Option to Temporarily Allow its On- Premises Licensees to Sell Alcoholic Beverages for One Additional Hour not to Exceed 3:00 AM as Well as the Ability for On-Premises Licensees Located within Public Alcoholic Beverages Consumption Areas Determined by the LLA to Sell Alcoholic Beverages for [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of June 15, 2026 Page 1 of 5 SELECT BOARD Minutes of the meeting of June 15, 2026. The meeting took place by remote participation via Zoom Webinar. Select Board Members present were Dawn E. Hill, Robert DeCosta, Brooke Mohr and Jill Vieth. Matt Fee was not present. Also present were Licensing Administrator Amy Baxter, Cultural Affairs and Special Events Coordinator Deana Weatherly and Real Estate Specialist Robert Bystrowski. I. CALL TO ORDER Chair Hill called the meeting to order at 11:00 AM. Mr. DeCosta noted he has to leave by 12:00 PM. II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Discussion Regarding Alcoholic Beverages Control Commission (ABCC) Advisory Regarding Local Licensing Authority’s (LLA) Option to Temporarily Allow its On-Premises Licensees to Sell Alcoholic Beverages for One Additional Hour not to Exceed 3:00 AM as Well as the Ability for On-Premises Licensees Located within Public Alcoholic Beverages Consumption Areas Determined by the LLA to Sell Alcoholic Beverages for Off-Premises Consumption; Votes May be Taken. Ms. Baxter reviewed the ABCC Advisory contained in the Board’s agenda packet. Ms. Mohr said she was not inclined to proceed with additional hour. Mr. DeCosta noted that hours will only extend until 2:00 AM. Ms. Mohr clarified that this is true. All Board members agree not to proceed. No votes were taken. IV. [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
approval for Change of Officers and Directors for Annual All-Alcoholic Beverages Club License for Sankaty Head Beach Club, Inc. dba Sankaty Head Beach Club
4 yea
Hill yea · DeCosta yea · Mohr yea · Vieth yea
authorize a TV temporarily on the entertainment license, an extension to 10:00 PM and abutter notifications for anything beyond normal hours, with the applicant checking in regarding post-game…
4 yea
Hill yea · DeCosta yea · Mohr yea · Vieth yea
close the hearing for Application for Multiple Amendments Including Alteration of Premises, Pledge of Collateral and Management Agreement for Annual All-Alcoholic Beverages Hotel License for Faros 17…
4 yea
Hill yea · DeCosta yea · Mohr yea · Vieth yea
approve with recommendations put forth by staff in the AIS and to determine that the premises licensed to sell alcoholic beverages is not detrimental to the spiritual activities of the First…
4 yea
Hill yea · DeCosta yea · Mohr yea · Vieth yea
close the hearing for Application for Modification of Entertainment License for Faros 17 Broad LLC dba Greydon House
4 yea
Hill yea · DeCosta yea · Mohr yea · Vieth yea
approval for prerecorded music inside up to 11:00 PM for Faros 17 Broad LLC dba Greydon House
3 yea · 1 abstain
Hill yea · Mohr yea · Vieth yea · DeCosta abstain
close the hearing for Application for Alteration of Outdoor Premises for Annual All-Alcoholic Beverages Restaurant License for Overlook Restaurant Nantucket, LLC dba Nantucket Fairgrounds
3 yea
Hill yea · Mohr yea · Vieth yea
approval subject to staff recommendations for Overlook Restaurant Nantucket, LLC dba Nantucket Fairgrounds
3 yea
Hill yea · Mohr yea · Vieth yea
Fri Jun 12, 2026 · 10:00

Nantucket Historical Commission

Nantucket Historical Commission to review sewer and light projects

The Nantucket Historical Commission will conduct Section 106 reviews for the Somerset Needs Area Sewer Project and the Coast Guard Station Brant Point Range Lights. The body will also discuss building naming, tree designation, and historic resource surveys.

historic-preservationsewer-projectinfrastructureland-use
131 Pleasant Street, Meeting Trailer Room A, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, June 12, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Staff update • Section 106 Review – Somerset Needs Area Sewer Project • Section 106 Review – Coast Guard Station Brant Point Range Lights • Ticcoma Green Building Naming • Liberty Tree designation • Update on Pleasant St improvements • Historic resource surveys update o PaleoWest, LLC / [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 11, 2026 · 13:00

Zoning Board of Appeals

Zoning Board to consider special permits and variances for property alterations

The Zoning Board of Appeals will meet to consider special permits for a property addition at 55 Baxter Road and a variance for a pool at 13 Fawn Lane. A request to alter lot lines at 11 & 12 Jonathan Way is continued to a later date.

zoningspecial-permitvariancehousingsepticpoolnantucket
✓ Decided: ZBA approves house alterations at 55 Baxter Road and continues two hearings

The Board approved a special permit for structural alterations at 55 Baxter Road. Two other applications, regarding a pool at 13 Fawn Lane and septic installation at 11 & 12 Jonathan Way, were continued to the July 9 meeting.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING ORIGINAL POSTING T 422 June 5, 2026 AM 11:02 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, June 11, 2026, at 1:00 PM Location / Address 131 Pleasant Street, Nantucket, MA 02554 ROOM A & REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Nicky Sheriff, Land Use Specialist WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA (Subject to Change) The meeting will be recorded and archived at www.nantucket-ma.gov. ZOOM WEBINAR REGISTRATION LINK: https://us06web.zoom.us/webinar/register/WN_U9fM0Bu6TeyFSd_5Jw5ULw To view the LIVE broadcast of the meeting, see YouTube Link at https://youtube.com/live/0bImfpWAC3E BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CALL TO ORDER: II. APPROVAL OF THE AGENDA: III. PUBLIC COMMENT for items not listed on the agenda: IV. APPROVAL OF MINUTES: 2 V. REQUEST FOR DETERMINATION OF INSUBSTANTIAL CHANGE (VOTES MAY BE TAKEN) 25-24 Surfside Crossi [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved ZBA Minutes – June 11, 2026 1 ZONING BOARD OF APPEALS 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket- ma.gov Commissioners: Susan McCarthy (Chair), John Brescher (Vice Chair), Elisa Allen (Clerk), Lisa Botticelli Alternates: Jim Mondani, Robert Constable ~~ MINUTES ~~ Thursday June 11, 2026 (ADOPTED ON 07/09/26) This meeting was held in person and via remote participation using ZOOM and YouTube. I. CALL TO ORDER Called to order at 1:09 pm and Announcements made by Chair McCarthy Attending Members: McCarthy, Brescher, Allen, Mondani, Botticelli, Constable Staff in attendance: Nicky Sheriff; Land Use Specialist, William Saad; Land Use Specialist, Triston Brown; Administrative Specialist Absent: Remote Members: - Late Arrivals: - Early Departures: - John Brescher left at 1:18PM II. APPROVAL OF AGENDA Motion: Motion to approve the agenda. (Made by:) (Seconded by: Mondani) Vote: Carried 5-0// McCarthy, Brescher, Allen, Botticelli, Constable (Aye) III. PUBLIC COMMENT IV. APPROVAL OF MINUTES V. REQUEST FOR DETERMINATION OF INSUBSTANTIONAL CHANGE(VOTES MAY BE TAKEN) 25-24 Surfside Crossing, LLC 3, 5, 7, and 9 South Shore Road WITHDRAWN This matter has been removed at the Applicant’s request VI. NEW BUSINESS 2026-0038 Amos B. Hostetter, Jr., Stephen W. Kidder and Michael J. Puzo, as Trustees of A & B Realty Trust 55 Baxter Road Reade Action Deadline September 19, 2026 The Applicant requests rel [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
5 yea
McCarthy yea · Brescher yea · Allen yea · Botticelli yea · Constable yea
approve the relief by Special Permit pursuant to Nantucket Zoning Bylaw Sections 139-30 and 139 33A(1)(b) to alter the pre-existing, nonconforming single family dwelling upon the locus
5 yea
McCarthy yea · Brescher yea · Botticelli yea · Allen yea · Constable yea
continue through July 09, 2026
5 yea · 1 abstain
McCarthy yea · Botticelli yea · Allen yea · Constable yea · Mondani yea · Brescher abstain
Thu Jun 11, 2026 · 08:00

Nantucket Water Commissioners

Commission will discuss pending personnel and vendor contracts

The Nantucket Water Commissioners will review the May 14 minutes, present production, billing, and rainfall reports, and receive updates on water quality, Chatham Road, drought conditions, and a new well. They will also discuss, amend, and execute any pending personnel or vendor contracts from the finance department. Public comment and any unforeseen items will be addressed before adjournment.

watercontractsbillingqualitydroughtwells
1 Milestone Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, June 11, 2026, at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Nantucket Water Commission Regular Meeting – in person at the Water Company conference room 1 Milestone Road, Nantucket, MA 02554 Thursday, June 11, 2026, at 8:00 AM 1. Call Meeting to Order 2. Acceptance of Agenda 3. Public Comment 4. Review of Minutes of May 14, 2026 meeting. 5. Production, Billing and Rainfall Reports 6. Director’s review and updates: a. Water Quality b. Chatham Rd c. Drought Conditions d. New Well Update e. Staff 7. Discussion, amendment and execution of any personnel or vendor contracts - pending from finance department. 8. Commissioner’s Comments and Reserved for Unforeseen Items for Discussion not anticipated. 9. Adjournment Next Regular Commission meeting Thursday, July 9, 2026, at 8 AM
Wed Jun 10, 2026 · 17:30

Select Board

Select Board to vote on $2.4M sewer contract, $750K road work, and affordable housing trust change

The Select Board will consider approval of multiple contracts including a $2.4 million agreement for Surfside wastewater treatment plant improvements, a $750,000 amendment for road work, and a $627,000 harbormaster patrol boat. They will also discuss an amendment to the Affordable Housing Trust Fund to increase the Area Median Income limit to 250%, receive a quarterly report from the Coastal Resilience Advisory Committee, and review short-term rental data. Annual committee appointments and approval of minutes and warrants are also on the agenda.

contractsbudgetaffordable-housingwaterinfrastructurepublic-safetyhousingroads
✓ Decided: Select Board approves various committee appointments and meeting minutes

The Select Board approved several years of meeting minutes, payroll warrants, and treasury warrants. The Board also filled multiple vacancies across various town commissions and committees through acclamation and paper ballots.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JUNE 10, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/TbuFXMyGOOc ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_j727QWJBSfWkI6JwrnPsHg I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Juneteenth (Friday, June 19, 2026) Celebrations. The Department of Culture and Tourism with the Museum of African American History, Boston & Nantucket, the Nantucket Historical Association, and Nantucket Island Chamber of Commerce is Hosting Juneteenth on Saturday, June 20 from 10:00 AM to 3:00 PM at the African Meeting House, 27 and 29 York Street. 3. Update [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of June 10, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of June 10, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Robert DeCosta, Matt Fee, Brooke Mohr and Jill Vieth. Dawn E. Hill joined the meeting later as noted. I. CALL TO ORDER Vice Chair Mohr called the meeting to order at 5:48 PM following a meeting of the Nantucket Regional Transit Authority Advisory Board. II. SELECT BOARD ACCEPTANCE OF AGENDA Vice Chair Mohr noted that committee appointments (item VIII - 1) is being moved to later in the meeting to allow for a full board to be present, and that item VIII – 2 has been tabled to the June 24th meeting. She noted that items III – 3 and 4 will be swapped and there will be one additional announcement. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Juneteenth (Friday, June 19, 2026) Celebrations. The Department of Culture and Tourism with the Museum of African American History, Boston & Nantucket, the Nantucket Historical Association, and Nantucket Island Chamber of Commerce is Hosting Juneteenth on Saturday, June 20 from 10:00 AM to 3:00 PM at the African Meeting House, 27 and 29 York [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 10, 2026 · 17:30

NRTA Advisory Board

Board will consider the Greenhound Intergovernmental Lease Agreement

The NRTA Advisory Board will open the meeting with a public comment period. It will then vote to approve the minutes from the May 13, 2026 meeting. Finally, the board will discuss and potentially approve the Greenhound Intergovernmental Lease Agreement.

public-commentminuteslease-agreementintergovernmental
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NRTA Advisory Board Day, Date, and Time Wednesday, June 10, 2026, 5:30pm Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD and REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Gary Roberts, NRTA Administrator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/TbuFXMyGOOc ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_j727QWJBSfWkI6JwrnPsHg I. Public Comment II. Approval of Minutes of meeting held on May 13, 2026 III. Greenhound Intergovernmental Lease Agreement
Wed Jun 10, 2026 · 15:00

Cemetery Commission

Cemetery Commission to reorganize, discuss Polpis lots and monument restoration

The Nantucket Cemetery Commission will hold a regular meeting on June 10, 2026. Agenda items include public comments, approval of minutes, election of officers (reorganization), updates on Polpis Cemetery lots, monument restoration at New North Cemetery, and Newtown Cemetery legal status. The board will also consider a new contractor for cemetery mowing.

cemeteryreorganizationmonumentslegal-statusmowingpolpis-cemeterynewtown-cemeterynew-north-cemetery
✓ Decided: Commission approves April minutes and prepares for Juneteenth monument dedication

The Commission approved the April 8, 2026, meeting minutes. Members discussed upcoming plans for a monument dedication at the Historic Coloured Cemetery on June 19 and updates regarding Polpis and Newtown cemeteries.

188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 Day, Date, and Time Wednesday, June 10, 2026, at 3:00 p.m. Location / Address DPW Conference Area, 188 Madaket Road Signature of Chair or Authorized Person Allen B. Reinhard, Chairman AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 Nantucket Cemetery Commission Meeting Notice and Agenda Wednesday, June 10, 2026 Meeting to be held at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. 1. Public and Commissioners Comments. 2. Approval of Minutes from May 13, 2026. 3. Commission reorganization: Election of officers. 4. Polpis Cemetery: Remaining lots laid out and marked. 5. Monument Restoration Project update: New North Cemetery. 6. Newtown Cemetery legal status update. MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cemetery Commission 2 7. New contractor for cemetery mowing. 8. Old, New or Other Business and final comments. 9. Adjourn. Next regular meeting: 3:00 p.m. Wednesday, July 8, 2026. Nantucket Cemetery Projects List: 1. Legal status of New [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 NANTUCKET CEMETERY COMMISSION Posted Meeting of May 27, 2026, at 3:00 pm DPW Conference Room, 188 Madaket Road, with Zoom Connectivity MAY FINAL AND APPROVED MINUTES Attendance, by Roll Call: Commissioners: Jascin Finger, Frances Karttunen, Scott McIver, Allen Reinhard, and Lee Saperstein (3:15 pm); Charlie Polachi, Cemetery Administrator. It was determined by roll call that there was a quorum at all times; for reference, the correct Zoom link to join Cemetery Commission meetings is Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 1. Call to Order. Allen Reinhard called the meeting to order at 3:00 pm; a roll call established the listed attendance. The link to the video recording is https://www.youtube.com/watch?v=1XLj4BgMWl0&list=PL49sKqpy7VAhIyX1ozdd1bZ3zV8 kXFp8M&index=70. 2. Public and Commissioners’ Comments. To begin, Frances Karttunen asked if she might relate the reception received by the video film of Nantucket’s Historic Coloured Cemetery in Helsinki. When unanimous consent was given, she said that it was excellent. Her attendance at the Maple Leaf and Eagle Conference was the reason for the delay in this month’s meeting. She said that there was an enthusiastic response from a nearly filled room. The next presentation will be on Juneteenth (June 19) at the Roxbury International Film Festival. For the dedication of the monument to Absalo [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approval of the minutes of April 8, 2026
4 yea
Frances Karttunen yea · Allen Reinhard yea · Jascin Finger yea · Scott McIver yea
Tue Jun 9, 2026 · 16:00

Historic District Commission

Historic District Commission to review residential construction and signage

The Historic District Commission is meeting to elect officers and review various applications for building alterations, new dwellings, and signage. The body will decide on consents for additions, sheds, and hardscaping, as well as new business regarding new home construction.

zoninghistoric-preservationconstructionsignagehousing
✓ Decided: HDC elects new officers and reviews several property renovations

The Commission elected Ray Pohl as Chair and Angus MacLeod as Vice Chair. The board approved various consents, sign recommendations, and a renovation at 240 Polpis Rd, while holding several other projects for revisions.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JUN 05 PM 02:21 Original Posting Number: T 427 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday June 09, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_uXmM_mrNS5CiZt4ug22VyQ#/registration To watch live feed, click here: https://www.youtube.com/live/o8zL755X_68 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, cl [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes June 9, 2026; adopted June 23, 2026 HISTORIC DISTRICT COMISSION Minutes June 9, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Ray Pohl (Chair), Angus MacLeod(Vice-Chair), Abby Camp, Val Oliver, Stephen Welch Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson In person: Pohl, MacLeod, Patten and Camp Zoom: Welch, Paul and Thornewill Meeting called to order at 4:00pm by Stephen Welch Board: Welch, Pohl, MacLeod, Oliver and Camp MacLeod made the motion to approve the agenda Motion carries unanimously Oliver left the meeting at 4:10pm Welch left the meeting at 5: 23pm Welch returned at 7:53pm Backus Left at 7:10pm I. ELECTION OF OFFICETS 1. Election of Officers • Board: Welch, Pohl, MacLeod, Oliver and Camp • Oliver Made the motion to elect Ray Pohl as Chair and Angus MacLeod as Vice Chair • Welch, Pohl and Oliver Yay; MacLeod and Camp Nay • Motion carries 3-2 2. Appointment of CPC Representative • Board: Welch, Pohl, MacLeod, and Camp • MacLeod made the motion for Connie Patten to remain as CPC Representative • Motion carries unanimously II. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Robert Sarvis 14776 11 Vesper Ln Rev. 14017; 69 sf addition 55/1.6 Self VO 2. Brad & Corinne Muffly 14792 1 Sea Fox Cir Addition 55/107.6 BPC Architecture VO 3. Amanda Cross 1 [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
elect Ray Pohl as Chair and Angus MacLeod as Vice Chair
3 yea · 2 nay
Welch yea · Pohl yea · Oliver yea · MacLeod nay · Camp nay
Tue Jun 9, 2026 · 08:00

Visitor Services Advisory Committee

Committee to discuss police department role in visitor services

The Visitor Services Advisory Committee will hold a remote meeting on June 9, 2026. The agenda includes a conversation with Sergeant John Rocket of the Nantucket Police Department, likely regarding public safety and visitor-related enforcement. Other items include approval of minutes from May 12, and reports from the Director, Visitor Services Coordinator, and Cultural Affairs and Event Coordinator.

visitor-servicespolicepublic-safetymeeting-minutesreports
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Visitor Services Advisory Committee Day, Date, and Time Tuesday, June 9th at 8:00am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person David Sharpe WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85275837374?pwd=ZmlCOWNCUmZhZXVQYitGTStjWEJIdz09 Meeting ID: 852 7583 7374 Passcode: 056433 1. Welcome VSAC Members 2. Public Comment 3. Approval of May 12th Minutes 4. Conversation with Sargeant John Rocket, Nantucket Police Department 5. Director’s Report 6. Visitor Services Coordinator’s Report 7. Cultural Affairs and Event Coordinator’s Report
Tue Jun 9, 2026 · 09:00

Sign Advisory Council (HDC)

Nantucket Sign Advisory Council to decide on multiple sign applications June 9

This meeting of the Sign Advisory Council includes public hearings and decisions on several sign applications. Notable items include a Master Sign Plan for Nourish Nantucket at 19 Boynton Lane, a projecting sign for 22 Federal Street, and signs for NIR Retail, LLC at Old South Wharf. The council will also discuss enforcement and approve minutes from a previous meeting.

signshistoric-districtnantucketpublic-hearingplanning
✓ Decided: Sign Advisory Council approves several business signs and holds others for revision

The Commission approved projecting, quarter board, and temporary signage for multiple businesses. Signage applications for Nourish Nantucket were held pending revisions regarding scale and visibility.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, June 09, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC SAC Minutes June 9, 2026; adopted July 7, 2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday June 9, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Ben Normand, Paul Wolf, Kevin Kuester, Mark Cutone Absent members: Chris Young Late arrivals: none. Early Departures: none. Motion to adopt agenda made by Cutone; seconded by Normand. Vote: Carried unanimously. Approval of Minutes: 6/2/2026 minutes made by Cutone; seconded by Wolf. Vote: Carried unanimously. II. Public Comment – Bill Goddard, local business owner, inquired about an upcoming application. Directed to contact staff online. III. Commissioner Comments- none Approved HDC Sign Advisory Council minutes 6/9/26; adopted 7/7/2026 1. 22 Federal St, LLC 14769 22 Federal S t Projecting sign 42.4.2/31 Anne Dougherty Discussion: Overall comments were made that existing projecting sign is small in scale as stated in a previous meeting. Suggested swapping the existing projecting sign on the corner of Federal and Broad Street, placing this proposed sign at the entrance. Since this proposed sign has not been made, make it larger and come back with a revised application for the projecting sign at the corner. Motion to approve as submitted made Normand; seconded by Wolf. Carries unanimously. 2. N ourish Nant [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 9, 2026 · 09:00

Select Board

Annual Select Board governance retreat scheduled

The Select Board will hold its annual governance retreat. No specific action items or public hearings are listed. The meeting is primarily procedural and planning-focused.

select-boardgovernanceretreatprocedural
✓ Decided: Select Board holds annual governance and strategic planning retreat

The Select Board conducted an annual governance retreat focused on roles, communication, and working relationships with Town staff. Discussion included board member motivations, effective governing practices, and the importance of project continuity. No substantive legislative or financial decisions were made during this session.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time TUESDAY, JUNE 9, 2026, 9:00 AM TO 1:00 PM Location / Address MEETING TRAILER, ROOM A, 131 PLEASANT STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CALL TO ORDER II. ANNUAL SELECT BOARD GOVERNANCE RETREAT III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of June 9, 2026 at 9:00 AM Page 1 of 4 SELECT BOARD Minutes of the Meeting of June 9, 2026. The meeting took place in person in Room A of the Meeting Trailer at 131 Pleasant. Members present were Matt Fee, Brooke Mohr and Jill Vieth. Robert DeCosta participated remotely. Dawn E. Hill joined the meeting later as noted. Also present were Town Manager C. Elizabeth Gibson, Deputy Town Managers Gregg Tivnan and Rick Sears, and Michelle Ferguson and Maddie Shea of Raftelis. I. CALL TO ORDER Vice Chair Mohr called the meeting to order at 9:03 AM. II. ANNUAL SELECT BOARD GOVERNANCE RETREAT Ms. Ferguson reviewed the agenda for the meeting, noted the use of a presentation that will be added to the Board’s agenda packet, and reviewed some ground rules for the meeting as to listening, participating and consensus-building. Ms. Ferguson asked the Board members to review expectations for today’s session. Ms. Mohr said she finds the annual governance meeting very helpful for the Board’s working relationship with each other, with discussion as to how they will function effectively together. Mr. Fee spoke on his commitment to seeing through the projects or initiatives he has helped start or progress. He noted the need for patience. Ms. Vieth said she is planning to listen and learn. Mr. DeCosta said he plans to mostly listen as well. Chair Hill joined the meeting at 8:15 AM. Ms. Gibson said she appreciates the opportunity to rev [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 9, 2026 · 16:00

Nantucket Islands Land Bank Commission

Commission to vote on Southern Pine Beetle service contract, discuss parking

The Nantucket Islands Land Bank Commission will consider awarding a contract for Southern Pine Beetle On-Call Services and discuss parking management at various properties. Other items include a change order for 41 Jefferson Avenue and an update on long-range objectives. Consent items include monthly transfer statistics, warrant authorization, and use requests for summer camps. An executive session will cover litigation and real estate negotiations.

contractsparkinglitigationsummer-campsreal-estateenvironment
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, June 9, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/84855951170?pwd=AXdmT5mzD4s4pDb6TVpLbd0ooyDOXn.1  Webinar ID: 848 5595 1170  Passcode: 943343  Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. PROPERTY MANAGEMENT a. Various Properties – Parking Discussion b. 41 Jefferson Avenue - Change Order 4. REGULAR BUSINESS a. Award Contract for Southern Pine Beetle On-Call Services 5. LONG-RANGE OBJECTIVES a. Update on Long-Range Objectives Workgroup 6. TRANSFER BUSINESS [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 9, 2026 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to ratify MassDOT grants for runway and apron lights

The Nantucket Memorial Airport Commission will ratify two MassDOT grant awards: $34,885 for Runway 6-24 Centerline Rehabilitation and $44,341.32 for Apron Lights installation. Commissioners will also discuss FY2028 Capital Project Requests, review pending leases and contracts (including a $1.5 million contract with McFarland-Johnson), and receive updates on PFAS investigation and the Terminal Optimization Project. An executive session is planned for collective bargaining and litigation strategy.

airporttransportgrantscapital-projectspfascontractsleasessolar
✓ Decided: Commission approves several airport contracts and updates meeting minute policy

The Commission approved multiple service contracts and a new timeline for distributing meeting minutes. A $1.5M contract for terminal renovation was held for further review pending a finalized scope.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, June 9, 2026 at 5:00 PM Location / Address HYBRID 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_4aNB_0OnRWWRDiDpKom_Hw Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_4aNB_0OnRWWRDiDpKom_Hw To view the meeting only, see link below: https://youtube.com/live/OE92W06P88g 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 05/12/26 Draft Minutes c. Ratify 05/13/26 and 05/27/26 Warrants 3. Public Comment 4. 060926-01 Agenda Production and Distribution 5. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 2 6. P [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING June 9, 2026 The meeting was called to order at 5:0 0 PM by Chairman Arthur Gasbarro with the following Commissioners present: Andrea Planzer, Anthoney Bouscaren, Philip Marks III, and Michael Leavitt. This meeting took place at 131 Pleasant Street, Nantucket, MA, and was conducted via Zoom Webinar and broadcast live on the Town of Nantucket YouTube channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Rich Lasdin , McFarland -Johnson; Priyanka Menon, Fennic k-McCredie Architecture; Philip Cox, Cox Aviation; and Kevin Bartlett, Cox Aviation. Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Gasbarro asked for comments and concerns on the 05/12/26 Draft minutes. Mr. Marks made a Motion to ratify the 05/13/26 and 0 5/27/26 Warrant [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
ratify the 05/13/26 and 0 5/27/26 Warrants
5 yea
Leavitt yea · Bouscaren yea · Marks yea · Planzer yea · Gasbarro yea
minutes be distributed within ten (10) calendar days following each meeting, and that substantial edits received be redistributed within ten (10) calendar days of receipt
5 yea
Planzer yea · Leavitt yea · Marks yea · Bouscaren yea · Gasbarro yea
approve the leases, contracts, and contract amendments as set forth in Exhibit One (1) , excluding the McFarland -Johnson Task Order MJ -EN-18
5 yea
Planzer yea · Leavitt yea · Bouscaren yea · Marks yea · Gasbarro yea
Tue Jun 9, 2026 · 10:00

Coastal Resilience Advisory Committee

Committee to review Surfside wastewater dune restoration and floodplain zoning

The Coastal Resilience Advisory Committee will review a conceptual design for the Surfside Wastewater Treatment Facility Dune Restoration project. Members will discuss flood insurance and determine which parts of a Model Floodplain Overlay District Zoning Bylaw to present for community feedback on July 14, 2026.

coastal-resiliencezoningflood-insurancewastewaterenvironment
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, June 9, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, June 9, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes April 28, 2026 5. Presentation on the Surfside Wastewater Treatment Facility Dune Restoration Conceptual Design and Long-Term Planni [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 8, 2026 · 16:00

Planning Board

Planning Board to hold public hearings on multiple property developments

The Planning Board will review applications for second dwellings and Approval Not Required (ANR) plans. The meeting includes public hearings for various residential and commercial properties, including the Easy Street Restaurant and Five Day Beans LLC.

zoningpublic-hearingsland-usehousingcommercial-development
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATE MEETING POSTING: Original Posting: 06-03-2026 Original Time: 2:51 PM MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, Liza Hatton and Brian Borgeson Alternates: Abby De Molina and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 06-08-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: Zoom Registration – June 8, 2026 To view the meeting only, see link below: Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, June 8, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Zoom Registration – June 8, 2026 Meeting Packet Link 2026 Meeting Packet Link [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jun 8, 2026 · 12:00

Scholarship Committee

Scholarship subcommittee to decide Maglathlin and Congdon awards

The Nantucket School Committee's Scholarship Subcommittee will meet to discuss and decide the Maglathlin and Congdon Scholarships for 2026. The agenda includes only this substantive item alongside routine procedural actions.

scholarshipseducationnantucketschool-committee
32 First Way
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee - Scholarship Subcommittee Day, Date, and Time Monday, June 8, 2026, 12:00 PM Location / Address Nantucket Public Schools - Central Office 32 First Way Nantucket, MA Signature of Chair or Authorized Person WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda III. Discussion and Decision - Maglathlin and Congdon Scholarships for 2026 IV . Adjournment 1
Thu Jun 4, 2026 · 09:00

Select Board/County Commissioners

Select Board to enter executive session for labor talks and property

The Select Board will convene and then immediately go into executive session to discuss collective bargaining with multiple union units and to consider the purchase or lease of real property at 7 Dooley Court. No public votes or decisions are scheduled during the open portion of the meeting.

select-boardcounty-commissionersexecutive-sessionlabor-negotiationsreal-estatenantucket
✓ Decided: Select Board moved to executive session for labor and real property discussions

The Select Board voted to adjourn to an executive session. The session includes reviewing previous minutes, conducting strategy sessions regarding union negotiations, and discussing the property at 7 Dooley Court.

16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, JUNE 4, 2026 AT 9:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of May 14, 2026 at 9:00 AM; May 18, 2026 at 1:30 PM. 2. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personnel and to Discuss Strategy with Respect to Collective Bargaining or Litigation, where an Open Meeting May have a Detrimental Effect on the Bargaining or Litigating Position of the Select Board/County Commissioners and the Chair so De [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of June 4, 2026 Page 1 of 2 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of June 4, 2026. The meeting was held in the Town Building Conference Room, Nantucket and via Zoom. Select Board Members present were Dawn E. Hill, Robert DeCosta, Matt Fee, Brooke Mohr and Jill Vieth. Town Manager C. Elizabeth Gibson, Deputy Town Manager Rick Sears and Human Resources Director Amanda Perry were present in person. Deputy Health and Human Services Director Jerico Mele and Operations Administrator Erika Mooney were present remotely. I. CONVENE IN OPEN SESSION Chair Hill called the meeting to order at 9:01 AM. Ms. Mohr moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purposes of: 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of May 14, 2026 at 9:00 AM; May 18, 2026 at 1:30 PM. 2. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personnel and to Discuss Strategy with Respect to Collective Bargaining or Litigation, where an Open Meeting May have a Detrimental Effect on the Bargaining or Litigating Position of the Select Board/County Commissioners and the Chair so Declares – Massachusetts Laborers’ Distr [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A)
5 yea
Hill yea · DeCosta yea · Fee yea · Mohr yea · Vieth yea
Thu Jun 4, 2026 · 17:00

Conservation Commission

Conservation Commission to hear dredging and construction permit requests

The Nantucket Conservation Commission will hold a hybrid meeting to discuss public hearings and orders of conditions for various projects, including a Polpis Harbor dredging plan and construction permits on Polpis Road.

conservationdredgingzoningpublic-hearingconstructionenvironment
✓ Decided: Commission approves orders for Polpis Road and Baxter Road properties

The Commission approved an order of conditions for 268 Polpis Road and a minor modification for 64 & 66 Baxter Road. Several other items, including dredging plans and various notices of intent, were continued until June 18, 2026.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 MAY 26 PM 02:00 Original Posting Number: T 397 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, June 4, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://youtube.com/live/MBGzvmDF2BE Zoom Registration: https://us06web.zoom.us/webinar/register/WN_kWVOJJMqQfOiQ5TQu7R15g Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for June 4, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes June 4, 2026, adopted June 18, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, June 4, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/MBGzvmDF2BE Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Schafer, and Turcotte Absent Members: Braine, Plandowski, and Williams Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:27) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Schafer) Vote: Vote Carried: 4:0: Engelbourg, Misurelli Schafer, and Turcotte (aye) III. Announcements Discussion: (00:02:32) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:02:55) Engelbourg - We had a comment from Emily Molden from the Nantucket Land and Water Council at the last meeting that was pretty much covered in the agenda item for Baxter Road. V. Public Comment Chair Engelbourg called for public comment Discussion: (00:03:11) none VI. Public Hearing A. Notice [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (7 roll-call votes)
Named votes as recorded in the official record.
accept the agenda
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
close SE48-3978
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
close (Hicks- 268 Polpis Road SE48-3978)
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
issue OOC as drafted (Hicks- 268 Polpis Road SE48-3978)
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
issue the Minor Modification for SE48-3197
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
issue Minor Modification (Golden Pond-64 & 66 Baxter Road SE48-3197)
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
approve the Minutes for 05/21/2026
4 yea
Engelbourg yea · Misurelli yea · Schafer yea · Turcotte yea
Thu Jun 4, 2026 · 11:30

Airport Commission, Nantucket Memorial

Airport Commission to discuss aviation fuel engineering and supply updates

The Nantucket Memorial Airport Commission will meet to review draft minutes and discuss the engineering task order for the fuel farm, MEPA review, and fuel supply updates.

airportfuelengineeringmeprapublic-meeting
✓ Decided: Subcommittee discusses fuel farm engineering and environmental review acceleration

The Aviation Fuel Subcommittee discussed options to accelerate the environmental review for a proposed fuel farm project using a hardship-based waiver. The group also reviewed current fuel supply levels, reservation usage, and outreach efforts to convert non-fuel purchasers.

14 Airport Road, Administration Building
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission – Aviation Fuel Subcommittee Day, Date, and Time Thursday, June 4, 2026 at 11:30 AM Location / Address This meeting will be held In-Person at 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 14 Airport Road, Unit 1, Administration Building 2nd Floor Conference Room, Nantucket, MA 02554 Thursday, June 4, 2026, at 11:30 AM 1. Call to Order 2. Review and Approve: a. Agenda b. 04/13/26 and 05/19/26 Draft Minutes 3. 060426-01 – Discussions Regarding Aviation Fuel: a. Fuel Farm Engineering Task Order b. Separate MEPA Review c. Fuel Supply and Sales Update d. Converting Non-Fuel Purchasers Update e. Fuel Supply RFP Specifications Update 4. Public Comment 5. Adjourn
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AVIATION FUEL SUBCOMMITTEE MEETING June 4, 2026 The meeting was called to order at 11:30 AM by Airport Manager Warren Smith with the following Commissioners present: Michael Leavitt and Philip Marks III. This meeting was conducted in person at 14 Airport Road, Nantucket, MA. Airport employees present were: Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; and Elizabeth Reuss, Administrative Assistant. Also present: Rich Lasdin, McFarland-Johnson. Mr. Smith read the Town’s virtual meeting statement. Mr. Smith asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Smith asked for comments and concerns on the 04/13/26 and 05/19/26 Draft minutes. Mr. Leavitt then made a Motion to approve the 04/13/26 and 05/19/26 Draft Minutes. Second by Mr. Marks. 060426-01 – Discussion Regarding Aviation Fuel:  Fuel Farm Engineering Task Order and Separate MEPA Review Mr. Lasdin reported that the Commission requested options to accelerate the environmental review for the proposed fuel farm project. The project is currently included in the state and federal EAEIR, which evaluates [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jun 4, 2026 · 12:15

Nantucket Public School Committee

School Committee reorganizes, assigns members to task forces for FY27

This is a reorganizational meeting of the Nantucket School Committee to elect officers and assign committee and task force memberships for fiscal year 2027. No substantive policy or budget decisions are on the agenda.

nantucketschool-committeereorganizationassignmentsfiscal-year-2027
Central Office, 32 First Way, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting – Reorganizational Meeting Day, Date, and Time Thursday, June 4, 2026 - 12:15 PM Location / Address HYBRID - Nantucket Public Schools Central Office 32 First Way Nantucket MA 02544 https://zoom.us/j/97719875348?pwd=acnLvG2AQ3Ipbg33l1xgABZJXxxb1o.1 Signature of Chair or Authorized Person WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! The Committee will begin in Open Session and continue to Organizational Session for the purpose of Reorganization and School Committee & Task Force Assignments FY 27 I. Call to Order II. Welcome and approval of agenda III. Organization and School Committee and Task Force Assignments IV. Adjournment 1
Wed Jun 3, 2026 · 15:00

Council on Aging

Council on Aging to discuss seniors of the year and senior expo updates

The Council on Aging will meet to approve minutes and hear from a guest speaker regarding elder services. The agenda includes updates on the Seniors of the Year and the Senior Expo.

council-on-agingseniorselder-servicesmeetingpublic-hearing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, June 3, 2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person ROBERT M KUCHARAVY, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Approval of minutes of April 1, 2026 V. Official business 1. Guest speaker: Sheri Hunt, Director/Care Manager, Elder Services of the Cape and Islands 2 2. Seniors of the Year Update - Robert Kucharavy 3. Senior Expo Update - Mary Anne Easley and Erin Lynch VI. Report - [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jun 3, 2026 · 17:30

Select Board

Select Board to hold hearing on airport fuel storage license

The Select Board will consider an application for an amended bulk fuel storage license for Nantucket Memorial Airport. The board will also review applicants for various town committees and discuss sidewalk improvements for Pleasant Street.

airportzoningroadsappointmentspublic-safety
✓ Decided: Select Board approves Pleasant Street sidewalk improvements and airport fuel license

The Select Board approved recommended alternatives for the Pleasant Street sidewalk project and an amended bulk fuel storage license for Nantucket Memorial Airport. The Board also approved previous meeting minutes and treasury warrants.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 AMENDED MEETING POSTING Original posting date: 5/29/2026 Original Posting # T 403 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JUNE 3, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/ULCPUUn2ppY ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_W6-Fo7KERFWkgQgc6qmMlg I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Nantucket Under Level 2 Drought Condition Mandatory Water Restrictions are in Place and Fines will be Charged for Non- Compliance. See https://www.nantucket-ma.gov/1897/Water for More Information. 3. Housing Newsletter Out Tomorrow Latest Housing Newsletter will be released Tuesday, June 4, Featurin [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of June 3, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of June 3, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Matt Fee, Brooke Mohr and Jill Vieth. Dawn E. Hill and Robert DeCosta joined the meeting later as noted. I. CALL TO ORDER Vice Chair Mohr called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Nantucket Under Level 2 Drought Condition Mandatory Water Restrictions are in Place and Fines will be Charged for Non-Compliance. See https://www.nantucket-ma.gov/1897/Water for More Information. 3. Housing Newsletter Out Tomorrow Latest Housing Newsletter will be released Thursday, June 4, Featuring Updates from Housing Department, Information about Current and Upcoming Housing Opportunities and Resources for Residents, Workers, Community Members. Sign-up at www.nantucket-ma.gov/housingnews. 4. Textile Recycling Event Solid Waste is Holding a Pop-up Textile Recycling Event on Saturday, June 6 from 8:00 AM to Noon at Solid Waste & Recycling Facility, 188 Madaket Road. Full List of Accepted [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 2, 2026 · 12:30

Affordable Housing Trust

Board will vote on purchasing three properties in an executive session

The Affordable Housing Trust will accept its agenda, approve minutes from May 19, and announce a lottery for a $373,000 home at 1 Cranberry Lane. The board will review a UMass Donahue Institute analysis of proposed real‑estate transfer fees, update Closing Cost Assistance Program income limits, and consider a waiver of income‑verification requirements for the Year‑Round Deed Restriction Pilot Program Round I. Members will vote on awarding the RFP for the Year‑Round Deed Restriction Pilot Program Round II. In executive session, the trust will consider purchase, exchange, or lease of real property at 27 Old South Road, 7 Dooley Court, and 13 Woodland Drive.

affordable-housinghousing-trustproperty-purchaselotteryhud-updatesexecutive-session
✓ Decided: Trust approved up to $200,000 for Year‑Round Deed Restriction Pilot at 10 Arkansas Ave

The Affordable Housing Trust approved an update to the Closing Cost Assistance Program income limits to match 2026 HUD figures. It also approved a waiver for the income verification requirement for the Year‑Round Deed Restriction Pilot at 17B Essex Road. The Trust authorized up to $200,000 to award a contract to Claire and Steven Williams for the Year‑Round Deed Restriction Pilot property at 10 Arkansas Avenue. Finally, the board moved to adjourn to executive session to consider several real‑property matters.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, June 2, 2026, at 12:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, JUNE 2, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. Housing Assistance Corporation (HAC) is accepting applications to a lottery for 1 Cranberry Lane, a three- bedroom, two-bathroom single family home. The home is income-restricted at 80% Area Median Inc [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on June 2, 2026, at 12:30PM Approved the 16th day of June 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, June 2, 2026 Remote Meeting via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice- Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Penny Dey, Brooke Mohr, Mary Mack, and Abby D e Molina Staff members present: Kristie Ferrantella (Housing Director ), Dylan Metsch-Ampel (Deputy Housing Director) , Caroline Ferguson (Administrative Specialist) , Vicki Marsh (Town Counsel), Eric Barth (Town Counsel), Keelin Ciccariello (Town Counsel), Steven Hunter (Financial Analyst), Tracy MacDonald (Real Estate Manager) Speaker(s) present: Megan Trudel (Deputy Planning Director) All votes were taken by roll call. I. CALL TO ORDER Vice-Chair Dey called the meeting to order at 12:34 PM. II. ACCEPTANCE OF AGENDA Abby De Molina made a MOTION to approve the agenda. Brooke Mohr seconded the motion; by roll call vote: Brooke Mohr – Aye; Mary Mack – Aye; Abby De Molina – Aye; Penny Dey – Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. Housing Assistance Corporation (HAC) is accepting applications to a lottery for 1 Cranberry Lane, a three-bedroom, two-bathroom single family home. The home is income-restricted at 80% Area Median Income (AMI), and it is being sold for $373,000. To l [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
4 yea
Brooke Mohr yea · Mary Mack yea · Abby De Molina yea · Penny Dey yea
approve the open session minutes of May 19, 2026
4 yea
Mary Mack yea · Brooke Mohr yea · Abby De Molina yea · Penny Dey yea
approve Closing Cost Assistance (CCAP) Income Limit Update to Align with the 2026 US Department of Housing and Urban Development (HUD) update, and to update the CCAP application to reflect the new…
4 yea
Brooke Mohr yea · Abby De Molina yea · Mary Mack yea · Penny Dey yea
approve the waiver request related to the applicants’ interest in other real property for the proposed year-round deed restriction at 17B Essex Road and authorize staff to issue a letter to Housing…
4 yea
Mary Mack yea · Brooke Mohr yea · Abby De Molina yea · Penny Dey yea
approve the allocation of up to $200,000 of funds to authorize the award of a contract to Claire and Steven Williams for the Year -Round Deed Restr iction Pilot Program property located at 10…
4 yea
Brooke Mohr yea · Mary Mack yea · Abby De Molina yea · Penny Dey yea
Tue Jun 2, 2026 · 16:00

Historic District Commission

HDC to review new hotel at 30 N. Beach St. and other old business

The Nantucket Historic District Commission will consider a backlog of old business items, including a new hotel at 30 N. Beach Street, multiple new dwellings and additions, and five temporary sign applications for the Nantucket Film Festival. The commission will also approve minutes from May 12 and discuss future topics such as brick veneer classification and hardscaping policy.

historic-districtsignsbuilding-permitsold-businesspreservationnantucket
✓ Decided: Historic District Commission approved a new hotel at 30 N. Beach St.

The commission approved several project permits, including a new hotel building at 30 N. Beach St. (3‑2 vote) and related hardscape work (unanimous). It also approved a fence consent for Maya Kearns and adopted sign recommendations for temporary festival signs (both unanimous). The 115 Cliff Rd application was held for revisions, and a guest house at 10 Maxey Pond Rd was approved (4‑1).

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAY 29 AM 10:13 Original Posting Number: T 402 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, June 2, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_dv9mKKD4TEO_rpHyYnXubA#/registration To watch live feed, click here: https://www.youtube.com/live/t3tm4p6EUhk Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpub [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes June 2, 2026; adopted June 16, 2026 HISTORIC DISTRICT COMISSION Minutes June 2, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Land Use Specialist and Holly Backus, Preservation Planner Meeting called at 4:02pm by Stephen Welch Pohl made the motion to approve the agenda. Approved by Welch, Pohl, Oliver, MacLeod and Camp In person Welch, Pohl, Oliver, Camp, MacLeod and Patten Zoom: Paul and Thornewill Camp left at 7:05pm I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Maya Kearns 14516 30 Miacomet Av Fence 67/195.3 Self VO • Board: Welch, Pohl, Oliver, MacLeod and Camp; Alternates: Thornewill, Patten, Paul • Oliver made the motion to approve consents • Motion carries unanimously II. COMMISSIONER Q & A WITH PRESERVATION PLANNER • In response to Angus MacLeod’s question regarding the proposed boardwalk at 30 Beach and its relationship to the Town’s pedestrian right-of-way, Holly Backus stated that the boardwalk is an unusual feature that is not consistent with the Historic District context. She explained that any portion of the boardwalk that extends into the Town right -of-way would require review by both the Historic District Commission (HDC) and the Department of Public [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
approve through Exhibit A (30 N. Beach St New hotel building)
3 yea · 2 nay
Welch yea · Patten yea · Camp yea · MacLeod nay · Oliver nay
The other 2 items passed by unanimous or near-unanimous consent.
Tue Jun 2, 2026 · 18:00

Nantucket Public School Committee

Committee will vote on a school field trip to Rome and Naples, Italy

The Nantucket Public School Committee will consider several votes, including a change to the high school GPA policy, a $1,000 donation for the CPS Summer Reading Program, and approval of a field trip to Italy. They will also vote on appointing a committee clerk and approving recent meeting minutes.

educationfield-tripbudgetpolicyappointments
10 Surfside Road, Nantucket High School, LGI, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, June 2, 2026, 6:00 PM Location / Address HYBRID - Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road · Nantucket, MA 02544 https://zoom.us/webinar/register/WN_gocvUZyaQMWubKuwZN9SSg Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA To virtually attend the meeting, register using the Zoom Webinar link below: https://zoom.us/webinar/register/WN_gocvUZyaQMWubKuwZN9SSg To watch meeting live, click here: https://youtube.com/live/7KhOsaEDExc I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. Student Enrollment b. Transportation Update c. End-of-Year Activities d. Additional Updates VI. Presentations and discussions of issues to the Committee a. English Learner/ELPAC Update b. 2025 DESE Accountability Scores VII. Committee discussions and votes to be taken a. Vote to approve the NHS GPA proposal change in the High School Student Handbook and Program of St [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jun 2, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review five temporary sign permits for Nantucket Film Festival

The Sign Advisory Council will consider five temporary sign applications for the Nantucket Film Festival at properties including 17 S Water St, 2 Center St, 19 Broad St, 5 N Water St, and 10 Easy St. The meeting also includes procedural items, public comment, and enforcement discussion.

signstemporary-signsnantucket-film-festivalpublic-hearingpermits
✓ Decided: Council approved four temporary festival signs and held one for revisions

The Sign Advisory Council unanimously approved temporary signs for Nantucket Dreamland, the Methodist Church, 19 Broad St LLC, and NPAC (the NPAC vote was 3‑2). The council rejected a motion to approve the Ack East St LLC sign and instead unanimously voted to hold it for revisions. Earlier procedural items – adopting the agenda and approving the prior minutes – also passed unanimously.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, June 02, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC SAC Minutes June 2, 2026; adopted June 9, 2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday June 2, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Kevin Kuester, Mark Cutone Absent members: none. Late arrivals: none. Early Departures: none. Motion to adopt agenda made by Kuester; seconded by Normand. Vote: Carried unanimously. Approval of Minutes: 5/26/2026 minutes made by Kuester; seconded by Wolf. Vote: Carried unanimously. II. Public Comment -none III. Commissioner Comments- none HDC Sign Advisory Council minutes 6/2/26; adopted 6/9/26 Signs 1. Nantucket Dreamland 14763 17 S Water St NFF Temp Sign 42.3./11.1 Nantucket Film Festival Discussion: No concerns Motion to recommend approval made by Normand; seconded by Wolf. Carries unanimously. 2. Methodist Church 14764 2 Center St NFF Temp Sign 42.3.1/199 Nantucket Film Festival Discussion: No concerns. Existing free-standing sign meant for this purpose. Motion to recommend approval made by Cutone; seconded by Wolf. Carries unanimously. 3. 19 Broad St LLC 14765 19 Broad St NFF Temp Sign 42.4.2/75 Nantucket Film Festival Discussion: No concerns. Motion to recommend approval made by Kuester; seconded by Cutone. Carries unanimously. 4. NP [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
recommend approval of NPAC 14766 5 N Water St NFF Temp Sign
2 nay
Young nay · Normand nay
Tue Jun 2, 2026 · 17:30

Harbor & Shellfish Advisory Board

Board will discuss commercial scalloping guidelines and related policies

The Harbor & Shellfish Advisory Board will meet to consider several items concerning commercial scalloping, including apprenticeship guidelines, licensing requirements, diesel fuel transfer safety, a catch‑reporting app, and a questionnaire for recreational scalloping. The board will also receive general reports from the Marine and Natural Resources departments and allow public comment. All listed items are slated for discussion, not formal decisions.

harborshellfishscallopingmarinenatural-resourcespublic-comment
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, June 2, 2026 at 5:30 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting - https://us06web.zoom.us/j/87190290779?pwd=pq9xarHaPDHOhWaneDUxdhg78SDrIc.1 Meeting ID: 871 9029 0779 Password: 426356 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, June 2, 2026 at 5:30 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/87190290779?pwd=pq9xarHaPDHOhWaneDU xdhg78SDrIc.1 Meeting ID: 871 9029 0779 Password: 426356 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of May 5, 2026 and May 19, 2026 CHAIRMAN’S REPORT Election of Officers MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOU [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 28, 2026 · 17:00

Nantucket Planning & Economic Development Commission

NP&EDC to vote on Transportation Improvement Program amendments

The Nantucket Planning & Economic Development Commission will consider approving Amendment #1 to the FFY 2026-30 Transportation Improvement Program (TIP) and the draft FFY 2027-31 TIP, and authorize a public review period for the FFY 2027 Unified Planning Work Program (UPWP). The meeting also includes discussion of Safe Streets and Roads for All grant and announcements on June meeting date change and bike path stop signs.

transportationplanninggrantspublic-reviewnantucket
✓ Decided: Commission approved $420,000 TIP amendment shifting federal highway funds to transit

The commission unanimously approved Amendment #1 to the FY 2026‑2030 Transportation Improvement Program, flexing about $420,000 of federal highway funding to transit projects. It also closed the public review and approved the draft FY 2027‑2031 TIP and authorized a public review period for the FY 2027 Unified Planning Work Program. No other actions were taken.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Thursday, May 28, 2026 at 5:00 pm Location / Address Hybrid – Meeting Trailer at 131 Pleasant Street, Room A and Remote Participation via Zoom https://us06web.zoom.us/webinar/register/WN_ITlCASrWSJamKt84YoWzaw#/registra tion Signature of Chair or Authorized Person Leslie Snell, AICP, Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGEN DA To participate in the meeting, use the registration link below: https://us06web.zoom.us/webinar/register/WN_ITlCASrWSJamKt84YoWzaw#/registration To view the meeting only: https://www.youtube.com/watch?v=UIsN49K9-y4 This meeting is being audio/video recorded and will be uploaded to the Town of Nantucket YouTube page at a later date. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Public Comment for items not included on the agenda: V. Announcements: • Reminder- June Meeting date change – from Monday [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ NP & EDC – MAY 28, 2026 @ 5:00PM MINUTES *Hybrid* - Meeting Trailer, Room A, 131 Pleasant Street and Remote Participation via Webinar ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ ▬▬▬▬▬ LINK TO MEETING: https://us06web.zoom.us/webinar/register/WN_ITlCASrWSJamKt84YoWzaw#/registration YOUTUBE LINK: Nantucket Planning & Economic Development Commission - May 28, 2026 - YouTube Commissioners: Abby De Molina - Chair, Michael Misurelli (Absent) - Vice Chair, Nat Lowell (Absent), Dave Iverson, Dawn Hill, Brian Borgeson, Liza Hatton, Bert Johnson (Absent), Joseph Topham and Kristina Jelleme Staff: Leslie Snell - Director of Planning, Megan Trudel - Senior Planner, Mike Burns - Transportation Program Manager (Absent) PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: Chair De Molina called the meeting to order at 5:00 PM. II. Establishment of Quorum: A quorum was established. Roll call vote: Commissioners present: Kristina Jelleme – Aye Joseph Topham – Aye Brian Borgeson – Aye Dawn Hill – Aye Dave Iverson – Aye Liza Hatton – Aye Chair Abby De Molina – Aye As all Commissioners were present in person, roll-call votes were not required for agenda items and votes were taken by voice vote. III. Approval of Agenda: MOTION/VOTE: Mr. Iverson made a motion to approve the agenda. The motion was duly seconded by Mr. Topham, and the motion carried un [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
Establishment of Quorum
7 yea
Kristina Jelleme yea · Joseph Topham yea · Brian Borgeson yea · Dawn Hill yea · Dave Iverson yea · Liza Hatton yea · Abby De Molina yea
Thu May 28, 2026 · 15:00

Nantucket Intermediate School Council

Nantucket Intermediate School Council to review family survey and set goals

The council will review results from the NIS Family Survey to identify common themes for short-term and long-term goals. Members will also discuss a communication plan and provide feedback on the council's performance for the year.

educationschool-improvementcommunity-surveyplanning
30 Surfside Road, NIS Cafeteria
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
RECEIVED __ 2026 MAY 20 AM 10:17 MEETING POSTING NANTUCKET TOWN CLERK TOWN OF NANTUCKET Posting Number:T 385 Pursuant to MGL Chapter 30A, § 18-25 y, All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NIS School Council Day, Date, and Time _| Thursday, May 28, 2026 — 3:00 PM Location / Address " 30 Surfside Road, Nantucket, MA a NIS Conference Room Signature of Chair or Authorized Person ZZ WARNING: IF THERE | QUO OF MEMBERS PRESENT, OR IF MEETING POSTINGS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 1. Review of minutes from March meeting 2. School Improvement Plan Focus Goal Work a. Review of results/notes of NIS Family Survey b. Determine common themes to create possible goals for school council moving forward i. Short-Term Goals/Action Steps ii, Long-Term Goals/Action Steps c. Communication Plan 3. Wrap Up for Year a. Feedback on NIS School Council b. Thank you to members c. Invitation to return to council for upcoming year
Wed May 27, 2026 · 15:00

Cemetery Commission

Cemetery Commission to discuss monument restoration and new member recruitment

The Nantucket Cemetery Commission will meet to approve minutes, discuss the restoration of the New North Cemetery monument, and plan the dedication of a new stone for Absalom Boston. The body will also consider the Newtown Cemetery's Article 81 real estate acquisition and discuss organizational changes.

cemeterymonumentsrestorationhistoric-coloured-cemeterynewtown-cemeterypolpis-cemeteryabsalom-boston
✓ Decided: Commission approved April minutes and set Juneteenth monument dedication plans

The Cemetery Commission unanimously approved the minutes from the April 8 meeting. It confirmed the upcoming dedication of a new monument to Absalom and Hannah Boston on Juneteenth, and scheduled installation of new corner markers at Polpis Cemetery on June 2. The commission also directed staff to consult real‑estate specialists about the Newtown Cemetery property and to locate an early consultant report for that site.

188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 Day, Date, and Time Wednesday, May 27, 2026 at 3:00 PM Location / Address DPW Conference Area, 188 Madaket Road Signature of Chair or Authorized Person Allen B. Reinhard, Chairman AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 Nantucket Cemetery Commission Meeting Notice and Agenda Wednesday, May 27, 2026 Meeting to be held at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. 1. Public and Commissioners’ comments. 2. Approval of Minutes from April 8, 2026. 3. A plan for dedication of the new stone for Absalom Boston in the Historic Coloured Cemetery on June 19, Juneteenth at 9 a.m. Potential speakers, program, parking, publicity, cemetery entrance. 4. Update on new corner markers at Polpis Cemetery, Red Maple at Polpis showing signs of life/ 5. Update: New North Cemetery monument restoration project. 6. Newtown Cemetery: Annual Town Meeting vote on Article 81, Real Estate Acquisition, Bob or Tracy to comment on next steps if available. MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) C [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 NANTUCKET CEMETERY COMMISSION Posted Meeting of May 27, 2026, at 3:00 pm DPW Conference Room, 188 Madaket Road, with Zoom Connectivity MAY FINAL AND APPROVED MINUTES Attendance, by Roll Call: Commissioners: Jascin Finger, Frances Karttunen, Scott McIver, Allen Reinhard, and Lee Saperstein (3:15 pm); Charlie Polachi, Cemetery Administrator. It was determined by roll call that there was a quorum at all times; for reference, the correct Zoom link to join Cemetery Commission meetings is Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 1. Call to Order. Allen Reinhard called the meeting to order at 3:00 pm; a roll call established the listed attendance. The link to the video recording is https://www.youtube.com/watch?v=1XLj4BgMWl0&list=PL49sKqpy7VAhIyX1ozdd1bZ3zV8 kXFp8M&index=70. 2. Public and Commissioners’ Comments. To begin, Frances Karttunen asked if she might relate the reception received by the video film of Nantucket’s Historic Coloured Cemetery in Helsinki. When unanimous consent was given, she said that it was excellent. Her attendance at the Maple Leaf and Eagle Conference was the reason for the delay in this month’s meeting. She said that there was an enthusiastic response from a nearly filled room. The next presentation will be on Juneteenth (June 19) at the Roxbury International Film Festival. For the dedication of the monument to Absalo [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approval of the minutes of April 8, 2026
4 yea
Frances Karttunen yea · Allen Reinhard yea · Jascin Finger yea · Scott McIver yea
Wed May 27, 2026 · 13:30

Nantucket Housing Authority

Award mowing contract for 2026 season

The Nantucket Housing Authority will award a mowing contract for 2026 to the lowest responsible bidder. It will also discuss a Housing Nantucket covenant at 10B Evergreen Way and elect officers and committee representatives. Other business includes approving bills, minutes, and a Tom Nevers fee and hold harmless agreement.

housingcontractsmowingaffordable-housingelectionsfeescovenants
3 Manta Drive, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Housing Authority Day, Date, and Time Wednesday, May 27, 2026, 1:30 PM Location / Address 3 Manta Drive, Nantucket and or via hybrid remote participation Signature of Chair or Authorized Person Nancy Friend, Executive Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join: https://teams.microsoft.com/meet/27255114573802?p=CZIiccf9Je4naFZvAy Meeting ID: 272 551 145 738 02 Passcode: sL6Xi6ZB AGENDA Open Session 1. Call to order/roll call 2. Approval of Agenda 3. Housing Nantucket Covenant 10B Evergreen Way 4. Discussion with Housing Nantucket/ Covenant Program 5. Bill roll/Payroll Signing of Warrant April 2026 6. Bill roll/Payroll Signing of Warrant May 2026 7. Minutes of March 25, 2025 8. Award Mowing Contract for the 2026 season to lowest responsible bidder 9. Tom Nevers Fee for use/Hold Harmless Agreement 10. Annual Election NHA officers and NHA representative to the following c ommittees for a one-year term: Community Preservation, Affordable Housing Trust, Habitat for Humanity and Nantucket Planning and Economic Development Commission 11. Executive Direc [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 27, 2026 · 17:30

County Commission

County Commission to appoint representative to planning commission

The Nantucket County Commission will hold a regular meeting on May 27, 2026, including the election of officers, public comment, approval of minutes and warrants, and one item of official business: the appointment of a County Representative to the Nantucket Planning and Economic Development Commission for 2026-2027. The meeting will be held in person and via Zoom.

commissionappointmentsplanningeconomic-developmentpublic-commentwarrantsminutes
✓ Decided: County appoints Dawn Hill to Planning and Economic Development Commission

The commission elected Jill Vieth as Chair and Robert DeCosta as Vice Chair, each by unanimous support. Commissioners approved the April 29 minutes and May payroll warrants with a 3‑0 vote, two members abstaining. The board appointed Dawn Hill as the county representative to the Nantucket Planning and Economic Development Commission with unanimous approval. The meeting was adjourned by unanimous vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNTY COMMISSIONERS Day, Date, and Time WEDNESDAY, MAY 27, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/RZVYt15ZNUU ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_SsG1HCQHREO7FLQ8VLekuA I. CALL TO ORDER II. ELECTION OF OFFICERS III. ANNOUNCEMENTS 1. The County Commission Meeting is Being Audio and Video Recorded. IV. PUBLIC COMMENT* V. NEW BUSINESS** VI. APPROVAL OF MINUTES, WARRANTS AND PENDING CONTRACTS 1. Approval of Minutes of April 29, 2026 at 5:30 PM. 2. A pproval of Payroll and Treasury Warrants for May, 2026. VII. OFFICIAL BUSINESS 1. 2026- 2027 Appointment of County Representative to Nantucket Planning and Economic Development Commission. VIII. COMMISSIONERS REPORTS/COMMENTS 2 IX. ADJOURN [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
County Commission Minutes of the Meeting of May 27, 2026 at 5:30 PM Page 1 of 2 COUNTY COMMISSIONERS Minutes of the meeting of May 27, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Commission present were Robert DeCosta, Matt Fee, Dawn E. Hill, Brooke Mohr and Jill Vieth. I. CALL TO ORDER Ms. Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. ELECTION OF OFFICERS Ms. Hill opened nominations for Chair. Mr. DeCosta nominated Ms. Vieth as Chair; seconded by Ms. Mohr; all in favor to elect Ms. Vieth as Chair, so voted. Chair Vieth opened nominations for Vice Chair. Ms. Mohr nominated Mr. DeCosta as Vice Chair; seconded by Mr. Fee; all in favor to elect Mr. DeCosta as Vice Chair, so voted. III. ANNOUNCEMENTS 1. The County Commission Meeting is Being Audio and Video Recorded. IV. PUBLIC COMMENT There was no public comment. V. NEW BUSINESS There was no New Business. VI. APPROVAL OF MINUTES, WARRANTS AND PENDING CONTRACTS Mr. Fee moved to approve items VI. 1 – 2; seconded by Ms. Hill; so voted 3-0. Chair Vieth and Mr. DeCosta abstained. 1. Approval of Minutes of April 29, 2026 at 5:30 PM. 2. Approval of Payroll and Treasury Warrants for May, 2026. VII. OFFICIAL BUSINESS 1. 2026-2027 Appointment of County Representative to Nantucket Planning and Economic Development Commissio [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve items VI. 1 – 2 (Approval of Minutes of April 29, 2026 and Approval of Payroll and Treasury Warrants for May, 2026)
2 abstain
Vieth abstain · DeCosta abstain
Wed May 27, 2026 · 17:30

Select Board

Select Board to approve contracts and discuss town updates

The Select Board will approve minutes, payroll warrants, and pending contracts, including a $63,098 software license renewal and a $106,182.71 tennis facility maintenance lease. The meeting will also feature announcements on the Housing Production Plan, a public comment period, and reports on police enforcement and committee operations.

select-boardcontractsbudgethousingpublic-commentpoliceinfrastructure
✓ Decided: Select Board approved multiple contracts, warrants and a noise‑bylaw waiver

The Board approved payroll and treasury warrants for May 2026 and accepted pending contracts, including a DPW‑MassDOT road‑maintenance agreement and a tennis facility lease with a reservation‑system review. It also approved a feasibility study for a solar carport canopy, accepted two resignations, dedicated a Liberty Tree at 10 Surfside Road, and granted a noise‑bylaw waiver for concrete deliveries at 100 Wauwinet Road. All motions passed unanimously.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - AMENDED MEETING POSTING Original posting date: 5/22/2026 Original Posting # T 395 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MAY 27, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/RZVYt15ZNUU ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_SsG1HCQHREO7FLQ8VLekuA I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town Manager’s Monthly E-News Out Thursday, May 28 The Town Manager’s Monthly E-News will be out Thursday, May 28. Subscribe to Receive the Newsletter and Stay Connected with Town Communications, including Newsletters, Alerts and Updates at www.nantucket-ma.gov/stayconnected. 3. Housing Production [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 27, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of May 27, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Robert DeCosta, Matt Fee, Brooke Mohr and Jill Vieth. I. CALL TO ORDER Chair Hill called the meeting to order at 5:33 PM following a meeting of the County Commission. II. SELECT BOARD ACCEPTANCE OF AGENDA Chair Hill noted there is one additional announcement and one correction to the agenda. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town Manager’s Monthly E-News Out Thursday, May 28 The Town Manager’s Monthly E-News will be out Thursday, May 28. Subscribe to Receive the Newsletter and Stay Connected with Town Communications, including Newsletters, Alerts and Updates at www.nantucket-ma.gov/stayconnected. 3. Housing Production Plan Community Workshop The Housing Department and Affordable Housing Trust Invite the Community to the 2nd Housing Production Plan Workshop on Monday, June 1 from 4:30 to 6:00 PM at Nantucket High School Cafeteria. Remote Participation Also Available. More at www.nantucket-ma.gov/HPP. 4. Housing Production Plan Community Survey The [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 27, 2026 · 10:30

Affordable Housing Trust

Board will evaluate and recommend awards for Deed Restriction Pilot Program II proposals

The Affordable Housing Trust will review proposals submitted under the Year‑Round Deed Restriction Pilot Program II, including the submission from Steven and Claire Williams at 10 Arkansas Avenue. The committee will consider potential award recommendations for the program. The meeting also includes approval of the March 23, 2026 minutes, a public comment period, and routine agenda approval.

affordable-housingdeed-restrictionhousinggrantsevaluation
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Wednesday, May 27, 2026, at 10:30 AM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) The meeting will be aired at a later time on the Town’s Government TV You Tube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Kristie Ferrantella Municipal Housing Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR WEDNESDAY, MAY 27, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/87371479071?pwd=Z02y0lRxygJjX3i8saLGs6ibRCJpdc.1 Meeting ID 873 7147 9071 Passcode 484903 I. CALL TO ORDER, ROLL CALL II. ANNOUNCEMENTS 1. This meeting of the Evaluation Committee for the Year-Round Deed Restriction Pilot Program II is Beig Audio and Video Recorded. III. APPROVAL OF AGENDA IV. PUBLIC COMMENT* V. APPROVAL OF MINUTES 1. Approval of Minutes of Ma [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 26, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review golf courses, property projects, and approve minutes

The Nantucket Islands Land Bank Commission will convene to review monthly reports for Sconset and Miacomet golf courses, update on property management projects including the Francis/Washington Street Beach Improvement, and approve the minutes from the May 12, 2026 meeting. The meeting will also include a warrant authorization for cash disbursements and property use requests.

golfproperty-managementbeach-improvementminutesfinanceland-bank
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, May 26, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/86914843660?pwd=O4qHy9EZVUmFaI6eRMYyVw9GBa5t01.1  Webinar ID: 869 1484 3660  Passcode: 668480    Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. GOLF BUSINESS a. Sconset Golf Course – Monthly Review b. Miacomet Golf Course – Monthly Review c. Warrant Authorization – Golf Capital Funds Transfer Request 4. PROPERTY MANAGEMENT a. Francis/Washington Street Beach Improvement – Washington Street Workgroup Plan Review b. 41 Je [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 26, 2026 · 09:00

Sign Advisory Council (HDC)

Council to discuss HDC color website representation, review 9 sign applications

The Sign Advisory Council (HDC) will hold a public comment period and respond to prior public comment regarding the representation of HDC approvable colors on the website and scanned color samples/swatches. The council will also consider nine sign applications, including projecting signs and quarter board signs at locations such as 46 Center St, 27 Fairgrounds Rd, 19 Washington St, 44 Center St, and multiple signs at 110/90 Eel Point. Other business includes adoption of agenda, approval of minutes, and scheduling of next meeting.

historic-districtsignspublic-hearingnantucketzoningcolorswebsite
✓ Decided: Council denied the quarter‑board sign at 110 Eel Point (4‑1 vote)

The Sign Advisory Council reviewed nine sign applications. It approved relocations and design changes for EMMA LLC, 27 Fairgrounds LLC, 44 Centre St Holdings, and Michael Cotton. It denied two quarter‑board signs for Linda Loring Nat. Found at 110 Eel Point and one at 90 Eel Point, and held three other Linda Loring applications for revisions. All motions were voted on as recorded.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, May 26, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC SAC Minutes May 26, 2026; adopted 6-2-2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday May 26, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Kevin Kuester, Mark Cutone Absent members: none. Late arrivals: Mark Cutone at 10:06am Early Departures: none. Motion to adopt agenda made by Wolf; seconded by Kuester. Vote: Carried unanimously. Approval of Minutes: 5/19/2026 minutes made by Kuester; seconded by Wolf. Vote: Carried unanimously. II. Public Comment -none III. Response to Public Comment of the 5/19/26 meeting. Staff informed the Council members that the HDC approved colors have been added to the HDC webpage. The Commission is hoping to have an Organizational Meeting in the near future to broaden the selection. Explanation of how the HDC/SAC handles color sample scans and swatches was briefly discussed. IV. Commissioner Comments- none Approved HDC SAC minutes 5/26/26; adopted 6/2/2026 Signs 1. EMMA LLC 14640 46 Center St OB- Sign Rev 42.3.1/2 Sign Here Nantucket Discussion: Wolf- questioned the placement Normand- appreciates revised color. Recommends placing right side of window near the corner board. Kuester- no concerns. Cutone- no concerns-agrees with Normand- Young- agrees. Motion to recommend app [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
deny Linda Loring Nat Found 14381 110 Eel Point OB- Quarter board sign #1 32/33 Kelly Emery as it does not meet the guidelines
1 nay
Wolf nay
Tue May 26, 2026 · 10:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee meeting cancelled

This meeting of the Nantucket Coastal Resilience Advisory Committee, scheduled for May 26, 2026, has been cancelled. No items were discussed or decided.

cancelledcoastal-resiliencenantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, May 26, 2026 at 10:00 a.m. Location / Address Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Tue May 26, 2026 · 16:00

Historic District Commission

HDC to consider new harbormaster building, dozens of property alterations

The Historic District Commission will vote on over 60 applications for consents, signs, and new business items, including a new harbormaster building at 34 Washington Street and multiple new dwellings. Commissioners will also discuss future policy topics such as hardscaping and demolition review. Several items are held for revisions or denied based on guidelines.

historic-districtnew-constructionsignssolarharbormasternantucketpublic-hearing
✓ Decided: Commission approved Wade Cottages pool‑patio with visibility limits (4‑1)

The Historic District Commission approved a series of consents with conditions, sign requests, and new‑business projects at its May 26, 2026 meeting. Notable approvals included a 3‑2 vote for a Liberty Ladies fence, a 4‑1 vote to allow a pool‑patio at the historic Wade Cottages with visibility restrictions, and unanimous approval of a new dwelling at Far East Nantucket. The commission denied one quarter‑board sign for the Linda Loring National Foundation and held the David Folger window‑replacement application for additional information.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAY 21 PM 01:53 Original Posting Number: T 390 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday May 26, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_uAO7gD2YRU-0RABxf7OXhQ#/registration To watch live feed, click here: https://www.youtube.com/live/PBJ6erEf4aA Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, cli [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes May 26, 2026; adopted June 09, 2026 HISTORIC DISTRICT COMISSION Minutes May 26, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson In person: Welch, Pohl, MacLeod, Oliver, Patten and Camp Zoom: Paul Meeting called to order at 4:06 pm by Stephen Welch Board: Welch, Pohl, MacLeod, Oliver and Camp Pohl made the motion to approve the agenda Motion carries unanimously Pohl left the meeting at 7:00 pm I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. NRTA 14701 91 Goldfinch Dr Add window wells 68/579 Val Oliver Design CT 2. Casey Amy 14704 17 Chuck Holoow Rd Cabana 75/1 Normand Residential CT 3. Jennie Greene 14746 35 Shell St Sias Demo Shed 73.1.3/5.6 Alison MacDonald VO 4. C Thayer 14738 13 Kittiwake Shed 68/646 LINK VO 5. Greg Raith 14743 5 Sheep Commons Rev Garage Studio 54/278 LFW VO 6. J Strasburg & Toby Tr 14741 1 Olivers Wy New Dwelling 49/166.1 K Megna VO 7. Krieger, Fred 14691 2 Towaddy Ln Dormer 73.4.1/46 Normand Residential AC 8. Jeff Ment 14692 18 Gardner Rd Fenestration Changes 43/135 Structures Unlimited LTD AC 9. Ringer Randolph 14696 3 Chuck Hollow Rd Rev. 14026; bulkhead/winds 72/36 Chuck Lenhart AC 10. Dan Platt 14697 26 N Cambr [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 21, 2026 · 17:00

Conservation Commission

Public hearing on Polpis Harbor dredging, multiple land bank projects

The Nantucket Conservation Commission will hold public hearings and meetings on several Notices of Intent and Orders of Conditions, including the Town's Polpis Harbor & Hither Creek Dredging Plan and multiple projects by the Nantucket Islands Land Bank. The commission will also consider enforcement actions for properties on Madaket Road, Baxter Road, and Grove Lane. The meeting includes approval of minutes and staff reports.

conservationwetlandsdredgingland-bankpublic-hearingenforcementnantucket
✓ Decided: Commission issued Orders of Conditions for four development sites

The Conservation Commission accepted its agenda and then approved Orders of Conditions (AOOC) for Lienhard at 11 Jonathan Way, Nantucket Islands Land Bank at 2 Milestone Road & 174 Orange Street, Nantucket Islands Land Bank at 231 Polpis Road, and Luxury Brands, Inc. at 100 Low Beach Road. It also closed the hearings for SE48‑3217, SE48‑3800, SE48‑3540, and SE48‑3562. All votes were unanimous among present members.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 APR 13 AM 10:04 Original Posting Number: T 272 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, May 21, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://youtube.com/live/ority6IKFlM Zoom Registration: https://us06web.zoom.us/webinar/register/WN_tI_62Q2vQWGMTMaLQ0iDkQ Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for May 21, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register a [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes May 21, 2026, adopted June 4, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, May 21, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/ority6IKFlM Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Schafer, Turcotte, Plandowski and Williams Absent Members: Braine Members Left Early: Schafer left at 6:08pm I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:34) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Williams) (Seconded by: Misurelli) Vote: Vote Carried: 6:0: Engelbourg, Misurelli, Plandowski, Schafer, Turcotte, and Williams (aye) III. Announcements Discussion: (00:02:22) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:02:52) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:03:06) Emily Molden, Nantucket Land & Water Council Molden - It’s been about 5 months since the damage was done to the geotubes and probably close to a year since any mitigati [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
accept the agenda
6 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
close (Diane V. Elliot 2022 Revocable Trust- 28 Lily Street)
6 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
close SE48-3217, SE48-3800, & SE48-3540
6 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
close SE48-3562
5 yea · 1 abstain
Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea · Engelbourg abstain
close (Lienhard- 11 Jonathan Way)
6 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
Thu May 21, 2026 · 16:00

Board of Health

Board of Health continues hearings on watershed and wellhead district amendments

The Nantucket Board of Health will continue public hearings on amendments to the Hummock Pond Watershed Regulation (Chapter 288) and the Wellhead Protection District Regulation (Chapter 382). They will also hear an appeal of an order to connect to town sewer at 49 Polpis Road, continued from October 2025. Additional items include a septic loan request for 8 Creek Lane, updates on the Vito Capizo Stadium renovation pre-testing agreement (no votes), and introduction of a correction letter for noncompliant short-term rental owners.

board-of-healthwatershedwellhead-protectionsepticsewershort-term-rentalspublic-hearingsnantucket
✓ Decided: Board adopts housing variance amendment adding “attainable” to Hummock Pond regulation

The Board approved an amendment to the Hummock Pond Watershed Regulation, adding the word “attainable” alongside “affordable” in Section 288-7 (vote 4-1). A similar amendment was adopted for the Wellhead Protection District Regulation, also adding “attainable” in Section 382-7 (vote 4-1). The Board approved a short‑term rental correction letter template for non‑compliant owners (vote 5-0) and approved a loan for the 8 Creek Lane property at half the requested amount (vote 5-0).

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, May 21, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/pHSrLWlXu5k Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_1NwrzQWGR8-rYy6HHKLDLA AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Approval of minutes (2/19/2026, 3/2/2026, 3/16//2026, 3/19/2026, 4/7/2026, 4/16/2026) 4. Director’s Updates 5. Environmental Contamination Administrator update 6. 8 Creek Lane-Septic Loan Request for property located in Madaket Harbor Watershed 7. Continuation of Public Hearing: Chapter [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH May 21, 2026 Adopted June 18, 2026 BOARD OF HEALTH ~~ MINUTES ~~ Thursday, May 21, 2026 Meeting PSF Community Room, 4 Fairgrounds Road, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:00 p.m. Staff in attendance: Jerico Mele, Deputy Director of Health and Human Services, John Hedden, Chief Environmental Health Officer Remote Staff: Roque Miramontes, Director of Public Health; Andrew Shapero, Environmental Contamination Administrator, Tomeka Gary, Public Health Coordinator; Alex Weisheit, KP Law Members attending: Ann Smith (chair), Meredith Lepore, James Cooper, Matt Fee Remote Members: Kerry McKenna, Public Participant: Kim Latlip, Meg Ruley, Willa Arsenault (Nantucket Land and Water Council), Dylan Metsch-Ampel (Deputy Housing Director) Arthur Reade (Attorney), Melissa Devitt (Asst. Superintendent of Schools) I. PUBLIC ANNOUNCEMENT II. PUBLIC COMMENT Discussion: • Kim Latlip raised concerns about public trust, saying the vice chair stated at town meeting that the Nobadeer turf field had never been cleaned — the town issued a public clarification the next day confirming the field has been professionally maintained under contract for 3 years • Kim Latlip noted the vice chair had submitted a public records request on November 30th, 2025, seeking maintenance and hardness testing records for the Nobadeer turf, received responsive records on December 16th, 2025. • Kim [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
adopt this new amendment to the regulation with one amendment: "attainable" added alongside "affordable" in Section 288-7 (Special Variance)
4 yea · 1 nay
Smith yea · Lepore yea · McKenna yea · Fee yea · Cooper nay
The other 3 items passed by unanimous or near-unanimous consent.
Thu May 21, 2026 · 15:00

Nantucket High School Council

School Council to discuss budget, staffing, and end-of-year activities

The Nantucket High School Council will meet to review budget updates, discuss staffing for the 2026-2027 school year, and plan end-of-year activities. The agenda also includes a guest speaker for seniors and upcoming SOS training. No votes or specific dollar amounts are listed.

schoolcouncilbudgetstaffingseniorsend-of-yeartraining
10 Surfside Road , NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Nantucket High School School Council Meeting May 21, 2026 3:00 p.m. Location: High School Conference Room ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ When people ask, “What do you do?” Answer: “Whatever it takes.” Competeeveryday.com ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ Potential Attendees: Brent Tartemella, Kristen Dussault, Meghan Washington, Pauline Cronin, Jess Douglas, Dalena Garcia Sosa, Jenn Psaradelis, Tracy Mailloux, Mandy Hilemn Time Minutes Activity Next Steps 3:00 5 Celebrations 3:05 5 Budget Update 3:10 10 Staffing for the 2026-2027 school year 3:20 10 Guest Speaker for Seniors 3:30 10 Upcoming SOS Training 3:40 15 End of the Year Activities / Closing the school year 3:55 5 Closing comments / questions We are not a team because we work together. We are a team because we respect, trust, and care for each other. Abigail Johnson
Thu May 21, 2026 · 13:00

Cannabis Advisory Committee

Cannabis Advisory Committee to discuss social consumption and DEA rescheduling

The Cannabis Advisory Committee will discuss the potential for social consumption on Nantucket and the DEA's rescheduling of cannabis from Schedule I to Schedule III. The body will also review cannabis reform legislation signed by Governor Healey and ACK Natural deliveries.

cannabisdrug-policypublic-healthregulation
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Cannabis Advisory Committee (CAC) Day, Date, and Time Thursday May 21, 2026, 1:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Barry Rector WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Board Members: Barry G. Rector (Chair), Abby DeMolina (Vice-Chair), Joe Plandowski (Secretary), Dawn Hill, Jacques Zimicki Join Zoom Meeting https://us06web.zoom.us/j/84056571521?pwd=TzVQMVZXdkV6SGt6MmpmTFM5dm9rZz09 Meeting ID: 840 5657 1521 Find your local number: https://us06web.zoom.us/u/kZpvpnBWV One tap mobile +13092053325,,88677055726#,,,,*027151# US Dial by your location +1 309 205 3325 US +1 646 558 8656 US (New York) +1 301 715 8592 US (Washington DC) 2 AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. I. Call to Order II. Acceptance of Agenda III. Announcements a. The Cannabis Advisory Committee Me [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 21, 2026 · 15:00

Cyrus Peirce Middle School

FY27 planning for the school district

The CPS School Council will review and approve the minutes from the April 19, 2026 meeting. It will also discuss year‑end events, plan for fiscal year 2027, consider upcoming elections, and hold a parent Q&A session.

educationbudgetelectionscommunityschool-council
10 Surfside Road, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
RECEIVED _) MEETING POSTING | navvueccr town creek Posting Number:T 377 TOWN OF NANTUCKET Y Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPS School Council Meeting Day, Date, and Time 3:00pm Thursday, May 21, 2026 Location / Address c/o Nantucket Public Schools Nantucket High School 10 Surfside Road NANTUCKET, MA 02554 CPS Cafeteria Signature of Chair or . Authorized Person ZEA Ake WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 1) Review and approval of 3/19/26 Minutes (April meeting canceled) 2) Year-end Events 3) FY27 Planning 4) Elections? (current terms end 2027 except S Ray 2028) 5) Parent Q&A
Thu May 21, 2026 · 11:00

Procurement Review Committee

Committee to review proposals for Jetties Tennis Facility lease

The Procurement Review Committee will meet to review proposals for the lease of the Jetties Tennis Facility and discuss awarding the lease.

tennisprocurementleaserentalcommitteezoomnantucket
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Jetties Tennis Facility Lease RFP Review Committee Day, Date, and Time Thursday, May 21, 2026 @ 11:00 am Location / Address REMOTE PARTICIPATION VIA ZOOM ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Gregg Tivnan WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82666960069?pwd=o14TtNrtRu2SYmaiWf12KLNa6KE3bA.1 Meeting ID: 826 6696 0069 Passcode: 270979 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review of Proposals for the Lease of Jetties Tennis Facility *Hoskins Burney Inc. d/b/a The Tennis Loft 6. Discussion by Evaluation Committee on the Proposal Received 7. Recommendation for Award of Lease for the Jetties Tennis Facility 8. Adjournment 2
Thu May 21, 2026 · 17:00

Parks and Recreation Commission

Parks and Recreation Commission to review beach projects and events

The Commission will discuss updates on the Nobadeer Project and Phase 1 of the Tom Nevers debris removal. The meeting also includes a report on culture and tourism regarding a scheduled school band concert.

parks-and-recreationbeachestourismpublic-events
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday, May 21, at 5:00 p.m. Location / Address REMOTE PARTICIPATION ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW.1 Meeting ID: 817 4815 2269 Passcode: 983395 Nantucket Parks and Recreation Commission Meeting Notice and Agenda Thursday, May 21 2026 Meeting to be held at 5:00 p.m. Remotely Via Zoom. 1. Call to Order 2. Reminder this meeting is being audio and video recorded 4. Approval of Agenda for May 21, 2026 5. Public Comment 6. Approval of Minutes from April 23 2026 2 7. Culture and Tourism: Deana Weatherly -Cultural Affairs and Special Events Coordinator • NPS School Band Concert Childrens beach 6/9/2026 8 Charlie Polachi- Parks and Recreation Manage [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 20, 2026 · 15:00

Nantucket Public School Committee

School Committee to hold collective bargaining session with teachers

The Nantucket School Committee Negotiation Subcommittee will meet in executive session. The purpose of the meeting is to conduct a collective bargaining session with the Nantucket Teachers Association.

educationlabor-relationscollective-bargainingschool-committee
30 Surfside Road, NIS Cafeteria
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Wednesday, May 20, 2026, 3:00 PM Location / Address HYBRID https://zoom.us/j/96429920526 Nantucket Intermediate School, Cafeteria 30 Surfside Road Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session and not return to open session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Wed May 20, 2026 · 15:00

Tree Advisory Committee

Tree Committee discusses emerald ash borer, Liberty Tree, street trees

The Nantucket Tree Advisory Committee will meet to receive updates on the Liberty Tree, sugar maples at 7 Pleasant St., West Creek elms, and the emerald ash borer. New business includes discussion of English oaks at 4 Easy St. The committee will also take public comment.

treesemerald-ash-borernantucketpublic-worksstreet-trees
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING T OWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time WEDNESDAY, May 20, 2026, AT 3:00PM Location / Address DPW CONFERENCE OR REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance I I. COMMITTEE ACCEPTANCE OF AGENDA I II. COMMITTEE APPROVAL OF MINUTES I V. ANNOUNCEMENTS V. P UBLIC COMMENT /DISCUSSION VI. C ITIZEN/DEPARTMENTAL REQUESTS VI I. OLD BUSINESS - Liberty Tree Update (Mary) - 7 pleasant St.- Sugar Maples (Dale) - W.Creek Elms Update - Emerald Ash Borer Update (Dale) 2 VIII. NEW BUSINESS - 4 Easy St.- English Oaks
Wed May 20, 2026 · 17:30

Select Board

Select Board will appoint a candidate to fill one Planning Board vacancy

The Select Board will consider and vote on a candidate for a single Planning Board opening, following the town's appointment policy. The meeting will also approve minutes from May 13 and May 14, approve treasury warrants, and hear public comments and updates on various town matters.

appointmentsminutesbudgetenergyaccessibility
✓ Decided: Select Board appoints Liza Hatton to Planning Board vacancy

The Board appointed Liza Hatton to fill the Planning Board vacancy until the 2027 election. It approved the minutes of the May 13 and May 14 meetings and the Treasury warrants for May 20. The Board approved an accessible parking space at 8 New Street and denied a fee waiver for a third parking permit. No new business was presented.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MAY 20, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/3buql-h8eYM ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_OU4VedBPQLeGv3NoY7_1iw I. CALL TO ORDER II. ELECTION OF OFFICERS III. SELECT BOARD ACCEPTANCE OF AGENDA IV. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Memorial Day Ceremony to be Held Sunday, May 24, 2026 at 1:00 PM at Prospect Hill Cemetery. 3. Announce Applications Received (per Select Board Committee Appointment Policy) for 2026 Annual Appointments: Agricultural Commission, Airport Commission, Board of Health, Cannabis Advisory Committee, Capital Program Committee, Cemetery Commi [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 20, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of May 20, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Robert DeCosta, Matt Fee, Brooke Mohr and Jill Vieth. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance, and welcomed Mr. DeCosta and Ms. Vieth as newly elected Select Board members, who were sworn in this morning. II. ELECTION OF OFFICERS Chair Hill opened nominations for Chair. Ms. Vieth nominated Ms. Hill as Chair; seconded by Mr. DeCosta; all in favor to elect Ms. Hill as Chair, so voted. Chair Hill opened nominations for Vice Chair. Ms. Vieth nominated Ms. Mohr as Vice Chair; seconded by Mr. DeCosta; all in favor to elect Ms. Mohr as Vice Chair, so voted. III. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. IV. ANNOUNCEMENTS Deputy Town Manager Rick Sears and Operations Administrator Erika Mooney reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Memorial Day Ceremony to be Held Sunday, May 24, 2026 at 1:00 PM at Prospect Hill Cemetery. 3. Announce Applications Received (per Select Board Committee Appointment Policy) for 2026 Annual Appointments: Agricultural Commission, Airport C [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Appointment to one (1) Planning Board Vacancy
4 yea · 1 nay
Hill yea · DeCosta yea · Fee nay · Mohr yea · Vieth yea
The other 1 item passed by unanimous or near-unanimous consent.
Wed May 20, 2026 · 17:30

Planning Board

Planning Board and Select Board to vote on vacancy appointment

The Planning Board will hold a joint meeting with the Select Board. The boards will introduce candidates for one Planning Board vacancy and vote on an appointment.

appointmentsplanning-boardselect-boardgovernance
✓ Decided: Liza Hatton appointed to Planning Board vacancy

The Planning Board and Select Board jointly appointed Liza Hatton to fill the Planning Board vacancy. She received eight votes. Her appointment lasts until the 2027 Annual Town Election, after which the seat will be filled by election for the remainder of the term through 2030.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s PLANNING BOARD Day, Date, and Time WEDNESDAY, MAY 20, 2026 AT 5:30PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person MEGAN TRUDEL, DEPUTY DIRECTOR OF PLANNING WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/3buql-h8eYM ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_OU4VedBPQLeGv3NoY7_1iw I. Call to Order II. Joint Meeting with Select Board to Introduce Candidates for One (1) Planning Board Vacancy Pursuant to Select Board Committee Appointment Policy; Joint Select Board – Planning Board Vote on Appointment. III. Adjournment - 2 -
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
- 1 - PLANNING BOARD APPROVED MINUTES OF 05-20-2026 *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, and Brian Burgeson Alternates: Stephen Welch, Howard Matz, and Abby De Molina Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist) and Catherine Ancero (PLUS Administrative Specialist) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ PLANNING BOARD JOINT MEETING WITH SELECT BOARD I. Call to Order: Chair Iverson called the meeting to order at 5:46PM. II. Joint Meeting with Select Board to Introduce Candidates for One (1) Planning Board Vacancy Pursuant to Select Board Committee Appointment Policy; Joint Select Board – Planning Board Vote on Appointment: Operations Administrator Erka Mooney reviewed the statutory process for filling the Planning Board vacancy pursuant to MGL Ch. 41, Section 81A. Ms. Mooney explained that the appointment would run until the 2027 Annual Town Election, at which time the posit ion would be filled by election for the remainder of the unexpired term through 2030. Ms. Mooney announced that three candidates had submitted applications: Liza Hatton, Clay Evans and Campbell Sutton. Each candidate was provided with an opportunity to introduce themselves and speak in support of their application. Members of the Select Board and Planning Board then cast ballots, [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
Appointment to fill the Planning Board vacancy
8 yea · 1 nay
Hill yea · DeCosta yea · Fee nay · Mohr yea · Veith yea · Iverson yea · Brian Borgeson yea · Lowell yea · Topham yea
Wed May 20, 2026 · 10:00

Select Board

Select Board to hold swearing-in ceremony

The Select Board will meet to conduct a swearing-in ceremony for officials elected during the May 19, 2026 annual town election.

electiongovernmentswearing-in
✓ Decided: Select Board adjourned the meeting unanimously

The board swore in newly elected members Robert DeCosta and Jill Vieth. A motion to adjourn was made, seconded, and approved by all members. No other substantive actions were taken.

16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MAY 20, 2026, 10:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM, 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/70dER4WX94I I. CALL TO ORDER II. SWEARING-IN CEREMONY FROM MAY 19, 2026 ANNUAL TOWN ELECTION III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 20, 2026 at 10:00 AM Page 1 of 2 SELECT BOARD Minutes of the Meeting of May 20, 2025. The meeting took place in the Town Building Conference Room, 16 Broad Street, Nantucket, MA 02554. Select Board Members present were Dawn E. Hill, Matt Fee and Brooke Mohr. I. CALL TO ORDER Chair Hill called the meeting to order at 10:00 AM. II. SWEARING-IN CEREMONY FROM MAY 19, 2026 ANNUAL TOWN ELECTION. Town Clerk Nancy Holmes administered the oath of office to Select Board-elect Robert DeCosta and Select Board-elect Jill Vieth as Select Board members. III. ADJOURNMENT Mr. DeCosta moved adjournment at 10:03 AM; seconded by Ms. Vieth; all in favor, so voted. Approved the 27 th day of May 2026. Select Board Minutes of the Meeting of May 20, 2026 at 10:00 AM Page 2 of 2 SELECT BOARD MAY 20, 2026 – 10:00 AM TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET NANTUCKET, MASSACHUSETTS List of documents used at the meeting: None.
Tue May 19, 2026 · 16:00

Historic District Commission

HDC to consider new hotel building at 30 N. Beach St and several sign applications

This meeting of the Historic District Commission will address multiple old business items, including a new hotel building at 30 North Beach Street, new dwellings, pool and hardscape projects, and several sign applications. Commissioners will also vote on an amended motion regarding a sign at 46 Center St and approve minutes.

historic-district-commissionold-businesssignsnew-constructionhotelpoolhardscapenantucket
✓ Decided: Historic District Commission approved multiple sign and property permits, most unanimously

The commission approved a consent for Frank Hanlon’s Fairgrounds Road project and added a historic condition to Sylvia Griggs’s Magnolia Avenue deck addition. Several sign applications were approved, some with size or color changes, while one wall sign was held for revisions. A number of property improvements, including pool‑hardscape projects on Cato Lane and several Greco Qual. developments, were approved, with one garage approval passing 4‑1.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAY 15 PM 02:04 Original Posting Number: T 371 Original Posting Time: 2026 MAY 18 AM 11:02 Original Posting Number: T 375 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, May 19, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_Q0w2PN9RQ4-MSJw9TFMQ9w#/registration To watch live feed, click here: https://www.youtube.com/live/owKQTyFaGYc Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes 05/19/2026; adopted 6/09/2026 HISTORIC DISTRICT COMISSION Minutes May 19, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson In person: Welch, Pohl, MacLeod, Patten and Camp Oliver arrived to the meeting at 4:42PM Zoom: Paul Absent: Thornewill Holly Backus left the meeting at 5:15PM Camp left at 6:53PM Meeting called to order at 4:01 pm by Stephen Welch Board: Welch, Pohl, Camp, MacLeod and Patten Pohl made the motion to approve the agenda Motion carries unanimously I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Frank Hanlon 14668 64 Fairgrounds Rd Move on from 44 Nonantum 67/492 Self VO • Board: Welch, Pohl, Camp, MacLeod and Patten; Alternates: Paul • Pohl made the motion to approve the consent • Motion carries unanimously II. CONSENT WITH CONDITIONS Property owner name Street Address Scope of work Map/Parcel Agent 1. Sylvia R. Griggs 14610 2 Magnolia Av Addition to deck 73.3.1/55 David Cokonis VO • Board: Pohl, Camp, MacLeod and Patten; Alternates: Paul; Recused: Welch • Camp made the motion to approved adding the historical information to the COA • Motion carries unanimously II. COMMISSIONER Q & A WITH PRESERVATION PLANNER [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve previous submission of garage (Greco Qual. Pers. Res. Tr 13595 7 Maxey Pond Rd)
1 nay
Camp nay
Tue May 19, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review four sign applications including Bloom Bar and Nantucket Saves

The Sign Advisory Council will consider four sign applications: a projecting sign for Bloom Bar at 9 S. Water St, projecting and wall signs at 1 Cambridge St, a temporary sign for Nantucket Saves at various locations, and a temporary thermometer sign at Sparks Ave Rotary. The council will also approve minutes from previous meetings and hear public comment.

signshistoric-districtnantucketpublic-hearing
✓ Decided: Council approved multiple signage projects, including 12 temporary signs

The Sign Advisory Council unanimously approved several sign applications, including a Bloom Bar sign with a 24" x 32" size and muted yellow border, a projecting sign at 1 Cambridge St, and 12 temporary signs for various locations. The council also approved a temporary thermometer sign for the Sparks Ave rotary. One quarter‑board sign application was held for revisions. All decisions were adopted without dissent.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, May 19, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC SAC Minutes May 19, 2026; adopted 5/26/2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday May 19, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Kevin Kuester, Mark Cutone Absent members: none. Late arrivals: Cutone at 9:06am Early Departures: none. Motion to adopt agenda made by Wolf; seconded by Normand. Vote: Carried unanimously. Approval of Minutes: 4/28/26 and 5/12/2026 minutes made by Kuester; seconded by Normand. Vote: Carried unanimously. II. Public Comment- Marsha Fader commented on difficulty finding HDC approvable colors and replicating colors digitally. III. Commissioner Comments- Young- Master Sign Plan should be part of the process. It would be helpful, down the road, to have a record by address. Cutone- a future suggestion for consideration is for newly constructed multi-tenant buildings reviewed by the HDC, the Master Sign Plan should be a part of the application. HDC Sign Advisory Council minutes 5/19/26; adopted 5/26/26 New Business 1. FC Mac Corp 14652 9 S. Water St Projecting sign- Bloom Bar 42.3.1/131 Cara Marquis Discussion: Young- double the size of the guidelines on the application- should be 24” x 32” Normand- should be high enough so pedestrians do not hit their head. Font unusual. Wol [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026 · 18:00

Nantucket Public School Committee

School Committee to review DESE accountability scores and FY2025 audit

The Nantucket School Committee meets to hear presentations on student enrollment, staffing updates, transportation, special services, the FY2025 end-of-year audit, and 2025 DESE accountability scores. The committee will also vote on several policy removals and donations, including $1,800 for mental health awareness and $4,000 for a Galapagos field trip.

educationschool-committeebudgetdonationspolicyspecial-educationdese-scores
10 Surfside Road, Nantucket High School, LGI, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, May 19, 2026, 6:00 PM Location / Address HYBRID - Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road · Nantucket, MA 02544 https://zoom.us/webinar/register/WN_6y-uL2rOSfKrLhrz7isGvg Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA To virtually attend the meeting, register using the Zoom Webinar link below: https://zoom.us/webinar/register/WN_6y-uL2rOSfKrLhrz7isGvg To watch meeting live, click here: https://youtube.com/live/zr9OVZ8EO9g I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. Student Enrollment b. 2026/2027 Hiring and Staffing Updates c. Transportation Update d. Additional Updates VI. Presentations and discussions of issues to the Committee a. Special Education Advisory Council (ACK-SEPAC), Laura Steele & Suzanne Fronzuto - Co-Chairs b. Special Services Update - Dr. Debra Gately, Executive Director of Special Services c. FY2025 End-of-Year [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026 · 12:30

Affordable Housing Trust

Trust will vote on real‑property deals at Dooley Court, Old South Road, Woodland Drive

The Affordable Housing Trust will review and vote on several real‑property transactions in an executive session, including potential purchase, exchange, lease, or valuation of properties at 7 Dooley Court, 27 Old South Road, and 13 Woodland Drive. The open portion of the meeting will also consider updates to the Housing Production Plan, approve two Closing Cost Assistance Program applications, and adopt minutes from prior meetings.

affordable-housingreal-estateexecutive-sessionclosing-cost-assistancehousing-production-plan
✓ Decided: Trust approved a Request for Information for 71 Surfside Road

The Affordable Housing Trust approved a Request for Information to attract developers for the 71 Surfside Road property. It also approved $15,000 closing‑cost loans for applications at 7A Waitt Drive and 45A Beach Grass Road, and authorized mortgage discharge and subordination agreements for existing loans. Minutes from prior meetings were approved and the next meetings were scheduled.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, May 19, 2026, at 12:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, MAY 19, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89243722122?pwd=q3T4GrZVBtz4GUbOxWUJu68vfEqoNK.1 Meeting ID: 892 4372 2122 Passcode: 461305 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Town of Nantucket Housing Department and Barrett Planning Group LLC are hosting the second community -wide Housing Workshop for the Nantucket Housing Production Plan (HPP) and are seeking your part [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on May 19, 2026, at 12:30 PM Approved the 2nd day of June 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, May 19, 2026 Remote Meeting via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice- Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Penny Dey, Brooke Mohr, Mary Mack, Forest Bell, and Shantaw Bloise Murphy. Staff members present were Kristie Ferrantella (Housing Director), Dylan Metsch-Ampel (Deputy Housing Director) , Caroline Ferguson (Administrative Specialist) , Vicki Marsh (Town Counsel), Eric Barth (Town Counsel) Keelin Ciccariello (Town Counsel), Susan Carmel (Deputy Finance Director), Melina Ernst-Fournier (Deputy Finance Director and Treasurer), and Tracy MacDonald (Real Estate Specialist). Speaker(s) present was Tony Duong (Barrett Planning LLC). All votes were taken by roll call. I. CALL TO ORDER Vice-Chair Dey called the meeting to order at 12:32 PM. II. ACCEPTANCE OF AGENDA Ms. Mack made a MOTION to approve the agenda. Ms. Mohr seconded the motion; by roll call vote: Forest Bell – Aye; Mary Mack – Aye; Brooke Mohr – Aye; Penny Dey – Aye; so voted. Shantaw Bloise-Murphy joined the meeting at 12:34pm. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Town of Nantucket Housing Department and Barrett Planning Group LLC are hosting the second community-wide H [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
4 yea
Forest Bell yea · Mary Mack yea · Brooke Mohr yea · Penny Dey yea
approve the open session minutes of April 7, 2026, April 21, 2026, April 28, 2026, and May 8, 2026
5 yea
Forest Bell yea · Mary Mack yea · Brooke Mohr yea · Shantaw Bloise-Murphy yea · Penny Dey yea
Approve Ms. Wu’s application and award up to $15,000 as a loan for closing cost assistance at 7A Waitt Drive and any unused funds returned to the Trust
5 yea
Forest Bell yea · Mary Mack yea · Shantaw Bloise- Murphy yea · Brooke Mohr yea · Penny Dey yea
Approve the Blake’s application and award up to $15,000 as a loan for closing cost assistance at 45A Beach Grass Road and any unused funds returned to the Trust
5 yea
Mary Mack yea · Shantaw Bloise- Murphy yea · Forest Bell yea · Brooke Mohr yea · Penny Dey yea
approve the Request for Information for 71 Surfside Road
5 yea
Brooke Mohr yea · Forest Bell yea · Shantaw Bloise-Murphy yea · Mary Mack yea · Penny Dey yea
Tue May 19, 2026 · 08:30

Airport Commission, Nantucket Memorial

Aviation Fuel Subcommittee discusses fuel supply and logistics

The Nantucket Memorial Airport Commission's Aviation Fuel Subcommittee will discuss multiple aspects of aviation fuel operations, including Steamship Authority reservations, alternate boat options, personnel updates, and a fuel farm consultant. The committee will also review expanded fuel farm issues, converting non-fuel purchasers, and specifications for a fuel supply RFP. No votes or decisions are listed; the meeting is limited to discussion and potential future action.

airportaviation-fuelferry-servicefuel-farmprocurementpersonnelpublic-meeting
✓ Decided: Agenda adopted and public hearing on fuel storage amendment set for June 3

Commissioners adopted the meeting agenda without objection. The subcommittee scheduled a public hearing for June 3 to consider an amendment to the bulk‑storage license that will include tanker trucks and propane storage. A draft letter of support for Robert B. Our’s proposed New Bedford boat route was prepared and is under final review. No other formal actions were taken.

14 Airport Road, Administration Building
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission – Aviation Fuel Subcommittee Day, Date, and Time Tuesday, May 19, 2026 at 8:30 AM Location / Address This meeting will be held In-Person at 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Tuesday, May 19, 2026, at 8:30 AM 1. Call to Order 2. Review and Approve: a. Agenda b. 04/13/26 Draft Minutes 3. 051926-01 – Discussions Regarding Aviation Fuel: a. SSA Reservations b. Alternate Boat Options c. Personnel Update d. Fuel Farm Consultant e. Expanded Fuel Farm Issues f. Converting Non-Fuel Purchasers g. Fuel Supply RFP Specifications 4. Public Comment 5. Adjourn
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AVIATION FUEL SUBCOMMITTEE MEETING May 19, 2026 The meeting was called to order at 8:40 AM by Airport Manager Warren Smith with the following Commissioners present: Michael Leavitt and Philip Marks III. This meeting was conducted in person at 14 Airport Road, Nantucket, MA. Airport employees present were: Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; and Elizabeth Reuss, Administrative Assistant. Mr. Smith read the Town’s virtual meeting statement. Mr. Smith asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Smith asked for comments and concerns on the 04/13/26 Draft minutes. Mr. Leavitt said he only received the draft minutes at 7:30 PM the previous evening–five (5) weeks after the meeting–which did not allow enough time to review prior to this meeting and noted they were sent much to long after the meeting. Mr. Leavitt then made a Motion that meeting minute drafts must be sent for review within seven (7) calendar days following each meeting. Second by Mr. Marks. 041326-01 – Discussion Regarding Aviation Fuel:  SSA Reservations Mr. Leavitt explained [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026 · 17:30

Harbor & Shellfish Advisory Board

Harbor Board discusses eelgrass, scallops, and diesel fuel transfer

The Harbor & Shellfish Advisory Board will meet to discuss eelgrass management priorities, commercial scalloping apprenticeship guidelines, and the safe transfer of diesel fuel from trucks to boats. The board will also review a new scallop catch reporting app and plan for 2027 Town Meeting articles.

shellfisheelgrassmarineenvironmentnantucketpublic-hearing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING NOTE TIME CHANGE TO 5:30 PM Original Posting Date _May 15, 2026_ Original Posting Number _T 369_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, May 19, 2026 at 5:30 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting - https://us06web.zoom.us/j/89879143527?pwd=bRcKTohqdzoSspa0PciHyi5CSbcP6B.1 Meeting ID: 898 7914 3527 Password: 816558 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Harbor and Shellfish Advisory Board Tuesday, May 19, 2026 at 5:30 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/89879143527?pwd=bRcKTohqdzoSspa0PciHyi5CS bcP6B.1 Meeting ID: 898 7914 3527 Password: 816558 CALL TO ORDER APPROVAL OF AGENDA 2 APPROVAL OF MINUTES Draft minutes of April 21, 2026 CHAIRMAN’S REPORT MARINE DEPARTMENT REPORT General M [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026 · 10:00

Community Preservation Committee

CPC to consider rental assistance, rain garden funding, easement costs

The CPC will vote on fund requisitions including $41,263 for Interfaith Council rental assistance and $54,060.93 plus $2,463.55 for Nantucket Lighthouse School rain garden construction. They will also discuss preservation easement costs, an office move/staffing update, and project assignments for FY2025 and FY2026. Public comment will be heard, and minutes from April 28 and May 1, 2026 will be approved.

community-preservationfundingrental-assistancerain-gardenpreservation-easementsnantucketpublic-hearing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time TUESDAY, MAY 19 2026 10:00 AM Location / Address 131 PLEASANT STREET – ROOM A (HYBRID) Remote Participation via Zoom Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Approval of Minutes 4/28/2026 & 5/1/2026 Public Comment Correspondence/Guest: None Guests: Olga Vasko and Emily Miller from the Lighthouse School New Business: 1. Fund Requisitions: - Nantucket Racket Sports Assoc. – FY 2020 - $774.17 for cameras/outdoor lighting (Dutra) - Interfaith Council – April Rental Assistance – FY2026 - $41,263.00 (Richen) - Nantucket Lighthouse School – FY 2026 - $54,060.93 and $2,463.55 for construction of rain garden (Du [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 19, 2026 · 16:00

Roads and Right of Way Committee

Committee to review Transportation Improvement Program and encroachment policy

The Roads and Right of Way Committee will discuss transportation planning items including the Transportation Improvement Program (TIP) and Unified Planning Work Program (UPWP), as well as status updates on the Encroachment Policy amendments and Stone Alley. The committee will also receive reports from DPW on roadway conditions and from NRTA on summer schedules.

roadstransportationencroachment-policypublic-wayharborsnantucket
✓ Decided: Committee approved corrected April minutes and adjourned the final meeting

The Roads and Right‑of‑Way Committee approved the April minutes after correcting the spelling of "WESCO" with a unanimous roll‑call vote. The Chair noted that July will be the committee's last month and suggested continuing future meetings on the third Tuesday of each month. Transportation program updates and other project reports were presented. The meeting was adjourned following a motion by Nelson Eldridge.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Roads and Right of Way Committee Day, Date, and Time Tuesday, May 19, 2026, at 4:00 pm Location / Address Room A, The Trailer, 131 Pleasant Street; or by Zoom: Join Zoom Meeting https://us06web.zoom.us/j/87669110695?pwd=mIL8nMalDNshfRZ9D5DiaDEjIs0ZP5. 1 Meeting ID: 876 6911 0695 Passcode: 487956 Signature of Chair or Authorized Person Lee W. Saperstein WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Expected Attendance: Members: Rick Atherton, Gordon Auchterlonie, Ed Gillum, Nelson (Snookie) Eldridge, Nat Lowell, Rob Ranney, Allen Reinhard, Lee Saperstein, and Phil Smith; ex officio: Mike Burns, Drew Patnode, Bob Bystrowski, Tracy MacDonald, and Gary Rogers. 1. Call to Order and Roll Call; this meeting is being audio and video recorded: Lee Saperstein. 2. Public and Commissioners’ Comments on Items not on the Agenda including agenda approval. 3.Approval of April Minutes: Lee Saperstein 4. Future schedules. 5. Transportation Issues: Mike Burns. • Review of Transportati [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Committee on Roads and Right-of-Way Draft Meeting Minutes Date: Tuesday, May 19, 2026 Time: 4:00 PM Meeting Type: Hybrid 1. Call to Order & Roll Call The meeting was called to order at 4:14 PM by Lee Saperstein, Chair of the Committee on Roads and Right-of-Way. Members Present: Phil Smith, Edward Gillum, Nat Lowell, Allen Reinhard, Drew Patnode, Lee Saperstein (Chair), Nelson Eldridge, Snooky Eldridge, Bob Bystrowski, Gary Roberts, Mike Burns, Gordie Auchterlonie Members Absent / Not Checked In: Rick Atherton, Rob Rennie, Tracy McDonald. 2. Approval of Agenda The agenda for the current meeting was reviewed. No items were added or modified. 3. Approval of April Minutes Edward Gillum noted one correction to the April minutes regarding the spelling of "West Coe" (correctly spelled W-E-S-C-O, not West). The minutes were approved as corrected following a motion by Snooky Eldridge, seconded by Allen Reinhard, and a unanimous roll call vote. 4. Committee Business & Future Scheduling The Chair noted that due to upcoming town restructuring, July will mark the end of the Committee on Roads and Right-of-Way. In the interim, it was agreed to maintain consistency and suggest to the Town Manager that future committee iterations continue meeting on the third Tuesday of each month at 4:00 PM. 5. Transportation Program Updates (Mike Burns) Mike Burns presented updates on the Draft FFY 2027–2031 Transportation Improvement Program (TIP) and the Unified Planni [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 18, 2026 · 14:00

Real Estate Assessment Committee

Committee to consider RFP for subdividing Lot G on Plan 2016-47

The Real Estate Assessment Committee will review a request to subdivide Lot G (approximately 7,000 sq. ft.) on Plan 2016-47 and decide whether to issue a Request for Proposals. It will also consider a conveyance request for Parcel 15 on Plan 2015-42 at 110 Surfside Road, with a calculated price of $19,114.20. Additional discussion will cover updates to the Yard Sale Program, including price factor changes and future income projections.

real-estateassessmentzoningparcelsyard-sale-program
131 Pleasant Street, Meeting Trailer Room A, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date May 13, 2026 Original Posting Number T 353 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s REAL ESTATE ASSESSMENT COMMITTEE (“REAC”) Day, Date, and Time MONDAY, MAY 18, 2026 AT 2PM Location / Address • 131 Pleasant Street, Trailer Room A and • REMOTE PARTICIPATION VIA ZOOM (See below) Signature of Chair or Authorized Person TRACY MACDONALD, Real Estate Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! MAY 18, 2026 UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting JOIN ZOOM MEETING: https://us06web.zoom.us/j/84027159713?pwd=mf0RY4JzDyIxf4G6prctKSNhIpFarl.1 I. CALL TO ORDER II. APPROVAL OF THE AGENDA III. APPROVAL OF MINUTES OF MEETINGS FOR FEBRUARY 10, 2025, APRIL 7, 2025, JUNE 16, 2025, JULY 21, 2025 AND FEBRUARY 13, 2026. IV. PUBLIC COMMENT V. REAL ESTATE MATTERS (a) Review/discussion of previous continuance from February 13, 2026 for staff to acquire an estimate to subdivide Lot G on Plan 2016-47 into 2 lots and obtain a formal response from the direct abutter regarding acquisition. Staff is requesting a [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 18, 2026 · 11:00

Select Board

Public hearings on new restaurant alcohol licenses and utility conduit installations

The Nantucket Select Board will meet remotely to consider several licensing requests and hold public hearings. Items include a noise bylaw waiver for the Boston Pops event, a change of location for a historical association party, and multiple applications for new alcohol and entertainment licenses. The board will also hear utility petitions from National Grid and Verizon for conduit installations.

licensingpublic-hearingsalcohol-licensesutilitieseventsnoise-waiver
✓ Decided: Select Board approved several liquor licenses and utility petitions, plus event waivers

The board unanimously approved a noise‑bylaw waiver for the Boston Pops event and a venue change for the Nantucket by Design opening party. It also approved multiple liquor and entertainment licenses, including Bar Yoshi, the Boathouse, and The Island Blend. Utility petitions from National Grid and Verizon were postponed for further consideration.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, MAY 18, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/iwcFDW55BLY ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_x0Iw12jLQcSuo2eGr2iBew I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Request for Approval of Waiver of Town Noise Bylaw for from 10:00 PM to 10:30 PM for Nantucket Cottage Hospital’s 2026 Boston Pops to be Held Saturday, August 8, 2026 at Jetties Beach. 2. Request for Approval of Change of Location for Nantucket Historical Association’s “Nantucket by Design” Opening Party for Approximately 220 Guests Plus 20 Staff to be Held Monday, July 13, 2026, 5:30 PM to 7:00 PM from El [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 18, 2026 Page 1 of 5 SELECT BOARD Minutes of the meeting of May 18, 2026. The meeting took place by remote participation via Zoom Webinar. Select Board Members present were Dawn E. Hill, Tom Dixon, Matt Fee and Brooke Mohr. Dr. Malcolm MacNab was absent. Also present were Licensing Administrator Amy Baxter, Culture and Tourism Director Shantaw Bloise-Murphy, Cultural Affairs and Special Events Coordinator Deana Weatherly and Real Estate Specialist Robert Bystrowski. I. CALL TO ORDER Chair Hill called the meeting to order at 11:03 AM. II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Request for Approval of Waiver of Town Noise Bylaw for from 10:00 PM to 10:30 PM for Nantucket Cottage Hospital’s 2026 Boston Pops to be Held Saturday, August 8, 2026 at Jetties Beach. Ms. Weatherly reviewed the request noting it is the 29th year of this event. Ms. Mohr moved approval; seconded by Mr. Fee; by roll call vote: Chair Hill – Yes; Mr. Dixon – Yes; Mr. Fee – Yes; Ms. Mohr – Yes; so voted. 2. Request for Approval of Change of Location for Nantucket Historical Association’s “Nantucket by Design” Opening Party for Approximately 220 Guests Plus 20 Staff to be Held Monday, July 13, 2026, 5:30 PM to 7:00 PM from Eleanor Ham Pony Field at 10 Mill Street to Harborview Nantucket at 24 Washington Street. Ms. Weatherly reviewed the request, noting the cont [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (13 roll-call votes)
Named votes as recorded in the official record.
Approval of Waiver of Town Noise Bylaw for Nantucket Cottage Hospital’s 2026 Boston Pops
4 yea
Hill yea · Dixon yea · Fee yea · Mohr yea
Approval of Change of Location for Nantucket Historical Association’s “Nantucket by Design” Opening Party
4 yea
Hill yea · Dixon yea · Fee yea · Mohr yea
Close the hearing for Sustainable Nantucket’s “Farm Fresh Feast” application
4 yea
Hill yea · Dixon yea · Fee yea · Mohr yea
Approval for Sustainable Nantucket’s “Farm Fresh Feast” application
4 yea
Hill yea · Dixon yea · Fee yea · Mohr yea
Close the hearing for Oswack Associates LLC dba Bar Yoshi application
4 yea
Hill yea · Dixon yea · Fee yea · Mohr yea
Approval for Oswack Associates LLC dba Bar Yoshi application
4 yea
Hill yea · Dixon yea · Fee yea · Mohr yea
Close the hearing for Climbing Everest, LLC dba Boathouse restaurant license application
3 yea
Dixon yea · Fee yea · Mohr yea
Approval with the standard 1:00 AM closing and to revisit the application at the Board’s October licensing meeting for Climbing Everest, LLC dba Boathouse
3 yea
Dixon yea · Fee yea · Mohr yea
Determine that the premises licensed to sell alcoholic beverages is not detrimental to the educational activities of the Boys and Girls Club, also to be reevaluated in October
3 yea
Dixon yea · Fee yea · Mohr yea
Close the hearing for Climbing Everest, LLC dba Boathouse non-live entertainment license application
3 yea
Dixon yea · Fee yea · Mohr yea
Approval for Climbing Everest, LLC dba Boathouse non-live entertainment license application
3 yea
Dixon yea · Fee yea · Mohr yea
Close the hearing for Three Brothers & Sisters Inc. dba The Island Blend restaurant license application
3 yea
Dixon yea · Fee yea · Mohr yea
Approval with an 11:00 PM cut off for alcohol service, the submission of new floor plans and any other technical documents requested by the Licensing Administrator for Three Brothers & Sisters Inc…
3 yea
Dixon yea · Fee yea · Mohr yea
Mon May 18, 2026 · 13:30

Select Board/County Commissioners

Nantucket Select Board to discuss union grievances in closed session

The Select Board/County Commissioners will convene and then immediately enter executive session to discuss strategy for collective bargaining and litigation regarding two grievances with Massachusetts Laborers' District Council and local unions. The open session is limited to convening and adjourning; no public votes or hearings are scheduled.

select-boardcounty-commissionersexecutive-sessionlabor-negotiationscollective-bargainingnantucketpublic-employees
✓ Decided: Board voted to adjourn to executive session for labor negotiation strategy

The Select Board moved to adjourn the open session and enter an executive session to discuss strategy for negotiations with nonunion personnel and related labor matters. The motion was seconded and approved by roll‑call vote, with all five members voting Yes. The meeting was then adjourned to executive session.

16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date _May 15, 2026_ Original Posting Number _T 356_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time MONDAY, MAY 18, 2026 AT 1:30 PM Location / Address TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personnel and to Discuss Strategy with Respect to Collective Bargaining or Litigation, where an Open Meeting May have a Detrimental Effect on the Bargaining or Litigating Position of the Select Board/County Commissioners and the Chair so Declares – Massachusetts Laborers’ District Council, Nantucket Public Employees’ Local Union 1060 and Unit MCR-4349 and 4348 of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 18, 2026 Page 1 of 2 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of May 18, 2026. The meeting was held in the Town Building Conference Room, Nantucket and via Zoom. Select Board Members present were Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Dawn E. Hill and Tom Dixon were present remotely. Deputy Town Managers Rick Sears and Gregg Tivnan were present in person. I. CONVENE IN OPEN SESSION Ms. Mohr was Acting Chair. She called the meeting to order at 1:33 PM. Mr. Fee moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purposes of: 1. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personnel and to Discuss Strategy with Respect to Collective Bargaining or Litigation, where an Open Meeting May have a Detrimental Effect on the Bargaining or Litigating Position of the Select Board/County Commissioners and the Chair so Declares – Massachusetts Laborers’ District Council, Nantucket Public Employees’ Local Union 1060 and Unit MCR-4349 and 4348 of the Laborers’ International Union of North America (Grievance I). 2. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personn [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Mon May 18, 2026 · 14:00

Harbor Plan Update Committee

Harbor Plan Update Committee to discuss draft plan and DEP comments

The committee is meeting to review outstanding and DEP comments regarding the draft harbor plan. Members will discuss the upcoming schedule and next steps to finalize the draft plan.

harbor-planenvironmental-reviewplanning
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 Nantucket and Madaket Harbor Plan Committee Meeting May 18, 2026 at 2:00 PM – 3:30 PM Location: Community Room at Public Safety Facility 4 Fairgrounds Road Zoom information below for those unable to be in person Agenda: 1. Welcome – Establish quorum a. Approval of agenda b. Approval of minutes 2. Outstanding comments a. Discuss outstanding comments and DEP comments on draft plan 3. Upcoming schedule a. Share and discuss schedule 4. Next steps (UHI) a. Finalize draft plan Zoom: Harbor Plan Update Committee Zoom Link https://umassboston.zoom.us/j/91682530066 Meeting ID: 916 8253 0066 One tap mobile +13092053325,,91682530066# US +13126266799,,91682530066# US (Chicago) MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor Plan Update Committee Day, Date, and Time Monday May 18, 2026 – 2:00 PM - 3:30PM Location / Address Community Room at Public Safety Facility 4 Fairgrounds Road, Nantucket, MA 02554 REMOTE PARTICIPATION VIA ZOOM https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Zoom link: https://umassboston.zoom.us/j/91682530066 Signature of Chair or Authorized Person Jeff Carlson, Natural Resources Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTIN [Excerpt truncated on this listing page; use the official record for the full text.]
Fri May 15, 2026 · 18:00

Nantucket Historical Commission

Historical Commission to review Verizon generator, Coast Guard lights, and Ticcoma Green naming

The Nantucket Historical Commission will hold a hybrid meeting to discuss several Section 106 reviews, including a Verizon Wireless generator replacement at 11 Orange Street and the Coast Guard Station Brant Point Range Lights. Other items include naming the Ticcoma Green Building, updates on historic resource surveys, and discussion of a Civil War Monument. The commission will also approve minutes from previous meetings and consider training opportunities.

historical-commissionsection-106-reviewverizon-generatorcoast-guard-lightsticcoma-greenhistoric-surveycivil-war-monument
✓ Decided: No substantive decisions recorded at the Nantucket Historical Commission meeting

The minutes contain only procedural and discussion notes without any recorded approvals, denials, or votes on specific actions. No concrete decisions were documented.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, May 15, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Staff update • Section 106 Review –11 Orange Street, Verizon Wireless Generator Replacement • Section 106 Review – Coast Guard Station Brant Point Range Lights • Ticcoma Green Building Naming • Historic resource surveys update o PaleoWest, LLC / Chronical Heritage survey of Town-owned hist [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 1DQWXFNHW+LVWRULFDO&RPPLVVLRQ 0D\0HHWLQJ $0 3OHDVDQW6WUHHW1DQWXFNHW0$DQGYLD=RRP $WWHQGHHV %HWV\7\OHU &RPPLVVLRQHU %DUEDUD+DOVWHG &RPPLVVLRQHU  *HRUJH%XWWHUZRUWK &RPPLVVLRQHU  5LWD&DUU &RPPLVVLRQHU $QJXV0DF/HRG &RPPLVVLRQHU 6DUDK0F/DQH &RPPLVVLRQHU +ROO\%DFNXV VWDII±3UHVHUYDWLRQ3ODQQHU  $JHQGD ‡ 5ROOFDOODW$0 &RPPLVVLRQHUV5LWD*HRUJH%DUEDUD$QJXV6DUDKDQG%HWV\DUHLQ 3HUVRQ6WDII+ROO\LVDOVRLQSHUVRQ ‡ 3XEOLFFRPPHQW 1RQH ‡ 6WDIIXSGDWH +ROO\PHWZLWKPDVRQVRQVLWHDWWKH&DQGOH6WUHHWVWDELOL]DWLRQSURMHFW DQGVKDUHGSKRWRV%ULFNLVEHLQJUHSRLQWHGDQGVWHHOIUDPLQJLVEHLQJUHSODFHG ‡ 6HFWLRQ5HYLHZ±2UDQJH6WUHHW9HUL]RQ:LUHOHVV*HQHUDW RU5HSODFHPHQW o $QJXVH[SUHVVHGDODFNRIFRQFHUQRYHUWKHSURSRVHGUHSODFHPHQWSDUWLFXODUO\ JLYHQLWVODFNRIYLVLELOLW\ o 0RWLRQWRZULWHDOHWWHUILQGLQJQRDGYHUVHHIIHFWE\$QJXVVHFRQGHG6DUDK $QJXV±$\H6DUDK±$\H%HWV\±$\H*HRUJH±$\H%DUEDUD±$\H5LWD± $\H ‡ 6HFWLRQ5HYLHZ±&RDVW*XDUG 6WDWLRQ%UDQW3RLQW5DQJH/LJKWV o (OL]DEHWK.LUNSDWULFNSUHVHQWHGWKHSURMHFW:RRGHQUDQJHOLJKWVZHUH FRQVWUXFWHGLQWKHSURSRVDOLVWRGHPROLVKWKHH[LVWLQJUDQJHOLJKWVDQG UHSODFHWKHPZLWK[¶UDQJHWRZHUVZKLFKDUHFRQFUHWHDQGVWHHO o $QJXVH[SUHVVHGFRQFHUQRYHUWKHFKDQJHLQFKDUDFWHUZRXOGUDWKHUVHHWKH H[LVWLQJUHSDLUHGRUUHEXLOWDOOFRPPLVVLRQHUVDJUHHG5LWDDVNHGLIWKLV DOWHUQDWLYHKDVEHHQFRQVLGHUH [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
write a letter finding no adverse effect regarding 11 Orange Street, Verizon Wireless Generator Replacement
6 yea
Angus yea · Sarah yea · Betsy yea · George yea · Barbara yea · Rita yea
Fri May 15, 2026 · 10:00

Board of Registrars

Board to test ballot tabulators for May 19 town election

The Board of Registrars will conduct a public test of ballot tabulating equipment ahead of the May 19, 2026 Annual Town Election. The single agenda item is the equipment test required before the election.

electionselection-equipmentballot-testing
16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Board of Registrar Day, Date, and Time Friday, May 15, 10:00am Location / Address 16 Broad Street, Conference Room Signature of Chair or Authorized Person Nancy L. Holmes WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting The test for the ballot tabulating equipment for the May 19, 2026 Annual Town Election
Fri May 15, 2026 · 11:00

Washington Street Collaborative Work Group

Workgroup to review Francis Street Beach Improvement Project design

The Washington Street Collaborative Workgroup will discuss the 30% design phase for the Francis Street Beach Improvement Project. The group will review schematic design deliverables, cost estimates, and funding sources provided by SCAPE and Pare.

beach-improvementpublic-worksinfrastructurecoastal-resilience
✓ Decided: Workgroup unanimously approves 30% design for Washington Street project

The Washington Street Collaborative Work Group met on May 15, 2026. Members approved the 30% design package for the Washington Street project and directed staff to finalize the report. The group also accepted the December 19 meeting minutes unanimously. No other actions were taken.

22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, May 15, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/84584957719?pwd=Uq0Wq8UYfRWEPPo2QnxxZqUKXNMBpE.1 Meeting ID: 845 8495 7719 Passcode: 296694 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA A. CONVENE IN OPEN SESSION 1. PUBLIC COMMENT a. May not exceed 3 minutes per speaker 2. MINUTES: December 19, 2025 3. FRANCIS STREET BEACH IMPROVEMENT PROJECT a. Design Refresh (SCAPE) b. Overview of Schematic Design Deliverables (SCAPE) ii. Task 2.2 - Schematic Design Documents iii. Illustrative deliverables iv. Task 2.3 - Revised Estimate of Probably Cost v. Task 2.4 - State and Federal Funding Sources Memo vi. Task 2.5 - Revised Basis of Design vii. Task 3 - Benefit Cost Analysis viii. Task 4 – O&M c. Schedule overview and next steps (SCAPE) d. Structural and permitting updates and next steps (Pare) e. Discussio [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Washington Street Workgroup Minutes Friday, May 15, 2026 at 11:00am Hybrid: Zoom and in person at the Land Bank Office Members present: Matt Fee, Alan Reinhart, John Stackpole Members absent: Nat Lowell, Malcolm MacNab Staff present: Vince Murphy, Liz Phelps, Bob Bystrowski, Mike Burds, Charles Johnson, Anne Doughertry, Laura Marett, Joe Famely, Todd Turcott, Gregg Tivnan, Megan Sheahan, Adrieene Lennon Packet available here: https://nantucketma.portal.civicclerk.com/event/24328/files/agenda/34755 Recording available here: https://www.youtube.com/watch?v=KOYJGqMSU5I A. Meeting convened in open session at 11.13am. 1. Public Comment opened and closed with no public comment 2. Meeting minutes of December 19 accepted unanimously by members present with no edits. 3. Laura Marett presented the packet materials on the Design Refresh Matt Feee asked how some of this fit in with the Nantucket coastal Resilience Plan. Vince Murphy responded that the CRP sought to raise the level of the road, and this is a supporting part to buy us time to plan for the larger project. Laura presented costs on (1) Frances Street Beach & Drainage (2) Land Bank Rain Garden and (3) the Saltmarsh center Green Infrastructure, as well as state and federal funding sources. Matt and Vince discussed grant applications, strategy and timeframes, as well as how Town and Land Bank may move these projects forward under an MOU. Joe Famely provided more information on these points. Ann [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 14, 2026 · 08:00

Nantucket Water Commissioners

Water Commissioners to review personnel and vendor contracts

The Nantucket Water Commissioners will review production, billing, and rainfall reports. The board will discuss updates on the Airport Project and Sewer Force Main, and consider the execution of personnel and vendor contracts.

water-qualityinfrastructurecontractspfas-treatmentsewer
1 Milestone Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, May 14, 2026, at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Nantucket Water Commission Regular Meeting – in person at the Water Company conference room 1 Milestone Road, Nantucket, MA 02554 Thursday, May 14, 2026, at 8:00 AM 1. Call Meeting to Order 2. Acceptance of Agenda 3. Public Comment 4. Review of Minutes of January 8, 2026, February 12, 2026 and April 9, 2026 meetings. 5. Production, Billing and Rainfall Reports 6. Director’s review and updates: a. Water Quality & Drought Condition b. Chatham Rd c. Sewer Force Main d. Airport Project e. Cross Connection Control Backflow Testing – Fire Service Policy f. Staff 7. Discussion, amendment and execution of any personnel or vendor contracts (Invoice Cloud pending; bids were due in March for Misc Parts & Steel Building for PFAS Treatment) 8. Commissioner’s Comments and Reserved for Unforeseen Items for Discussion not anticipated. 9. Adjournment Next Regular Commission meeting Thursday, June [Excerpt truncated on this listing page; use the official record for the full text.]
Thu May 14, 2026 · 09:00

Select Board

Select Board to consider purchase or lease of property at 158 Madaket Road

The Select Board will hold an executive session to approve minutes from April 2 and April 30, 2026. They will discuss strategy for collective bargaining and grievances with the Massachusetts Laborers’ District Council and Nantucket Public Employees’ Local Union 1060. The board will consider the purchase, exchange, lease, or valuation of real property located at 158 Madaket Road, with votes permitted. A litigation strategy concerning a response from the U.S. Department of the Interior will also be reviewed.

propertyreal-estatelaborcollective-bargaininglitigation
✓ Decided: Select Board adjourned to executive session and approved meeting minutes

The Board voted to adjourn the open session and enter executive session for several purposes, including approval of executive‑session minutes, strategy for labor negotiations, discussion of real‑property at 158 Madaket Road, and litigation strategy. The motion was seconded and passed by roll‑call vote with all five members voting Yes. The Board also approved the minutes of the May 14, 2026 meeting.

TOWN BUILDING CONFERENCE ROOM, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 AMENDED MEETING POSTING Original posting date: 5/8/2026 Original Posting # T 340 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, MAY 14, 2026 AT 9:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of April 2, 2026; April 30, 2026. 2. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personnel and to Discuss Strategy with Respect to Collective Bargaining or Litigation, where an Open Meeting May have a Detrimental Effect on the Bargaining or Litigating Position of the Select [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 14, 2026 Page 1 of 3 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of May 14, 2026. The meeting was held in the Town Building Conference Room, Nantucket and via Zoom. Select Board Members present were Dawn E. Hill, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Tom Dixon was absent from open session but joined executive session later. Deputy Town Manager Rick Sears was present in person. Town Manager C. Elizabeth Gibson and Deputy Town Manager Gregg Tivnan were present remotely. I. CONVENE IN OPEN SESSION Chair Hill called the meeting to order at 9:05 AM. Ms. Mohr moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purposes of: 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of April 2, 2026; April 30, 2026. 2. Purposes 2 and 3: To Conduct Strategy Sessions in Preparation for Negotiations with Nonunion Personnel or to Conduct Collective Bargaining Sessions or Contract Negotiations with Nonunion Personnel and to Discuss Strategy with Respect to Collective Bargaining or Litigation, where an Open Meeting May have a Detrimental Effect on the Bargaining or Litigating Position of the Select Board/County Commissioners and the Chair so Declares – Massachusetts Laborers’ District Council, Nantucket Public Employees’ Local Union 106 [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session
4 yea
Hill yea · Fee yea · MacNab yea · Mohr yea
Wed May 13, 2026 · 17:30

NRTA Advisory Board

NRTA board to discuss FY27 budget, Keolis transition

The Nantucket Regional Transit Authority Advisory Board will discuss the FY27 budget and hear an overview of the transition to new operator Keolis NA. The board will also consider a Revenue Anticipation Note and receive a fleet status update. Public comment and approval of prior minutes are also on the agenda.

transitbudgetkeolisnantucketpublic-transportation
PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NRTA Advisory Board Day, Date, and Time Wednesday, May 13, 2026, 5:30pm Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD and REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Gary Roberts, NRTA Administrator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/jmfcjaZr7NQ ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_xiyoCK33SrO1JJ_giOB_vw I. Public Comment II. Approval of Minutes from February 18,2026 Advisory Board Meeting III. Administrator Report 1. Overview of Transition to new Operator Keolis NA 2. Fleet Status IV. FY27 Budget V. Revenue Anticipation Note
Wed May 13, 2026 · 17:30

Select Board

Sewer fee waiver for 8 affordable rental units at 20-26 Sparks Avenue

The Select Board will consider a request to waive sewer connection and capacity fees for eight rental units restricted to 80% Area Median Income at 20-26 Sparks Avenue. Also on the agenda are a follow-up on a dangerous dog hearing, proposed no-parking designations on Lovers Lane, Okorwaw Avenue, and Monohansett Road, and a letter of support for a Safe Streets and Roads for All grant application. The board will vote on multiple pending contracts, including collective bargaining agreements and a $1.13 million Jetties Beach concession lease.

affordable-housingsewer-feesdangerous-dogtraffic-safetycollective-bargainingjetties-beachgrantsappointments
✓ Decided: Select Board approved noise waiver, sewer fee waivers, and housing measures

The Board unanimously approved a night‑time noise‑bylaw waiver for KOBO work, waived sewer connection and capacity fees for eight affordable‑housing units on Sparks Avenue, and accepted an affordable‑housing restriction for 20 Nancy Ann Lane. It also designated no‑parking zones on Lovers Lane, Okorwaw Avenue and Monohansett Road, authorized a letter of support for the Safe Street and Roads for All grant, and approved pending contracts and payroll/treasury warrants. An interim representative to the Board of Health was appointed.

PSF COMMUNITY ROOM, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MAY 13, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/jmfcjaZr7NQ ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_xiyoCK33SrO1JJ_giOB_vw I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Select Board/Planning Board Joint Appointment to Fill Vacant Seat on Planning Board at May 20, 2026 Select Board Meeting. 3. Announce Applications Received (per Select Board Committee Appointment Policy) for 2026 Annual Appointments: Agricultural Commission, Airport Commission, Board of Health, Cannabis Advisory Committee, Capital Program Committee, Cemetery Co [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of May 13, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of May 13, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Thomas Dixon participated remotely. I. CALL TO ORDER Chair Hill called the meeting to order at 5:55 PM following a meeting of the Nantucket Regional Transit Authority Advisory Board. She noted that Mr. Dixon is participating remotely, therefore all votes will be taken by roll call. II. SELECT BOARD ACCEPTANCE OF AGENDA Chair Hill noted that there is one extra announcement item and one New Business item. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Deputy Town Manager Rick Sears and Operations Administrator Erika Mooney reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Announce Applications Received for Planning Board Vacancy; Appointment to be Made by Select Board/Planning Board at May 20, 2026 Select Board Meeting. Ms. Mooney announced the three applicants for the Planning Board vacant seat: Liza Hatton, Clay Evans and Campbell Sutton. 3. Announce Applications Received (per Select Board Committee Appointment Policy) for 2026 Annual Appointments: Agricultural Commission, Airport Commission, Board [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
approve the work to be done when affected businesses are closed (KOBO waiver of Town Noise Bylaw)
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
approval of items VII 1 – 4 with the exception of the minutes from April 27, 2026 at 11:00 AM and April 30, 2026 at 2:00 PM
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Tue May 12, 2026 · 08:00

Visitor Services Advisory Committee

Conversation with Steamship Authority GM on May 12 agenda

The Visitor Services Advisory Committee will meet remotely to discuss visitor services. Key agenda items include a conversation with Alex Kryska, General Manager of The Steamship Authority, and reports from the Director and Coordinators. Public comment and approval of previous minutes are also scheduled.

visitor-servicessteamship-authoritynantucketpublic-commentminutesreports
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Visitor Services Advisory Committee Day, Date, and Time Tuesday, May 12th at 8:00am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person David Sharpe WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85275837374?pwd=ZmlCOWNCUmZhZXVQYitGTStjWEJIdz09 Meeting ID: 852 7583 7374 Passcode: 056433 1. Welcome VSAC Members 2. Public Comment 3. Approval of April 14th Minutes 4. Conversation with Alex Kryska, General Manager, The Steamship Authority 5. Director’s Report 6. Visitor Services Coordinator’s Report 7. Cultural Affairs and Event Coordinator’s Report
Tue May 12, 2026 · 10:00

Board of Registrars

Board to test ballot equipment for May 19 election

The Board of Registrars is meeting to conduct a mandatory test of ballot tabulating equipment ahead of the May 19 Annual Town Election. This is a procedural item required by state law before the election can proceed.

electionsvotingequipment-testing
16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Board of Registrar Day, Date, and Time Tuesday, May 12, 10:00am Location / Address 16 Broad Street, Conference Room Signature of Chair or Authorized Person Nancy L. Holmes WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting The test for the ballot tabulating equipment for the May 19, 2026 Annual Town Election
Tue May 12, 2026 · 10:00

Coastal Resilience Advisory Committee

Committee to discuss coastal resiliency articles from Town Meeting

The Coastal Resilience Advisory Committee will review and discuss its 2025 4th and 2026 1st quarter report for the Select Board, and debrief on multiple Town Meeting articles related to coastal resiliency, including stormwater bylaws, dredging funds, and beach revolving fund changes. The committee will also examine its mission and charge, and share members' resiliency goals for 2026.

coastal-resiliencestormwaterdredgingzoningfematown-meetingnantucketbeach-fund
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, May 12, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, May 12, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes February 10, 2026; March 24, 2026 5. Review, discuss, and approve CRAC’s 2025 4th and 2026 1st quarter report for the Select Board by L [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 12, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank Commission to review property management and agricultural policies

The Nantucket Islands Land Bank Commission will discuss agricultural policies and property management tasks. The body will also review designer change orders for building relocations and hold an executive session regarding real estate and litigation.

agricultureproperty-managementland-uselitigationconservation
22 Broad Street
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date May 8, 2026 Original Posting Number T 342 TOWN OFNANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday May 12, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St., Nantucket, MA 02554 Plus Remote Participation via ZOOM*, the meeting will be aired at a later time on Town’s Government TV You Tube Channel Signature of Chair or Authorized Person Marian P. Wilson, Office Administrator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting AGENDA https://us06web.zoom.us/j/89365064432?pwd=PU466dWLrUMNs6ry8j0ahgDHleU1bl.1 Webinar ID: 893 6506 4432 Passcode: 452383 Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. AGRICULTURAL BUSINESS a. Bee Hives on Land Bank Land – Policy Review b. Various Properties - Proposed Pig Enclosure Locations for Summe [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 12, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review five sign permit applications

The Sign Advisory Council will consider several sign permit applications, including a freestanding sign for the Museum of African American History at 29 York Street and projecting signs for two retail tenants at 46 Center Street. The council will also approve minutes from its May 5, 2026 meeting and discuss enforcement.

signshistoric-districtpermitsnantucketadvisory-council
✓ Decided: Council recommended approving Museum of African American History sign option 3

The Sign Advisory Council voted 3-2 to recommend the Museum of African American History sign using option 3 in FOLGER Blue. All other items were either held for revisions or approved unanimously. No other substantive decisions were made.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, May 12, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC SAC Minutes May 12, 2026; adopted 5/19/26 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday May 12, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Kevin Kuester, Mark Cutone Absent members: none. Late arrivals: none. Early Departures: none. Motion to adopt agenda made by Wolf; seconded by Normand. Vote: Carried unanimously. Approval of Minutes: 5/5/2026 minutes made by Kuester; seconded by Normand. Vote: Carried unanimously. II. Public Comment- none III. Commissioner Comments- HDC Sign Advisory Council minutes 5/12/26; adopted 5/19/26 New Business 1. Museum of African Am. Hist- 14486 29 York Street Freestanding Sign 55.4.1/178 Marsha Fader Discussion: Kuester- revisions requested on 5/5/26 do not reflect logo or color. Not similar to the original sign. Does not fit into neighborhood context and setting. Wolf- prefers option 4. Normand- prefers option 3 or 4. Cutone- prefers option 3 or 4; leaning towards 4. They provide a chip in their presentation for #3. Young- not comfortable- too much like a billboard. Located in the residential section of the OHD. Logo should be removed. Should go before the Commission with color chips. Motion to approve option #3 made by Cutone; seconded by Wolf. Kuester seconded the motion [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
recommend approvable to the HDC with option 3 FOLGER Blue
2 nay
Young nay · Kuester nay
Tue May 12, 2026 · 17:30

Nantucket Public School Committee

School Committee will review midyear goals and self‑evaluation

The Nantucket Public School Committee meeting on May 12, 2026 will include an Assistant Superintendent update, a review of the Open Meeting Law, a mid‑year review of the Committee’s goals, a self‑evaluation, and a mid‑year review of the Superintendent’s goals. No specific decisions or contracts are listed; the agenda consists of informational updates and discussion topics.

educationschool-committeemidyear-reviewgovernanceopen-meeting-law
Nantucket Community School, Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting, Workshop Day, Date, and Time Tuesday, May 12, 2026, 5:30 PM Location / Address Nantucket Community School, Conference Room 56 Center Street Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to order II. Welcome and approval of agenda III. Assistant Superintendents Update IV. Open Meeting Law Review and Discussion V. School Committee Goals - Midyear Review VI. School Committee Self-Evaluation VII. Superintendent Goals: Midyear Review VIII. Adjournment 1 OUR MISSION: Nantucket Public Schools, in partnership with a caring community, will create a dynamic and equitable learning environment which engages each of us to be inspired learners and responsible citizens, prepared to meet local and global challenges.
Tue May 12, 2026 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to review $3.9M apron rehabilitation and various leases

The Nantucket Memorial Airport Commission will discuss pending contracts, including a major apron rehabilitation project. The body will also consider amendments to ramp parking and APU rules and review solar installation alternatives.

airportinfrastructurecontractszoningsolarbudget
✓ Decided: Commission unanimously approved airport leases, contracts and warrants

The commission ratified the April 15 and April 29 warrants with a 5‑aye vote. It then approved the leases and contracts listed in Exhibit One—including agreements with Aloft Aviation, Cape Air, and multiple service providers—with the same unanimous vote. The agenda was adopted without comment. No other substantive actions were taken.

131 Pleasant Street, Meeting Trailer Room A, Nantucket
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, May 12, 2026 at 5:00 PM Location / Address HYBRID 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_21zJ3IwwTlWNTgUrPvVSig Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_21zJ3IwwTlWNTgUrPvVSig To view the meeting only, see link below: https://youtube.com/live/BzUK_foRAe4 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 03/24/26 and 04/14/26 Draft Minutes c. Ratify 04/15/26, and 04/29/26 Warrants 3. Public Comment 4. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 5. Pending Matters: a. 071420-03 Per-and Polyfluo [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING May 12, 2026 The meeting was called to order at 5:0 0 PM by Chairman Arthur Gasbarro with the following Commissioners present: Andrea Planzer , Anthoney Bouscaren, Philip Marks III, and Michael Leavitt. This meeting took place at 131 Pleasant Street, Nantucket, MA, and was conducted via Zoom Webinar and broadcast live on the Town of Nantucket YouTube channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Rich Lasdin , McFarland -Johnson; Priyanka Menon, Fennic k-McCredie Architecture; John athan McCredie, Fennick-McCredie Architec ture; and Jim S oukup, Weston Solutions. Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Gasbarro asked for comments and concerns on the 03/24/26 and 04/14/26 Draft minutes. Mr. Marks made a Motion t [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
ratify the 04/15/26 and 04/29/26 Warrants
5 yea
Planzer yea · Leavitt yea · Bouscaren yea · Marks yea · Gasbarro yea
approve the leases, contracts, and contract amendments as set forth in Exhibit One (1)
5 yea
Planzer yea · Leavitt yea · Bouscaren yea · Marks yea · Gasbarro yea
Tue May 12, 2026 · 16:00

Historic District Commission

Commission will consider a new harbormaster building on Washington Street

The Historic District Commission will review numerous consent applications for additions, fences, solar installations, and other alterations across town. A motion will be taken to approve the new harbormaster building at 34 Washington St. The meeting also includes sign approvals, a ratified motion from a prior meeting, and a Q&A with the preservation planner.

historic-districtbuildingsignspermitsplanning
✓ Decided: Historic District Commission unanimously approved dozens of preservation permits

The commission approved all consent items listed except #7 (10 Maxey Pond cabana) which was moved for further review, then later approved that cabana. It also approved consent‑with‑conditions items #1 and #3‑13, and approved several sign applications while holding others for revisions. Additional project approvals and holds were recorded for new business items.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAY 08 PM 02:52 Original Posting Number: T 343 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, May 12, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_h7wxmGL2SL2br1B06ATQgw#/registration To watch live feed, click here: https://www.youtube.com/live/Afy59fFqR0I Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes May 12, 2026; adopted June 2, 2026 HISTORIC DISTRICT COMISSION Minutes May 12, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson In person: MacLeod, Oliver, Patten and Camp Zoom: Pohl, Paul and Thornewill Welch was not present Meeting called to order at 4:00 pm by Angus MacLeod Board: Pohl, MacLeod, Oliver, Thornewill and Camp MacLeod made the motion to approve the agenda Motion carries unanimously Backus left the meeting at 6:15pm Pohl left the meeting at 6:58 pm I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Nant. Land Bank 14647 41 Jefferson Av Garage move on site 30/45 Eleanor Antionetti 2. Dan Gault 14664 17 Ridge Ln Addition/new foundation 38/78 Self RP 3. Michelle Garfinkel 14672 13 Starbuck Rd Fence-hardscape 60/113 Thornewill Design RP 4. Nant. Land Bank 14677 159 Hummock Pond Rd Storage shed demo 65/28 Eleanor Antionetti RP 5. Jordan Tamchin 14674 50 Burnell ST New guest house 49/167 CWA RP 6. Jordan Tamchin 14675 50 Burnell ST New garage 49/167 CWA RP 7. 10 Maxey Pond, LLC 14658 10 Maxey Pond Rd Cabana 40/100 CWA RP 8. Judith Brownell 14633 38 Monohansett Fence 79/60 Val Oliver Design CP 9. Robert Hatcher 14632 72 Baxter Rd [Excerpt truncated on this listing page; use the official record for the full text.]
Mon May 11, 2026 · 16:00

Planning Board

Planning Board to review plans and continue public hearings

The Nantucket Planning Board will meet to review preliminary and approval-not-required plans, approve minutes, and continue several public hearings. The meeting will be held in person at the Public Safety Facility and via Zoom.

planningzoningpublic-hearingshousingdevelopmentnantucket
✓ Decided: Board approved special permit for 4 Lovers Lane with seasonal hours

The Planning Board approved a special permit for Jibo & Co. Holdings LLC at 4 Lovers Lane, adding seasonal operating dates and specific outdoor hours. It also approved numerous Approval Not Required plans, a preliminary plan for 46 Lovers Lane, a bike‑path easement removal, a re‑endorsement of 10 Surfside Drive, and granted continuances for six other applications. All votes were unanimous except the 46 Lovers Lane preliminary plan (3‑1).

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 04-13-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: Zoom Registration - May 11, 2026 To view the meeting only, see link below: YouTube Live Meeting Link - May 11, 2026 Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, May 11, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Zoom Registration - May 11, 2026 Meeting Packet Link 2026 Meeting Packet Link Signature of Chair or [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Page 1 of 7 PLANNING BOARD APPROVED MINUTES OF 05-11-2026 *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, and Hillary Hedges Rayport Alternates: Stephen Welch, Howard Matz, and Abby De Molina (Absent), Staff: Leslie Snell (Director of Planning) (remote participation), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist) and Catherine Ancero (PLUS Administrative Specialist) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ I. Call to order: Chair Iverson called the meeting to order at 4:00 PM. Attendance taken by roll call: Board Members: Hillary Hedges Rayport, Aye Vice-Chair Lowell, Aye Joseph Topham, Aye Chair Dave Iverson, Aye Alternates: Stephen Welch, Aye Howard Matz, Aye Staff: Leslie Snell, Aye Megan Trudel, Aye Catherine Ancero, Aye William Saad, Aye II. Approval of the agenda: MOTION/VOTE: Ms. Rayport made a motion to approve the agenda, and the motion was duly seconded by Vice-Chair Lowell, and the motion was carried out unanimously. III. Public Comment: for items not listed on the agenda There were no public comments and no concerns. IV. Minutes: ▪ March 9, 2026 ▪ March 12, 2026 Page 2 of 7 DOCUMENTATION: File with associated plans, photos and required documentation DISCUSSION: Board reviewed the March 9th and the 12th meeting minutes. Confirmation that the Aril 13th da [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve the preliminary plan for 46 Lovers Lane, 8 and 8R Skyline Drive
1 nay
Rayport nay
Fri May 8, 2026 · 15:00

Commission on Disability

Commission to appoint representative to new Transportation and Public Access Committee

The Commission on Disability will discuss appointing a representative to the newly formed Transportation and Public Access Advisory Committee (TPAC), which merges the Bicycle and Pedestrian Advisory Committee and Roads and Right of Way Committee. Members will also receive updates on various accessibility issues, including complaints about the Pleasant Street post office automatic door, accessible parking spaces, airport crosswalks, and a new accessible path at Sconset golf course.

disabilitytransportationaccessibilityairportpublic-accessparkingbeach-access
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/ Board Commission on Disability Day, Date, and Time Friday, May 8, 2026, at 3:00 PM Location / Address https://us06web.zoom.us/j/84378453563?pwd=8OqiDuLXtzd1628coctDBIX6ve4ikJ.1 Signature of Chair or Authorized Person Brenda McDonough WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Open Session To Join Zoom Meeting https://us06web.zoom.us/j/84378453563?pwd=8OqiDuLXtzd1628coctDBIX6ve4ikJ.1 Meeting ID: 843 7845 3563 Passcode: 566989 I. Call to Order for Open Session II. Adopt Agenda III. Public Comment IV. Approve Open Session Minutes for January 2, 2026 V. New Business • Bicycle and Pedestrian Advisory Committee (BPAC) and Roads and Right of Way Committee are being “merged” to advise on broader mobility issues for both the Select Board and Nantucket Planning and Economic Development (NP&EDC). The NP&EDC has recommended the SB form a Transportation and Public Access Advisory Committee (TPAC) with 1 representative from COMDIS. The town would like to have a CO [Excerpt truncated on this listing page; use the official record for the full text.]
Fri May 8, 2026 · 12:30

Affordable Housing Trust

Affordable Housing Trust to discuss real property at 158 Madaket Road

The Affordable Housing Trust will meet to consider the purchase, exchange, lease, or value of a specific property. This discussion will take place in executive session to protect the trust's negotiating position.

affordable-housingreal-estateproperty-acquisition
✓ Decided: Board voted to move to executive session to discuss 158 Madaket Road property

At 12:38 pm, Chair Brian Sullivan called a motion to adjourn the meeting to executive session under MGL C. 30A § 21(A) to consider the purchase, exchange, lease, or value of real property at 158 Madaket Road. The motion was seconded by Shantaw Bloise‑Murphy and passed by roll‑call vote with all four members present voting aye. The meeting was then adjourned.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Friday, May 8, 2026, at 12:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR FRIDAY, MAY 8, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at 158 Madaket Road where an Open Meeting may have a Detrimental Effect on the Negotiating Position of the Affordable Housing Trust Members and the Chair so Declares; Votes May be Taken. III. ADJOURNMENT *Public [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on May 8, 2026, at 12:30 PM Approved the 19th day of May 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, May 08, 2026 Remote Meeting via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice- Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present : Brian Sullivan, Brooke Mohr, Shantaw Bloise-Murphy and Abby De Molina. Staff members present were Kristie Ferrantella (Housing Director), Dylan Metsch-Ampel (Deputy Housing Director ); Caroline Ferguson (Administrative Specialist) , Vicki Marsh (Town Counsel), Eric Barth (Town Counsel), and Keelin Ciccariello (Town Counsel). CONVENE IN OPEN SESSION All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order at 12:38 pm. Ms. Mohr made a MOTION to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purpose of: 1. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at 158 Madaket Road where an Open Meeting May have a Detrimental Effect on the Negotiating Position of the Affordable Housing Trust Members and the Chair so Declares; Votes May be Taken. Shantaw Bloise- Murphy seconded the motion; by roll call vote: Shantaw Bloise- Murphy – Aye; Abby De Molina – Aye; Brooke Mohr – Aye; and Chair Sullivan – Aye; so voted. The meeting adjourned at 12:38 pm.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purpose of: Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at 158…
4 yea
Shantaw Bloise-Murphy yea · Abby De Molina yea · Brooke Mohr yea · Sullivan yea
Thu May 7, 2026 · 17:00

Conservation Commission

Nantucket Conservation Commission to weigh Polpis Harbor dredging plan

The Nantucket Conservation Commission will hold public hearings and meetings on several wetland-related projects. Key items include a notice of intent for a dredging plan at Polpis Harbor and Hither Creek, and applications for properties on Hummock Circle, Hoicks Hollow Road, and Polpis Road. The commission will also review a beach management plan at 41 Jefferson Avenue and consider enforcement actions on Baxter Road geotubes and other sites.

conservationwetlandsdredgingpublic-hearingenvironmentcoastal-managementenforcement
✓ Decided: Commission appointed Mike Misurelli as chair pro tem and approved several permits

The Conservation Commission met remotely, appointed Mike Misurelli as chair pro tem and adopted the agenda. It closed SE48‑3977, issued orders of conditions for the Battat property, approved a minor modification for 28 Washington Street, a certificate of compliance for 113 Eel Point Road, and a three‑year extension for the Capaum Pond order. All motions passed unanimously. The minutes from the April meetings were also approved.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, May 7, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote Participation via Zoom Webinar. (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/IpQOZn9JNE4 Zoom Registration: https://us06web.zoom.us/webinar/register/WN_gqPBWMaxTHiCTMUCTyE9FQ NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for Thursday, May 7, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/IpQOZn9JNE4 Zoom Registration: https://us06web.zoom.us/webinar/register/WN_gqPBWMaxTHiCTMUCTyE9FQ *Indicates items not previously opened/discussed I. Call To Order II. Acceptance of the Agenda III. [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes May 7, 2026, adopted May 21, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, May 7, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/IpQOZn9JNE4 Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Vice Chair, Linda Williams Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Braine, Misurelli, Schafer, Turcotte, Plandowski and Williams Absent Members: Engelbourg Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:00:55) Williams makes a motion to appoint Misurelli as Chair pro temp due to Engelborg’s absence. Motion: Motion to appoint Misurelli as chair pro temp: (Made by: Williams) (Seconded by: Schafer) Vote: Vote Carried: 6:0: Braine, Misurelli, Plandowski, Schafer, Turcotte, and Williams (aye) Discussion: (00:01:11) Misurelli notes the continuances Motion: Motion to accept the agenda (Made by: Williams) (Seconded by: Schafer) Vote: Vote Carried: 6:0: Braine, Misurelli, Plandowski, Schafer, Turcotte, and Williams (aye) III. Announcements Discussion: (00:01:30) Misurelli announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
appoint Misurelli as chair pro temp
6 yea
Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
accept the agenda
6 yea
Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
close SE48-3977
6 yea
Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
Wed May 6, 2026 · 16:00

Planning Board

Planning Board meeting for May 6, 2026, cancelled

This meeting of the Nantucket Planning Board has been cancelled. No business was conducted.

cancelled-meetingplanning-board
10 Surfside Road, Nantucket High School , NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CANCELLED MEETING MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) Committee/Board/s PLANNING BOARD Day, Date, and Time WEDNESDAY, MAY 6, 2026, at 4:00PM Location / Address NANTUCKET HIGH SCHOOL MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD, NANTUCKET, MA 02554 Signature of Chair or Authorized Person MEGAN TRUDEL, DEPUTY DIRECTOR OF PLANNING WARNING: IF THERE IS NOT A QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 05-06-2026 (Subject to change ) THIS MEETING HAS BEEN CANCELLED I. Call to order: II. Approval of the agenda: III. Discussion of any technical changes to the Planning Board motions or comments for 2026 Annual Town Meeting: IV. 2026 Annual Town Meeting begins at 4:30PM – in the event necessar [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 6, 2026 · 16:00

Select Board

Nantucket Select Board meeting for May 6, 2026 cancelled

This meeting of the Nantucket Select Board has been cancelled. No items were discussed or decided. The cancellation was posted on April 17, 2026.

cancelledselect-boardnantucketmeeting
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date 04/17/2026 Original Posting # T 288 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MAY 6, 2026, 4:00 PM Location / Address NANTUCKET HIGH SCHOOL, MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD Signature of Chair or Authorized Person ERIKA MOONEY THIS MEETING HAS BEEN CANCELLED
Wed May 6, 2026 · 15:00

Council on Aging

Nantucket Council on Aging to select Senior Man and Woman of 2026

The Nantucket Council on Aging is meeting to conduct official business, including selecting the Senior Man and Senior Woman of 2026 and receiving an update on the Senior Expo. The board will also hear reports from the Saltmarsh Senior Center coordinator and the Deputy Director of Nantucket Health and Human Services, and consider new business and other matters.

council-on-agingseniorsnantucketsenior-expomeeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date _Feb 9, 2026_ Original Posting Number _T 118_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, May 6, 2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person ROBERT M KUCHARAVY, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Approval of minutes of April 1, 2026 V. Official business 1. Select Senior Man and Senior Woman 0f 2026 - COA Board 2. Senior Expo Update - Mary Anne Easley and Erin Lynch VI. Report - Coordinator, Sa [Excerpt truncated on this listing page; use the official record for the full text.]
Wed May 6, 2026 · 16:00

Finance Committee

Finance Committee meeting cancelled

This meeting of the Nantucket Finance Committee, originally scheduled for May 6, 2026, has been cancelled. No business will be conducted.

cancelledfinance-committeenantucket
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date April 30 2026 Original Posting Number T 322 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time WEDNESDAY, MAY 6, 2026 @ 4:00 PM Location / Address NANTUCKET HIGH SCHOOL, MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD Signature of Chair or Authorized Person STEVEN HUNTER THIS MEETING HAS BEEN CANCELLED
Tue May 5, 2026 · 09:00

Sign Advisory Council (HDC)

Sign board to review five sign applications including museum and café signs

The Sign Advisory Council will hold a remote meeting on May 5, 2026, to discuss and decide on five sign applications. Items include a freestanding sign for the Museum of African American History at 29 York Street, a wall sign for Café 22 at 22 Federal Street, master sign plans for 28 Easy Street and 8 Washington Street, and a projecting sign relocation at 14 Federal Street. The council will also adopt minutes from prior meetings and hear public comment.

signssign-advisory-councilhdcnantucketpublic-hearinghistoric-districtsign-permits
✓ Decided: Council approved Robert Young’s Master Sign Plan for 28 Easy St (3‑1 vote)

The Sign Advisory Council approved a Master Sign Plan for 28 Easy Street, with a 3‑1 vote (Kuester opposed). It also unanimously approved revisions to the Museum of African American History sign, held revisions for a wall sign at 22 Federal Street, and approved several other sign applications. All motions were adopted and the meeting adjourned at 10:30 a.m.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, May 05, 2026; 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/4382647590?omn=87146143224 Meeting ID: 438 264 7590 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 438 264 7590 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of Agenda 5. Approval of Minutes: 4/7/26 and 4/28/26 II. PUBL [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC SAC Minutes May 5, 2026; adopted May 12, 2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday May 5, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:08 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Kevin Kuester Absent members: Mark Cutone Late arrivals: none. Early Departures: none. Motion to adopt agenda made by Wolf; seconded by Kuester. Vote: Carried unanimously. Approval of Minutes: 4/7/2026 minutes made by Kuester; seconded by Wolf. Vote: Carried unanimously. Motion to hold 4/28/2026 minutes made by Kuester; seconded by Wolf. Vote: Carried unanimously. II. Public Comment- none III. Commissioner Comments- Discussed looking into Mullen Rule for Advisory Boards. Approved HDC Sign Advisory Council Minutes 5/5/26; adopted 5/12/2026 Signs 1. Museum of African Am. Hist- 14486 29 York Street Freestanding Sign 55.4.1/178 Marsha Fader Discussion: Marsh Fader- agent Dr. Noelle Trent- CEO of the Museum of African American History Fader- submitted proposed image with edge banding and history of signage of site. Dr. Noelle Trent- explained new logo. Kuester- concerned with design of the sign. Explained that sign to identify location, not to advertise, recent trends. Does this sign have grandfathered status? Original sign had certain design characteristics: color, sim [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve 28 Easy St OB- Master Sign Plan
1 nay
Kuester nay
Tue May 5, 2026 · 16:00

Historic District Commission

HDC to review new hotel at 30 N. Beach St., signs, and 30+ old business items

The Historic District Commission meets May 5, 2026, to discuss old business from prior meetings, including sign applications, new buildings, and other structure approvals. The agenda lists over 30 items, with a new hotel at 30 N. Beach St., new dwellings, pools, and hardscapes, plus a ratifying vote from the April 28 meeting.

historic-district-commissionsignsnew-constructionhotelsdwellingspoolsnantucket
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAY 01 AM 10:03 Original Posting Number: T 324 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, May 05, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_7XbSW7VWRJS4ck9cU3VU8w To watch live feed, click here: https://youtube.com/live/736LUPnNFT4 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantu [Excerpt truncated on this listing page; use the official record for the full text.]
Tue May 5, 2026 · 16:00

Finance Committee

Finance Committee meeting set for May 5

The Finance Committee will meet at Nantucket High School to discuss the Annual Town Meeting, which is scheduled to begin at 4:30 PM.

financetown-meetingnantucket
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, MAY 5, 2026 @ 4:00 PM Location / Address NANTUCKET HIGH SCHOOL, MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting ANNUAL TOWN MEETING (starts at 4:30 PM) – if needed
Tue May 5, 2026 · 16:00

Planning Board

Planning Board discusses tech changes for Annual Town Meeting

The Nantucket Planning Board will meet to discuss technical changes to its motions and comments for the 2026 Annual Town Meeting, which begins at 4:30PM. The agenda is otherwise procedural, including call to order and approval of the agenda. No specific rezonings, contracts, or dollar amounts are listed.

planning-boardtown-meetingmotionstechnical-changesnantucket
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) Committee/Board/s PLANNING BOARD Day, Date, and Time TUESDAY, MAY 5, 2026, at 4:00PM Location / Address NANTUCKET HIGH SCHOOL MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD, NANTUCKET, MA 02554 Signature of Chair or Authorized Person MEGAN TRUDEL, DEPUTY DIRECTOR OF PLANNING WARNING: IF THERE IS NOT A QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 05-05-2026 (Subject to change ) I. Call to order: II. Approval of the agenda: III. Discussion of any technical changes to the Planning Board motions or comments for 2026 Annual Town Meeting: IV. 2026 Annual Town Meeting begins at 4:30PM – in the event necessary : V. Adjournment:
Tue May 5, 2026 · 16:00

Select Board

Select Board to convene for Annual Town Meeting

The Select Board is scheduled to meet on May 5, 2026. The primary purpose of the meeting is to facilitate the Annual Town Meeting starting at 4:30 PM, if needed.

town-meetinggovernance
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time TUESDAY, MAY 5, 2026, 4:00 PM Location / Address NANTUCKET HIGH SCHOOL, MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting ANNUAL TOWN MEETING (starts at 4:30 PM) – if needed
Mon May 4, 2026 · 16:00

Finance Committee

Finance Committee meets before Annual Town Meeting

This is a procedural meeting of the Nantucket Finance Committee prior to the Annual Town Meeting. The agenda lists only the Annual Town Meeting starting at 4:30 PM, with no specific items for committee discussion or action.

financetown-meetingprocedural
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time MONDAY, MAY 4, 2026 @ 4:00 PM Location / Address NANTUCKET HIGH SCHOOL, MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting ANNUAL TOWN MEETING (starts at 4:30 PM)
Mon May 4, 2026 · 16:00

Select Board

Select Board to convene Annual Town Meeting

The Nantucket Select Board will meet to formally convene the Annual Town Meeting at 4:30 PM. No other agenda items are listed; the meeting appears procedural to open the Town Meeting.

town-meetingselect-boardproceduralnantucket
10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, MAY 4, 2026, 4:00 PM Location / Address NANTUCKET HIGH SCHOOL, MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting ANNUAL TOWN MEETING (starts at 4:30 PM)
Mon May 4, 2026 · 16:30

Planning Board

Planning Board discusses technical changes to town meeting motions

The Planning Board is meeting to discuss potential technical changes to their motions and comments for the 2026 Annual Town Meeting, which begins immediately after. No specific rezonings, contracts, ordinances, or fee changes are listed on the agenda.

planning-boardannual-town-meetingprocedural
✓ Decided: Planning Board unanimously approves zoning amendment to Article 63

The Board approved the meeting minutes and the agenda, each by unanimous vote. It then unanimously approved the proposed amendment language to Article 63 of the Zoning Bylaw and recommended its adoption. The 2026 Annual Town Meeting was suspended at 10:00 PM and scheduled to resume the next day at 4:00 PM.

10 Surfside Road, Nantucket High School, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) Committee/Board/s PLANNING BOARD Day, Date, and Time MONDAY, MAY 4, 2026, at 4:30PM Location / Address NANTUCKET HIGH SCHOOL MARY P. WALKER AUDITORIUM 10 SURFSIDE ROAD, NANTUCKET, MA 02554 Signature of Chair or Authorized Person MEGAN TRUDEL, DEPUTY DIRECTOR OF PLANNING WARNING: IF THERE IS NOT A QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 05-04-2026 (Subject to change ) I. Call to order: II. Approval of the agenda: III. Discussion of any technical changes to the Planning Board motions or comments for 2026 Annual Town Meeting: IV. 2026 Annual Town Meeting begins at 4:30PM: V. Adjournment:
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 OF 2 PLANNING BOARD APPROVED MINUTES OF 05-04-2026 2026 ANNUAL TOWN MEETING *The Planning Board meeting will be audio and video recorded Board Members: David Iverson, Chair, Nat Lowell Vice-Chair, Joseph Topham, and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (PLUS Administrative Specialist) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ I. Call to order Chair Iverson called the Planning Board meeting to order at 4:02PM. Attendance was taken by roll call: Board Members: Nat Lowell (Vice-Chair), Aye Hillary Rayport, Aye Joseph Topham (not present at roll call) Dave Iverson (Chair), Aye Staff: Leslie Snell, Aye Meg Trudel, Aye William Saad, Aye Catherine Ancero, Aye II. Approval of the agenda: Board made a motion to approve and second the agenda. The motion was approved and seconded, carried unanimously. (Iverson, Lowell and Rayport) III. Discussion of any technical changes to the Planning Board motions or comments for 2026 Annual Town Meeting: The Board briefly discussed the proposed Zoning Bylaw Amendment to Article 63, including the revised language and its intended purpose. Following discussion, the Board voted unanimously to approve the amendment language to Article 63 and recommend its adoption. The motion carried unanimous [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
approve and second the agenda
3 yea
Iverson yea · Lowell yea · Rayport yea
approve the amendment language to Article 63 and recommend its adoption
3 yea
Iverson yea · Lowell yea · Rayport yea
Sat May 2, 2026 · 10:00

Advisory Committee of Non-voting Taxpayers

Advisory Committee to discuss property tax exemption increase

The Advisory Committee of Non-Voting Taxpayers will meet remotely to discuss the potential impacts of increasing the Year-Round Resident Property Tax Exemption and review committee matters.

tax-exemptionproperty-taxcommitteemeetingzoompublic-commentreappointment
✓ Decided: Agenda and minutes approved; meeting adjourned unanimously

The committee approved the meeting agenda and the corrected minutes from the April 11, 2026 meeting, each by unanimous vote. No other substantive actions were decided. The meeting was then adjourned by unanimous motion.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Advisory Committee of Non-Voting Taxpayers Day, Date, and Time Saturday May 2, 2025 at 10 a.m. Location / Address REMOTELY VIA ZOOM; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/@nantucketgov/videos Signature of Chair or Authorized Person Kathy Baird, Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81681188728 Meeting ID: 816 8118 8728 Call to Order This meeting is being audio and video recorded - read statement for Remote Zoom Meeting Membership count for quorum Approval of Agenda for today’s meeting, if quorum present Approval of draft minutes for meeting of April 11, 2026 if quorum present Potential Impacts of Year-Round Resident Property Tax Exemption Increase (NYT Article on RTE) Discussion of other Future Key ACNVT Issues of Concern Open Meeting Law Training, Conflict of Interest Training Status/Responsibilities- Should [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADVISORY COMMITTEE OF NON-VOTING TAXPAYERS Minutes of Public meeting 10:00 am, Saturday, May 2, 2026 1. Attending members: Kathy Baird, Lou Bassano, Gene Briskman, Lynn Filipski, Bill Gardner, Peter Halle, Donna Martino, Steve Perelman, Pamela Suan, Scott Ulm. Members absent: Michael Cody, Patti Deuster, Don Green, Renee Johannensen (Alternate) and Peter Kahn. 2. Chair Peter Halle convened the meeting at 10:04 am and read the Virtual Meeting Script, confirming a quorum was present. 3. The Agenda for today’s meeting was moved for approval, seconded and passed unanimously. 4. Approval of the corrected minutes from the April 11, 2026 meeting was moved, seconded and passed unanimously. 5. Peter H. confirmed that the ACNVT letter regarding our position on Article 11 – Our Island Home had been sent to the town and Nantucket Current. Gene sent a personal letter to the editor of the Inquirer & Mirror on the Martha’s Vineyard facility. 6. Peter H. opened the discussion on potential impacts of Year-Round Resident Property Tax Exemption (taxed on 80% of assessed valuation) increases under consideration by the Select Board. Peter H. noted this as the founding issue for our committee and suggested speaker/speakers be found/scheduled for our meetings when this topic is scheduled for town consideration. 7. Peter requested current members complete their required Open Meeting Law (OML) and Conflict of Interest (COI) Training Status. As a result of what was learned in the [Excerpt truncated on this listing page; use the official record for the full text.]
Fri May 1, 2026 · 15:00

Nantucket Public School Committee

School Committee to hold closed-door teachers union negotiations

The Nantucket School Committee Negotiation Subcommittee will meet on May 1, 2026, solely to adjourn into executive session for collective bargaining with the Nantucket Teachers Association. No public votes or decisions will occur, and the committee will not return to open session. The meeting is closed to the public per Massachusetts law.

school-committeenegotiationscollective-bargainingexecutive-sessionnantucket
30 Surfside Road, NIS Cafeteria, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Friday, May 1, 2026, 3:00 PM Location / Address HYBRID https://zoom.us/j/92269857787 Nantucket Intermediate School, Cafeteria 30 Surfside Road Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session and not return to open session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Fri May 1, 2026 · 10:00

Community Preservation Committee

CPC considers $40,000 funding transfer for Mitchell House roof repairs

The Community Preservation Committee is meeting to consider a technical amendment to Article 34 FY2027. The body will vote on transferring $40,000 from Undesignated Reserves to the Maria Mitchell Association for roof walk repairs.

fundinghistoric-preservationgrantsroof-repairs
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time FRIDAY, MAY 1, 2026 10:00 AM Location / Address ZOOM ONLY Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Public Comment: New Business: 1. Fund Requisition: To consider a technical amendment to Article 34 FY2027, for supplemental funding for Maria Mitchell Association in the amount of $40,000 to be transferred from Undesignated Reserves for the Mitchell House Roof Repairs grant FY 2026, Vote needed to approve the transfer to cover approved roof repairs that now relates to the damaged roof walk. A preservation easement requires the roof walk to remain on the structure. It was severely damaged in February 2026 extreme wind even [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 30, 2026 · 14:00

Planning Board

Planning Board holds pre-Annual Town Meeting conference

The Planning Board is holding a joint meeting with the Select Board. The agenda consists of a pre-Annual Town Meeting conference with the Moderator.

town-meetingplanning-boardselect-board
REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 04-30-2026 JOINT MEETING WITH SELECT BOARD (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Join Zoom Meeting: https://us06web.zoom.us/j/82351877329?pwd=Af1T2tutfh1DV1bmW3PDF0a74kMcTy.1#success Meeting ID: 823 5187 7329 Passcode: 312409 Committee/Board/s PLANNING BOARD Day, Date, and Time Thursday, April 30, 2026, at 2:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/j/82351877329?pwd=Af1T2tutfh1DV1bmW3PDF0a74kMcTy.1#success Signature of Chair or Authorized Person MEGAN [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 30, 2026 · 14:00

Select Board

Board to discuss upcoming Annual Town Meeting with moderator

The Select Board will hold a pre-annual town meeting conference with the moderator to discuss logistics and procedures for the upcoming Annual Town Meeting. No votes or decisions are expected; the session is a preparatory discussion.

select-boardtown-meetingmoderatormeeting-preparation
✓ Decided: Select Board adjourned meeting after unanimous vote

The Nantucket Select Board met via Zoom on April 30, 2026 and reviewed plans for the May 4 Annual Town Meeting. A motion to adjourn was moved by Thomas Dixon, seconded by Dr. Malcolm MacNab, and approved unanimously (4‑0). No other actions or approvals were taken.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time THURSDAY, APRIL 30, 2026, 2:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82351877329?pwd=Af1T2tutfh1DV1bmW3PDF0a74kMcTy.1 Meeting ID: 823 5187 7329 Passcode: 312409 PRE-ANNUAL TOWN MEETING CONFERENCE WITH MODERATOR
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 30, 2026 at 2:00 PM Page 1 of 2 SELECT BOARD Minutes of the Meeting of April 30, 2026. The meeting took place in person via remote participation using Zoom. Members of the Board present were Dawn E. Hill, Thomas Dixon, Dr. Malcolm MacNab and Brooke Mohr. Matt Fee was absent. I. CALL TO ORDER Moderator Sarah Alger called the meeting to order at 2:02 PM. Chair Holdgate called the Select Board to order at 2:05 PM and called roll of those present. Finance Committee Chair Jill Vieth called the Finance Committee to order at 2:05 PM and called roll of those present. There was no quorum of the Planning Board. II. PRE-ANNUAL TOWN MEETING CONFERENCE WITH MODERATOR Ms. Alger reviewed plans for the May 4, 2026 Annual Town Meeting. She reviewed non-voters who will be present at the meeting. Ms. Alger reviewed the articles for the meeting and answered questions from participants. III. ADJOURNMENT Mr. Dixon moved to adjourn the Select Board at 2:50 PM; seconded by Dr. MacNab; by roll call vote: Chair Hill – Yes; Mr. Dixon – Yes; Dr. MacNab – Yes; Ms. Mohr – Yes; so voted. The Finance Committee adjourned at 2:50 PM. Ms. Alger concluded the meeting. Approved the 27 th day of May, 2026. Select Board Minutes of the Meeting of April 30, 2026 at 2:00 PM Page 2 of 2 SELECT BOARD APRIL 30, 2026 – 2:00 PM REMOTE PARTICIPATION VIA ZOOM NANTUCKET, MASSACHUSETTS List of documents used at the meeting: Non [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn the Select Board
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Thu Apr 30, 2026 · 14:00

Finance Committee

Finance Committee holds pre-annual town meeting conference

The Finance Committee is meeting for a pre-annual town meeting conference with the moderator. No other specific business items are listed on the agenda.

financetown-meetingprocedural
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, APRIL 30, 2026 @ 2:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82351877329?pwd=Af1T2tutfh1DV1bmW3PDF0a74kMcTy.1 Meeting ID: 823 5187 7329 Passcode: 312409 PRE-ANNUAL TOWN MEETING CONFERENCE WITH MODERATOR
Thu Apr 30, 2026 · 13:00

Finance Committee

Finance Committee to review technical amendments for 2026 Town Meeting Warrant

The Finance Committee will meet to review and discuss potential motions regarding technical amendments to articles in the 2026 Annual Town Meeting Warrant.

financetown-meetingbudget
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, APRIL 30, 2026 @ 1:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86236352522?pwd=ebFjkvtrtguRxWhHTMoc0IamM56G8x.1 Meeting ID: 862 3635 2522 Passcode: 675419 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review, Discussion and Potential Motions on Technical Amendments to Articles in the 2026 Annual Town Meeting Warrant 6. Committee Reports 7. Other Business 8. Adjournment
Thu Apr 30, 2026 · 15:15

Select Board/County Commissioners

Select Board will discuss collective bargaining strategy with Police Union 330

The Nantucket Select Board/County Commissioners will meet remotely via Zoom on April 30, 2026. An open session will be held, followed by an executive session. In the executive session, the board will discuss strategy regarding collective bargaining with the Police Superior Officers Union 330. No decisions or votes are listed on the agenda.

collective-bargainingpoliceexecutive-sessionremotemeeting
✓ Decided: Board voted to adjourn to executive session to discuss collective bargaining

The Select Board moved to adjourn the open session and enter executive session to discuss strategy regarding the Police Superior Officers Union collective bargaining. The motion was moved by Ms. Mohr, seconded by Mr. Dixon, and approved unanimously by the three members present.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, APRIL 30, 2026 AT 3:15 PM Location / Address REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION Join Zoom Meeting https://us06web.zoom.us/j/94853819503?pwd=NUtYUm9xVk42bURaMlV2S3RINGxUdz09 Meeting ID: 948 5381 9503 Passcode: 376668 II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 3: To Discuss Strategy with Respect to Collective Bargaining (Police Superior Officers Union 330), where an Open Meeting May have a Detrimental Effect on the Bargaining Position of the Select Board/County Commissioners and the Chair so Declares. III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 30, 2026 Page 1 of 2 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of April 30, 2026. The meeting was held remotely via Zoom. Select Board Members present were Dawn E. Hill, Tom Dixon and Brooke Mohr. Matt Fee and Dr. Malcolm MacNab were absent from open session. Operations Administrator Erika Mooney was present remotely. I. CONVENE IN OPEN SESSION Chair Hill called the meeting to order at 3:15 PM. Ms. Mohr moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purpose of: 1. Purpose 3: To Discuss Strategy with Respect to Collective Bargaining (Police Superior Officers Union 330), where an Open Meeting May have a Detrimental Effect on the Bargaining Position of the Select Board/County Commissioners and the Chair so Declares. Seconded by Mr. Dixon; by roll call vote: Chair Hill – Yes; Mr. Dixon – Yes; Ms. Mohr – Yes; so voted. Approved the 13 th day of May 2026. Select Board Minutes of the Meeting of April 30, 2026 Page 2 of 2 SELECT BOARD APRIL 30, 2026 – 3:15 PM REMOTE PARTIICPATION VIA ZOOM NANTUCKET, MASSACHUSETTS List of documents used at the meeting: None.
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A) to discuss strategy with respect to collective bargaining (Police Superior Officers Union 330)
3 yea
Hill yea · Dixon yea · Mohr yea
Wed Apr 29, 2026 · 17:30

County Commission

County Commission to approve payroll and pending contracts

The Nantucket County Commission will meet to approve minutes, payroll warrants, and pending contracts. The meeting will be held at the PSF Community Room and via Zoom.

county-commissionmeetingcontractspayrollpublic-commentzoomnantucket
✓ Decided: Commission approved minutes, payroll warrants and pending contracts

The commission voted to approve the December 17, 2025 meeting minutes, payroll and treasury warrants for January‑April 2026, and pending contracts listed in Exhibit 1. All five members voted yes. The meeting was then adjourned.

📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNTY COMMISSIONERS Day, Date, and Time WEDNESDAY, APRIL 29. 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/9iWXlxhA4-o ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_V-BNGQmQQouL0forZyGu3g I. CALL TO ORDER II. ANNOUNCEMENTS 1. The County Commission Meeting is Being Audio and Video Recorded. III. PUBLIC COMMENT* IV. NEW BUSINESS** V. APPROVAL OF MINUTES, WARRANTS AND PENDING CONTRACTS 1. Approval of Minutes of December 17, 2025 at 5:30 PM. 2. Approval of Payroll and Treasury Warrants for January, February, March and April, 2026. 3. Approval of Pending Contracts for April 29, 2026 - as Set Forth on the Spreadsheet Identified as Exhibit 1, Which Exhibit is Incorporated Here [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
County Commission Minutes of the Meeting of April 29, 2026 at 5:30 PM Page 1 of 2 COUNTY COMMISSIONERS Minutes of the meeting of April 29, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Commission present were Thomas Dixon, Matt Fee, Dawn E. Hill and Dr. Malcolm MacNab. Brooke Mohr participated remotely. I. CALL TO ORDER Chair Dixon called the meeting to order at 5:30 PM following the Pledge of Allegiance. He noted that Ms. Mohr is participating remotely, and all votes will be by roll call. II. ANNOUNCEMENTS 1. The County Commission Meeting is Being Audio and Video Recorded. III. PUBLIC COMMENT There was no public comment. IV. NEW BUSINESS There was no new business. V. APPROVAL OF MINUTES AND WARRANTS Ms. Hill moved approval of items V. 1 - 3; seconded by Mr. Fee; by roll call vote: Chair Dixon – Yes; Mr. Fee – Yes; Ms. Hill – Yes; Dr. MacNab – Yes; Ms. Mohr - Yes; so voted. 1. Approval of Minutes of December 17, 2025 at 5:30 PM. 2. Approval of Payroll and Treasury Warrants for January, February, March and April, 2026. 3. Approval of Pending Contracts for April 29, 2026 - as Set Forth on the Spreadsheet Identified as Exhibit 1, Which Exhibit is Incorporated Herein by Reference. VI. COMMISSIONERS REPORTS/COMMENTS There were no reports or comments. VII. ADJOURNMENT Mr. Fee moved adjournment at 5:31 PM; [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
approval of items V. 1 - 3
5 yea
Dixon yea · Fee yea · Hill yea · MacNab yea · Mohr yea
adjournment
5 yea
Dixon yea · Fee yea · Hill yea · MacNab yea · Mohr yea
Wed Apr 29, 2026 · 17:30

Historic District Commission

HDC to hear appeal on Nonantum Avenue properties with Select Board

The Historic District Commission, jointly with the Select Board, will discuss and possibly decide an appeal (HDC2025-08-13048) concerning properties at 11, 13, 17, and 21 Nonantum Avenue. The agenda contains no other substantive items.

historic-district-commissionpublic-hearingappealshistoric-preservationnantucket
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – with the Select Board Day, Date, and Time Wednesday, April 29, 2026, 05:30pm Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_V-BNGQmQQouL0forZyGu3g#/registration YOU TUBE LINK FOR VIEWING ONLY: https://www.youtube.com/live/9iWXlxhA4-o Commissioners: Stephen Welch (Chair), Rau Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson AGENDA Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. Some applications on this agenda may not be heard a [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 29, 2026 · 17:30

Select Board

Washington Street Stormwater Replacement Project scheduled for May‑June 2026

The Select Board will discuss several agenda items, including the Washington Street Stormwater Replacement Project that runs from May 3 to June 5, 2026 with night and day work and parking bans. The board will also consider public feedback on Vineyard Wind’s debris/infrastructure failure response plan, a request to raise the Airport Fuel Revolving Fund limit to $11,000,000, and a historic preservation restriction review for 6 Broadway. Additional items include noise‑bylaw waivers for a geotechnical soil test and the stormwater project, and a public hearing on a historic district fencing request.

stormwaterairport-fundinghistoric-preservationnoise-waiverpublic-hearingtown-meeting
✓ Decided: Board deemed Pedro a dangerous dog and ordered leashing and behaviorist evaluation

The Select Board voted to classify the dog Pedro as dangerous, requiring the owner to have the dog leashed or harnessed at all times and to obtain a professional behaviorist assessment with a training plan. The Board also approved the minutes, payroll and treasury warrants, accepted a zoning board resignation, increased the airport fuel fund limit, and approved several noise‑bylaw waivers and a historic preservation review.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, APRIL 29, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/9iWXlxhA4-o ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_V-BNGQmQQouL0forZyGu3g I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Announce Applications Received for Planning Board Vacancy; Appointment to be Made by Select Board/Planning Board at May 20, 2026 Select Board Meeting. 3. 2026 Annual Committee/Board/Commission Vacancies and Appointment Timeline; Committee Appointment Process: Boards, Commissions & Committees | Nantucket, MA - Official Website. 4. May 4, 2026 Annual Town Mee [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 29, 2026 at 5:30 PM Page 1 of 7 SELECT BOARD Minutes of the meeting of April 29, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Matt Fee, Thomas Dixon and Dr. Malcolm MacNab. Brooke Mohr participated remotely. I. CALL TO ORDER Chair Hill called the meeting to order at 5:32 PM following a meeting of the County Commission. She noted that Ms. Mohr is participating remotely, therefore all votes will be taken by roll call. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson and Operations Administrator Erika Mooney reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Announce Applications Received for Planning Board Vacancy; Appointment to be Made by Select Board/Planning Board at May 20, 2026 Select Board Meeting. Ms. Mooney announced the three applicants for the Planning Board vacant seat: Liza Hatton, Clay Evans and Campbell Sutton. 3. 2026 Annual Committee/Board/Commission Vacancies and Appointment Timeline; Committee Appointment Process: Boards, Commissions & Committees | Nantucket, MA - Official Website. Ms. Mooney reviewed the committee appointment information. 4. May 4, 2026 Annual Town Meeting Starts Monday [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approval of items VII 1 – 3 (Minutes of April 15, 2026; Payroll Warrants for April 26, 2026; Treasury Warrants for April 22, 2026 and April 29, 2026)
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
accept the resignation of Mark Poor from the ZBA as an Alternate
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Airport: Request to Increase Fuel Revolving Fund Spending Limit from $8,500,000 to $11,000,000
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Tue Apr 28, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank Commission meets to review golf, farm, and property management

The Nantucket Islands Land Bank Commission will convene to review monthly operations for golf courses and farms, authorize contracts for invasive species management, and discuss property matters including a chicken coop and parking. The meeting includes a public comment period and approval of prior meeting minutes.

land-bankgolfagricultureproperty-managementpublic-meeting
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, April 28, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/89758444312?pwd=4lPrNakJWEmdzYjtGuo3gay9ZRHbUI.1 Webinar ID: 897 5844 4312 Passcode: 605718 Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. GOLF BUSINESS a. Sconset Golf Course – Monthly Review b. Miacomet Golf Course – Monthly Review c. Warrant Authorization – Golf Capital Funds Transfer Request d. Golf Committee Membership – Recommendations e. Event Request – Fundraising Dinner 4. AGRICULTURAL MANAGEMENT a. 160 H [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 28, 2026 · 16:00

Historic District Commission

Historic District Commission to review numerous property and sign applications

The Historic District Commission is meeting to review a large volume of applications for residential and commercial alterations, including new dwellings, solar installations, and signage. Commissioners will also discuss changing the vote quantum for demolition permits.

zoninghistoric-preservationsolarsignagedemolition
✓ Decided: Historic District Commission unanimously approved demolition of first floor and storage building relocation for Land Bank project

The commission approved the meeting agenda and all listed consents. It approved consents with conditions for six applications, ratified the summer meeting schedule, and approved several project applications, including a rooftop solar installation and a multisport court. The board also approved a modification for the Land Bank to demolish the first floor of Unit 1 and relocate the storage building, with the motion passing unanimously.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 APR 24 PM 02:00 Original Posting Number: T 310 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, April 28, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_i9Pk7YKZRG-hkyK5Xv09RQ To watch live feed, click here: https://youtube.com/live/11PVvcMAN_0 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, click here. * [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes April 28, 2026; adopted May 26, 2026 HISTORIC DISTRICT COMISSION Minutes April 28, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn and Holly Backus In person Welch, Pohl, Oliver and MacLeod Zoom: Paul and Thornewill Camp and Patten absent Meeting called to order at 4:14 pm by Stephen Welch Board: Welch, Pohl, MacLeod, Oliver and Thornewill Thornewill made the motion to approve the agenda with moving # 30 Nantucket Land Bank 41 Jefferson to beginning of 4/7/2026 applications Motion carries unanimously I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. 138 Miacomet Rd, LLC 14406 138 Miacomet Rd Open air structure 81/6.2 Thornewill Design AC 2. NHA Properties Inc 14533 75B Old South Rd New Dwelling 68/999.1 K Megna CT 3. Baybutt, Marylou 14536 33 Dartmouth Rd Replace doors 76.4.2/378 Val Oliver Design CT 4. Bernard, Alfred 14535 74 Orange St Parking fence 55.4.1/26 Val Oliver Design CT 5. Faros Properties 14529 23 Madaket Rd Roof change 41/303 T&T Roofing CT 6. John Lineman 14564 7 Pine Grove Rd Window replacement 67/244 Greg Mazares CT 7. 26 Pine Crest LLC 14532 26 Pine Crest Fence 68/426 EMDA CT 8. 11 Nancy Ann Ln LLC 14534 11 Nancy Ann Ln Windows 68/136 EMDA CT 9. DSM Su [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 28, 2026 · 12:30

Affordable Housing Trust

Trust to approve Habitat for Humanity agreement for 20 Nancy Ann Lane development

The Nantucket Affordable Housing Trust will consider approving a Memorandum of Understanding and a Grant and Loan Agreement with Habitat for Humanity Nantucket, Inc. for the acquisition of 20 Nancy Ann Lane and the development of four affordable single‑family homes. The Trust will also accept a perpetual Affordable Housing Restriction on that property. An executive session will be held to discuss the purchase, exchange, lease, or valuation of real property at 158 Madaket Road.

affordable-housinghousing-developmenthabitat-for-humanityproperty-acquisitionexecutive-sessiontown-meeting
✓ Decided: Trust approves Habitat for Humanity deal to build four affordable homes

The Affordable Housing Trust approved the memorandum of understanding and grant and loan agreement with Habitat for Humanity Nantucket to acquire 20 Nancy Ann Lane and develop four affordable single‑family homes. The agreement includes a perpetual affordable‑housing restriction on the property and authorizes the Chair to execute related documents. The Trust also approved the meeting agenda and voted to adjourn to an executive session to consider a possible transaction at 158 Madaket Road.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, April 28, 2026, at 12:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, APRIL 28, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/84183921190?pwd=pvHU8p808RaaQ0pSWsUyIVwtEwC65F.1 Meeting ID: 841 8392 1190 Passcode: 387575 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. PUBLIC COMMENT* V. HOUSING DEPARTMENT REQUESTS/REPORTS 1. Request for Approval and Execution of (a.) Memorandum of Understanding and (b) Grant and Loan Agreement with Habitat for Humanity Nantucket, Inc., for its acquisition of 20 Nancy Ann Lane a [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on April 28, 2026, at 12:30 PM Approved the19th of May 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, April 28, 2026 Remote Meeting via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice- Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Brian Sullivan, Brooke Mohr, Mary Mack, and Abby De Molina joined remotely. Staff members present were Kristie Ferrantella (Housing Director), Dylan Metsch-Ampel (Deputy Housing Director) , Caroline Ferguson (Administrative Specialist) , Vicki Marsh (Town Counsel), and Eric Barth (Town Counsel). Speaker(s) present was Stephen Maury (Habitat for Humanity Nantucket). All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order 12:33 PM. II. ACCEPTANCE OF AGENDA Vice-Chair Dey made a MOTION to approve the agenda. Ms. Mack seconded the motion; by roll call vote: Brian Sullivan – Aye; Mary Mack – Aye; Brooke Mohr – Aye; Penny Dey – Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. PUBLIC COMMENT There was no public comment. V. HOUSING DEPARTMENT REQUESTS/REPORTS 1. Request for Approval and Execution of (a.) Memorandum of Understanding and (b.) Grant and Loan Agreement with Habitat for Humanity Nantucket, Inc., for its acquisition of 20 Nancy Ann Lane and its development of four (4) affordable single [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
4 yea
Brian Sullivan yea · Mary Mack yea · Brooke Mohr yea · Penny Dey yea
approve and execute the Memorandum of Understanding and Grant and Loan Agreement with Habitat for Humanity Nantucket, Inc., for its acquisition of 20 Nancy Ann Lane and its development of four (4)…
4 yea
Brooke Mohr yea · Brian Sullivan yea · Mary Mack yea · Penny Dey yea
adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purpose of: 1. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at…
4 yea
Brooke Mohr yea · Mary Mack yea · Brian Sullivan yea · Penny Dey yea
Tue Apr 28, 2026 · 10:00

Coastal Resilience Advisory Committee

Committee to hear staff explain 2026 Town Meeting articles on coastal resiliency

The Coastal Resilience Advisory Committee will hear town staff explain several 2026 Annual Town Meeting articles related to coastal resiliency. Members will also discuss their 2026 resiliency goals and potential recommendations for the Select Board. A recap of a Retreat and Relocation Workshop is scheduled.

coastal-resiliencetown-meeting-articlesstormwatersustainabilityretreat-and-relocationadvisory-committee
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, March 28, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, March 24, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. A moment of silence in memory of Gary Beller 4. Public Comment 5. Approval of Minutes 6. 2026 Annual Town Meeting articles related to coastal resiliency explained b [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 28, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews 13 sign applications

The Sign Advisory Council will hold a remote meeting on April 28, 2026, to review 13 new sign applications for properties across Nantucket, including freestanding, projecting, and window signs. The council will also discuss setting 1-, 2-, and 3-year terms for members. No minutes from previous meetings are available for approval.

signspermitsnantuckethistoric-districtzoning
✓ Decided: Council approved multiple sign applications, notably a Center St projecting sign

The Sign Advisory Council approved several sign requests, including a projecting sign for NIR Retail at 23 & 25 Center Street and a hanging sign for Robert Young on Easy Street. It also approved signs for The Makery, Melissa Dudley, and Georgine Anton. Other applications were held for revisions or further review.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 APR 22 AM 10:12 Original Posting Number: T 296 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, April 28, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign View pack, click here. Listed below are the topics the chair reasonably anticipates and will be discussed at the meeting. I. PRO [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC SAC Minutes April 28, 2026; adopted 5/19/26 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday April 28, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:03 am. Attending members: Chris Young, Ben Normand, Mark Cutone, Paul Wolf, Kevin Kuester Absent members: None Late arrivals: Kevin Kuester at 10:05am and Paul Wolf at 10:13 am Early Departures: Ben Normand at 10:02 am and Mark Cutone at 10:05 am Motion to adopt agenda made by Cutone; seconded by Normand. Vote: Carried unanimously. Approval of Minutes: N/A II. Public Comment- none III. Commissioner Comments-none HDC Sign Advisory Council minutes 4/28/26; adopted 5/19/26 Signs 1. Museum of African Am. Hist- 14486 29 York Street Freestanding Sign 55.4.1/178 Marsha Fader Agent: Marsha Fader- Architect for MAAH Alexia Layne-Lomon- Director of Development and Communication for the MAAH for Bostonand Nantucket. Discussion: Cutone- concerned logo should be understated (15%) of the field, Boston - Nantucket, frame, border edge banding. Wolf-agrees with Cutone; logo is large. Kuester-grandfathered signs- the Intention was to maintain the historic sign. Young- any of the historic sites like the NHA, Atheneum don’t have this type of representation. It feels commercial in a residential neighborhood. Concerned with design as setting a precede [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approve 28B Easy St Hanging Sign
1 nay
Kuester nay
MTA for "preferred" design with the independent fonts, molding applied to the armature, drop the #8 down to fill void and drop "Sal Amore" down
1 nay
Kuester nay
approve 10 Main St- Sconset Projecting Sign
1 nay
Kuester nay
Tue Apr 28, 2026 · 10:00

Community Preservation Committee

CPC to vote on $580K in fund requisitions and Heifer Barn reallocation

The Community Preservation Committee will consider fund requisitions totaling over $580,000 for projects including the Mitchell House re-roof, PickleBall/Padel courts, rental assistance, and a handicap ramp. They will also vote on a request from NISDA to reallocate funding for Heifer Barn, and hear a quarterly update on CPC bond fund expenditures. Additionally, they will discuss office move/staffing and approve minutes from previous meetings.

community-preservationfund-requisitionsheifer-barnmaria-mitchellpickleballrental-assistancehistoric-preservationhousing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time TUESDAY, APRIL 28 2026 10:00 AM Location / Address 131 PLEASANT STREET – ROOM A (HYBRID) Remote Participation via Zoom Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Approval of Minutes 7/23/2025, 9/16/2025, 10/29/2025, 11/5/2025, 12/16/2025, 2/17/2026, 3/17/2026 Public Comment Correspondence/Guest: NISDA Kathy Kelm NISDA – Discussion about reallocation of funding regarding Heifer Barn. Vote on request Guests: Jacin Leonardo-Finger – Maria Mitchell issues with roof-walk on the Mitchell House Dylan Metcsh-Ampel, Deputy Director of Housing – quarterly presentation regarding CPC bond funds expenditures New Business: [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026 · 17:00

Nantucket Planning & Economic Development Commission

Commission to authorize contract for UMDI population study

The Nantucket Planning & Economic Development Commission will consider authorizing the Director to sign a contract for the University of Massachusetts Donohue Institute population study. It will also consider authorizing 21‑day public review periods for a Transportation Improvement Program amendment that shifts flex highway program funding to support an automatic vehicle location and passenger count system for fixed‑route buses, and for the draft TIP for FY 2027‑2031.

population-studytransportationfundingpublic-reviewplanning
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Monday, April 27, 2026 at 5:00 pm Location / Address Remote Participation via Zoom https://us06web.zoom.us/j/87671485712?pwd=tubm09naBQMhXtJarQqNdHbu TQQBB7.1 Signature of Chair or Authorized Person Leslie Snell, AICP, Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGENDA This meeting is being audio/video recorded and will be uploaded to the Town of Nantucket YouTube page at a later date. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Public Comment for items not included on the agenda: V. Announcements: • Meeting date schedule changes: • TPAC Appointments, 6-At Large positions appointed by the Town Manager. Applications due to Town Administration either in person or via email to [email protected] by Friday, May 8th at noon. • May- from Monday, May 18th at 5pm to Thursday, May 28th at 5pm • June – from Monday, June 22nd at [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 27, 2026 · 11:00

Select Board

Public hearings on multiple utility conduit projects across town

The Select Board will consider several licensing manager changes and a license surrender, approve a public entertainment license for Figawi Charities, and hold public hearings on numerous utility conduit installation petitions submitted by Nantucket Electric Company/National Grid and Verizon New England. These items involve changes to alcohol beverage licenses, a one‑day entertainment permit, and underground electrical infrastructure projects.

licensingutilitiesentertainmentpublic-hearingsinfrastructure
✓ Decided: Board approved liquor manager changes, event permits and new licenses

The Select Board voted to approve several changes of managers for existing alcohol licenses, accepted the surrender of one restaurant license, and granted public entertainment permits for a Figawi charity event and three Nantucket Historical Association gatherings with attendance caps and parking requirements. It also approved a change of license category for the Siasconset Golf Course and a new seasonal common victualler license for Oswack Associates. All motions passed by roll‑call vote as recorded.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 AMENDED MEETING POSTING Original posting date: 4/23/2026 Original Posting # T 299 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, APRIL 27, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/5fCcb5_pg6I ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_UWd0r6rwSyasphDPZlzZKQ I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Request for Approval of Application for Change of Manager for Annual All-Alcoholic Beverages Restaurant License for Overlook Restaurant, LLC dba Nantucket Fairgrounds from Karen Cingolo, Manager to Ryan Murray, Manager, for Premises Located at 27 Fairgrounds Road. 2. Request for Approval of Application for Change of Manager of Annual All-Alc [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 27, 2026 Page 1 of 10 SELECT BOARD Minutes of the meeting of April 27, 2026. The meeting took place by remote participation via Zoom Webinar. Select Board Members present were Dawn E. Hill, Tom Dixon, Dr. Malcolm MacNab and Brooke Mohr (arrived late as noted below). Matt Fee was absent. Also present were Operations Administrator Erika Mooney, Licensing Administrator Amy Baxter, Culture and Tourism Director Shantaw Bloise-Murphy, Cultural Affairs and Special Events Coordinator Deana Weatherly and Real Estate Specialist Robert Bystrowski. I. CALL TO ORDER Chair Hill called the meeting to order at 11:01 AM. II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS Ms. Baxter noted that her office has put together more liquor license guidance for all license holders to ensure that liquor license managers understand the responsibilities of being a manager. Ms. Mohr joined the meeting at 11:03 AM. 1. Request for Approval of Application for Change of Manager for Annual All-Alcoholic Beverages Restaurant License for Overlook Restaurant, LLC dba Nantucket Fairgrounds from Karen Cingolo, Manager to Ryan Murray, Manager, for Premises Located at 27 Fairgrounds Road. Ms. Baxter reviewed the request. Ms. Mohr moved approval; seconded by Mr. Dixon; by roll call vote: Chair Hill – Yes; Mr. Dixon – Yes; Dr. MacNab – Yes; Ms. Mohr – Yes; so voted. 2. Requ [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (9 roll-call votes)
Named votes as recorded in the official record.
Approval of Application for Change of Manager for Annual All-Alcoholic Beverages Restaurant License for Overlook Restaurant, LLC dba Nantucket Fairgrounds from Karen Cingolo, Manager to Ryan Murray…
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Approval of Application for Change of Manager of Annual All-Alcoholic Beverages Restaurant Hotel License for VTT Nantucket Inn LLC dba Nantucket Inn from Shawn Cioto, Manager to Harold Jones, Manager
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Approval of Application for Change of Manager of Seasonal All-Alcoholic Beverages Club License for Sankaty Head Beach Club Inc dba Sankaty Head Beach Club from Lori Snell, Manager to Kimberly…
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Approval of Application for Change of Manager of Annual All-Alcoholic Beverages Hotel License for The Restaurant at Easton Street, LLC dba Breeze Bar and Cafe from Carlos Castrello, Manager to Bryan…
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Acceptance of Surrender of Annual All-Alcoholic Beverages Restaurant License #03217-RS-0762 from C. Noble, LLC dba The Charlie Noble
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Approval of Massachusetts “License for Public Entertainment on Sunday” for May 24, 2026 for Figawi Charities Inc.
4 yea
Hill yea · Dixon yea · MacNab yea · Mohr yea
Close the hearing for Nantucket Historical Association’s “Baskets, Bubbles & Bourbon”
3 yea
Hill yea · Dixon yea · Mohr yea
Approve the event [Nantucket Historical Association’s “Baskets, Bubbles & Bourbon”] with conditions: cap of 250 attendees, valet parking at York Street and/or off-site parking with shuttle service…
3 yea
Hill yea · Dixon yea · Mohr yea
Close the hearing for Nantucket Historical Association’s “Nantucket by Design” Opening Party
3 yea
Hill yea · Dixon yea · Mohr yea
Fri Apr 24, 2026 · 09:00

Contract Review Committee, Human Services

Committee to review Human Services and Substance Misuse Grant for FY27

The Nantucket Contract Review Committee will meet remotely on April 24, 2026, to review the Human Services and Substance Misuse Grant recommendation for Fiscal Year 2027. They will also discuss changes to the grant process, including a date for the award ceremony, and review funding requests for FY28. Additionally, the committee will discuss ATM Warrant 69 and receive an update on the Needs Assessment project.

human-servicesgrantssubstance-misusebudgetcontract-reviewnantucket
✓ Decided: Committee approved agenda, minutes, funding variation, and quarterly reports

The Contract Review Committee accepted the meeting agenda and approved the minutes from 11/14/2025, 11/21/2025, and 2/6/2026. It approved Fairwinds’ proposed variation in funding and approved all Q3 quarterly reports as submitted. The meeting was then adjourned.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CONTRACT REVIEW COMMITTEE Day, Date, and Time FRIDAY, APRIL 24TH, 2026, AT 9:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM 131 PLEASNT STREET: ROOM B The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK AT-LARGE/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/85374228575?pwd=JWgRNNX1XzGUwWGeiCVab03g0Yb22T.1 Meeting ID: 853 7422 8575 Passcode: 748236 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Public Comment IV. Approval of Minutes from 11/14/2025, 11/21/2025 & 2/6/2026 V. Review of Human Services and Substance Misuse Grant recommendation FY 27 VI. Review FY 27 Grant Process and recommendations for changes, including date for Grant Award ceremony VII. Discussion of ATM Warrant 69 VIII. Discussion on funding request for FY 28 IX. Review and Approve Quarterly Reports X. Update on Needs Assessment project XI. New Business* XII. Next Meeting Date XIII. A [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Contract Review Committee Meeting Town of Nantucket 131 Pleasant Street Nantucket, MA, 02554 www.nantucket-ma.gov Contract Review Committee: Veronica Bolcik (Chair), Joanna Roche (Vice Chair & FinCom Rep), Linda Williams (At-Large), John W. Belash (At-Large), Lee Tesser (At- Large) Suzanne Keating (CHS Rep) Staff: Jerico Mele (Human Services Director), Alexandria Richards (Office Manager) ˜˜MINUTES˜˜ Friday, April 24, 2026 131 Pleasant St, Trailer Room B This meeting was held in person with remote participation using ZOOM and YouTube. Attendance: Veronica Bolcik, Suzanne Keating, Lee Tesser, John Belash, Linda Williams(9:05am) Staff: Jerico Mele, Alexandria Richards Members of the Public: Kristie Wilson & Roberto Santamaria (Fairwinds), Marcos Alcorn (Kulik Strategic Advisors) I. Establish Quorum Quorum was established with attendance at 9:05 am. II. Acceptance of Agenda John made a motion to accept the agenda, it was seconded by Lee and accepted by all members in attendance. III. Public Comment No comment. IV. Approval of Minutes from 11/14/2025, 11/21/2025 & 2/6/2026 Suzanne made a motion to approve all minutes as submitted, it was seconded by John and accepted by all members in attendance. V. Review of Human Services and Substance Misuse Grant recommendation FY 27 FinCom supported the warrant article with the current grant recommendations. Things will start getting busier in July for the new fiscal year FY27. Jerico is lo [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Apr 24, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The Washington Street Collaborative Work Group scheduled for April 24, 2026 was cancelled. No agenda items were discussed or decided at this meeting.

cancellationnantucketlocal-governmentcollaborative-workgroupcoastal-resilience
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, April 24, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/82209999469?pwd=7ziqFM1tcY0vIEFKMblhKOF3xcRGPp.1 Meeting ID: 822 0999 9469 Passcode: 394349 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Thu Apr 23, 2026 · 17:00

Parks and Recreation Commission

Parks commission to discuss artificial turf moratorium, Nobadeer project

The Commission will hear a report from the Parks and Recreation Manager including updates on the Nobadeer Project, Tom Nevers Debris Removal Phase 1, and a discussion about the Board of Health meeting on an artificial turf installation moratorium. Culture and Tourism will review planned summer activities at Children's Beach and the Nantucket Wellness Festival. The meeting will also include approval of previous minutes and public comment.

parksrecreationartificial-turfmoratoriumnobadeer-projecttom-neverschildrens-beachnantucket
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday, April 23, at 5:00 p.m. Location / Address REMOTE PARTICIPATION ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW.1 Meeting ID: 817 4815 2269 Passcode: 983395 Nantucket Parks and Recreation Commission Meeting Notice and Agenda Thursday, April 23 2026 Meeting to be held at 5:00 p.m. Remotely Via Zoom. Adjourn 4/16/26 Parks Commission Meeting 1. Call to Order 2. Reminder this meeting is being audio and video recorded 4. Approval of Agenda for April 23, 2026 5. Public Comment 6. Approval of Minutes from March 16 2026 2 7. Culture and Tourism: Deana Weatherly -Cultural Affairs and Special Events Coordinator • Community School Line Dancing Class 7/7/26-7/28/26 [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 23, 2026 · 17:00

Conservation Commission

Commission will hear revisions to Nantucket Wetlands Protection Regulations

The Nantucket Conservation Commission will hold a public hearing to discuss proposed changes to the Town's Wetlands Protection Regulations (Chapter 390). The agenda also includes routine items such as call to order, agenda acceptance, announcements, and staff reports. No other specific decisions are listed for this meeting.

wetlandsenvironmentregulationspublic-hearingconservation
✓ Decided: Commission approved agenda and ordered staff to forward definition drafts to Town Council

The Conservation Commission accepted the meeting agenda with a unanimous 4‑0 vote. Commissioners discussed updates to the Wetlands Protection Regulations and considered new definitions for temporary shade apparatuses and bioengineered materials. The Commission directed staff to send those definition drafts to the Town Council for review before a future hearing. No other motions were adopted.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, April 23, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote Participation via Zoom Webinar. (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/KHvc6Z_dzWA Zoom Registration: https://us06web.zoom.us/webinar/register/WN_0UcsZg0xTdCoAfKW0kwPxw NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for Thursday, April 23, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/KHvc6Z_dzWA Zoom Registration: https://us06web.zoom.us/webinar/register/WN_0UcsZg0xTdCoAfKW0kwPxw *Indicates items not previously opened/discussed I. Call To Order II. Acceptance of the Agenda [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes April 23, 2026, adopted May 7, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, April 23, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/KHvc6Z_dzWA Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Turcotte, Plandowski and Williams Absent Members: Braine, Misurelli, Schafer Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:05) Engelbourg takes a role call of Commissioner’s present and asks for a motion to accept the agenda. Motion: Motion to accept the agenda (Made by: Williams) (Seconded by: Plandowski) Vote: Vote Carried: 4:0: Engelbourg, Plandowski, Turcotte, and Williams (aye) III. Announcements Discussion: (00:01:24) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:01:42) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:01:50) none VI. Public Hearing 1. Discussion of Revision of the Town of Nantucket Wetlands Protection Regulations (Chapter 390) Discussion: (00:0 [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
accept the agenda
4 yea
Engelbourg yea · Plandowski yea · Turcotte yea · Williams yea
Thu Apr 23, 2026 · 14:00

Capital Program Committee

Capital committee to amend Harbormaster and sewer capital projects

The Capital Program Committee will consider technical amendments to the General Fund and Enterprise Capital budgets, including adding a Harbormaster mooring buoy/maintenance boat, increasing Harbormaster Building funding, and adding a Fairgrounds Road sewer upgrade. The committee will also discuss criteria for ranking capital project priorities.

capital-programharbormastersewerinfrastructurenantucket
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 4/17/2026 10:49 AM Original Posting Number T 289 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Capital Program Committee Day, Date, and Time Thursday, April 23, 2026 @ 2:00 PM Location / Address IN-PERSON PARTICIPATION at 131 Pleasant Street, Room A (Trailer) REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Susan M. Carmel WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81635402073?pwd=a0pF5syXqTwHEbX1RMauUqyvJbqIS4.1 Meeting ID: 816 3540 2073 Passcode: 543324 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Approval of Minutes from February 17, 2026 6. Article 10 General Fund Capital: Technical Amendment – addition of Harbormaster Mooring Buoy/Maintenance Boat 7. Article 10 General Fund Capital: Technical Amendment – Harbormaster Building funding increase 8. Article 19 Enterprise C [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 23, 2026 · 12:00

Council for Human Services

Council for Human Services to review FY 27 grant process and ATM Warrant 69

The Council for Human Services will discuss the grant process for FY 27 and preliminary preparations for FY 28. The body will also receive an update on a Needs Assessment and review ATM Warrant 69.

human-servicesgrantsbudgetneeds-assessment
✓ Decided: Council approved agenda, minutes and scheduled next meeting for May 28

The council unanimously accepted the agenda. They also unanimously approved the minutes from February 12, 2026. Members up for re‑appointment must submit applications by May 8 noon, and all members are required to complete conflict‑of‑interest training. The next meeting was scheduled for May 28 at noon, and the council adjourned at 1:44 p.m.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL FOR HUMAN SERVICES Day, Date, and Time THURSDAY, APRIL 23RD, 2026, AT 12:00 PM Location / Address  131 PLEASANT ST: ROOM B  REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! JOIN ZOOM MEETING: https://us06web.zoom.us/j/82796789140?pwd=DxKSyqDecFaarU74BZnIlZP0jdbL9b.1 Meeting ID: 827 9678 9140 Passcode: 868111 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Approval of Minutes from 2/12/2026 IV. Public Comment V. Review of Grant Process FY 27 and preliminary preparation for FY 28 VI. Update on Needs Assessment with on-site visits to take place May 4 thru 8, 2026. VII. Human Services Director Report VIII. Community Human Services items for by CHS members IX. Review ATM Warrant 69 X. New Business* XI. Next meeting date XII. Adjournment *FOR MATTERS NOT REASONABLY ANTICIPATED 48 HOURS PRIOR TO THE MEETING
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Council For Human Services Meeting Town of Nantucket 131 Pleasant Street Nantucket, MA, 02554 w ww.nantucket-ma.gov Council for Human Services Members: Veronica Bolcik (Chair), Sarah Wright (Vice- Chair), Sue Mynttinen, Suzanne Keating, Tara Restieri, Kelly Steffen, Claudia Valle, Amanda Wright, Health and Human Services Staff: Jerico Mele (Human Services Director), Alexandria Richards (Office Manager) ˜˜MINUTES˜˜ Thursday, April 23rd, 2026 131 Pleasant St, Trailer A This meeting was held in hybrid fashion with remote participation using ZOOM Attendance: Amanda Wright, Veronika Bolcik, Sue Mynttinen, Tara Restieri, Sarah Wright (left at 12:44pm), Kelly Steffen, Suzanne Keating Staff: Alexandria Richards Public: Marcos Alcorn, Tracy Kulik (Kulik Strategic Advisors) I. E stablish Quorum Quorum was established at 12:03pm with attendance. II. A cceptance of Agenda Sue made a motion to accept the agenda. It was seconded by Amanada and accepted by all members in attendance. III. A pproval of Minutes from 2/12/2026 Sue made a motion to approve minutes from 2/12/2026 it was seconded by Suzanne and accepted by all members in attendance. IV . Public Comment No comment. V. R eview of Grant Process FY 27 and preliminary preparation for FY 28 Veronica gave updates on the FINCOM meeting confirming Grant recommendations are on the warrant for the Annual Town Meeting. In early July the FY28 funding request letter will be sent to the town requesting an increase for Grants. [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 21, 2026 · 17:00

Harbor & Shellfish Advisory Board

Board to discuss eelgrass management priorities and scallop apprenticeship guidelines

The Nantucket Harbor & Shellfish Advisory Board will discuss updates to the eelgrass management plan, review commercial scalloping apprenticeship guidelines, and discuss Chapter 91 licensing compliance. The meeting also includes a report from the Marine Department and Natural Resources staff. A public comment period is scheduled for marine and natural resources topics.

harborshellfisheelgrassscallopingchapter-91diesel-fuelnatural-resources
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, April 21, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting – https://us06web.zoom.us/j/87033499306?pwd=vyaEKEiqGHXpxEuDxNWqtlCXOy940K.1 Meeting ID: 870 3349 9306 Password: 143745 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, April 21, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/87033499306?pwd=vyaEKEiqGHXpxEuDxNWqtl CXOy940K.1 Meeting ID: 870 3349 9306 Password: 143745 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of March 17, 2026 and April 7, 2026 CHAIRMAN’S REPORT May 5, 2026 Annual Town Meeting MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NAT [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 21, 2026 · 12:30

Affordable Housing Trust

Affordable Housing Trust to review property acquisitions and license agreements

The Affordable Housing Trust will review bids and license agreements for several properties. The board will also consider the purchase, exchange, lease, or value of four specific real estate locations during an executive session.

affordable-housingreal-estatezoningpublic-contracts
✓ Decided: Trust approves license agreement for Orange Street and Bartlett Road properties

The Affordable Housing Trust amended the agenda to remove an open‑session item and approved the change by unanimous roll‑call vote. The Trust also approved and authorized execution of the license agreement for 135 & 137 Orange Street and 12 & 12R Bartlett Road, with all members voting aye. Finally, the board voted to adjourn to executive session to consider several real‑property matters, again with unanimous approval.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, April 21, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, APRIL 21, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89243722122?pwd=q3T4GrZVBtz4GUbOxWUJu68vfEqoNK.1 Meeting ID: 892 4372 2122 Passcode: 461305 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. UPDATE ON PUBLIC COMMENT QUESTIONS FROM PRIOR MEETINGS V. PUBLIC COMMENT* VI. NEW BUSINESS** VII. DR. HOWARD DICKLER CITIZEN [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on April 21, 2026, at 12:30 PM Approved the 19th day of May 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, April 21, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present : Brian Sullivan. Brooke Mohr, Forest Bell, Mary Mack, Shantaw Bloise-Murphy, and Abby De Molina joined remotely. Staff members present were Dylan Metsch- Ampel (Deputy Housing Director) and Caroline Ferguson (Administrative Specialist) . Kristie Ferrantella (Housing Director), Brian Turbitt (Finance Director), Tracy MacDonald (Real Estate Manager), Vicki Marsh (Town Counsel), Eric Barth (Town Counsel), and Keelin Ciccariello (Town Counsel) joined remotely. All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order at 12:30 PM. Chair Sullivan said that he is going to recuse himself from all agenda items related to 1 Toombs Court going forward. II. ACCEPTANCE OF AGENDA Mr. Metsch -Ampel asked that the agenda be amended to remove Open Session Agenda Item VIII.1 Review of 71 Surfside Road Invitation for Bid (IFB) and Executive Sesson Item 4. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at 1 Toombs Court where an Open Meeting may have a Detrimental Effect on the Negotiating Position [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approve the agenda as amended
4 yea
Mary Mack yea · Brooke Mohr yea · Forest Bell yea · Brian Sullivan yea
Approve and Execute the License Agreement Subject to Review by Town Counsel
6 yea
Mary Mack yea · Abby De Molina yea · Forest Bell yea · Shantaw Bloise -Murphy yea · Brooke Mohr yea · Brian Sullivan yea
adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session
6 yea
Mary Mack yea · Brooke Mohr yea · Abby De Molina yea · Forest Bell yea · Shantaw Bloise-Murphy yea · Brian Sullivan yea
Tue Apr 21, 2026 · 16:00

Roads and Right of Way Committee

Committee reviews Pleasant Street sidewalk survey and Milestone Road projects

The Roads and Right of Way Committee will discuss transportation updates, including survey results for the Pleasant Street sidewalk extension and status reports on several Milestone Road improvements. Real estate matters such as Wesco Lane access and monument installations will also be reviewed. The meeting will conclude with reports from the DPW, NRTA, and a Harbor Plan update.

transportationsidewalksroad-wideningreal-estateinfrastructure
✓ Decided: Committee approved a formal marker for the Lily Pond Park easement

The committee unanimously approved the March meeting minutes. It voted to support the Nantucket Land Bank’s request for a public way marker at 6 Westco Place to clarify access to Lily Pond Park. The meeting was adjourned by a unanimous motion.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Roads and Right of Way Committee Day, Date, and Time Tuesday, April 21, 2026, at 4:00 pm Location / Address Room A, The Trailer, 131 Pleasant Street; or by Zoom: Join Zoom Meeting https://us06web.zoom.us/j/87669110695?pwd=mIL8nMalDNshfRZ9D5DiaDEjIs0ZP5. 1 Meeting ID: 876 6911 0695 Passcode: 487956 Signature of Chair or Authorized Person Lee W. Saperstein WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Expected Attendance: Members: Rick Atherton, Gordon Auchterlonie, Ed Gillum, Nelson (Snookie) Eldridge, Nat Lowell, Rob Ranney, Allen Reinhard, Lee Saperstein, and Phil Smith; ex officio: Mike Burns, Drew Patnode, Bob Bystrowski, Tracy MacDonald, and Gary Rogers. 1. Call to Order and Roll Call; this meeting is being audio and video recorded: Lee Saperstein. 2. Public and Commissioners’ Comments on Items not on the Agenda. 3. Approval of March Minutes: Lee Saperstein. 4. Status of Committee Reorganization: Submit applications for at-large membership in TPAC. 5. Transportat [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Roads and Right of Way Committee Final Meeting Minutes for Review and Approval – April 21, 2026 1. Call to Order & Attendance The meeting was called to order at 4:05 PM by Chair Lee Saperstein. This was a hybrid meeting held at the Pleasant Street trailer and via Zoom. Attendance: - Present: Lee Saperstein (Chair), Rick Atherton, Phil Smith, Allen Reinhard, Ed Gillum, and Nelson (Snooky) Eldridge. - Ex Officio/Guests: Mike Burns (Transportation Planning), Drew Patnode (DPW Director), Bob Bystrowski (Real Estate), Gary Roberts (NRTA), Claire O’Connor (Nantucket Land Bank). - Absent: Nat Lowell, Rob Ranney, and Gordon Auchterlonie. 2. Approval of Minutes The minutes from the March meeting were reviewed and unanimously approved. The Chair expressed appreciation for the transition to using transcription tools for documentation. 3. Committee Reorganization (Transportation and Public Access Committee - TPAC) The committee discussed its transition as it nears the end of its current term in June. It will be replaced by the new TPAC advisory body starting July 1. - Structure: Nine voting members (3 designated, 6 at-large). - Designated Seats: Joe Topham and Nat Lowell (NP&EDC), and Mickey Rowland (Commission on Disabilities). - Applications: Six at-large members will be appointed by the Town Manager. Applications are due by noon on May 8, 2026. 4. Real Estate – Lily Pond Park Easement (6 Westco Place) Claire O’Connor from the Nantucket Land Bank pres [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Apr 17, 2026 · 10:00

Nantucket Historical Commission

Review of Historic Rehabilitation Tax Credit for 17 North Water Street

The Nantucket Historical Commission will discuss a staff update and public comment, then review the Historic Rehabilitation Tax Credit application for 17 North Water Street. Members will examine survey responses for Pleasant Street accessibility improvements with the Transportation Program Manager. Updates on historic resource surveys, including a pending site visit by PaleoWest, LLC/Chronical Heritage and Massachusetts Historical Commission surveys, will be presented. The commission will also debrief the Certified Local Government meeting of April 10 and consider related preservation concerns before approving the March 20 minutes.

historical-commissiontax-creditaccessibilityhistoric-surveyspreservationmeeting
✓ Decided: Nantucket Historical Commission adopted meeting minutes

The commission formally adopted the minutes of the April 17, 2026 meeting on June 12, 2026. No other substantive actions, approvals, or denials were recorded in the provided minutes.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, April 17, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Staff update • Historic Rehabilitation Tax Credit Review – 17 North Water Street • Pleasant Street accessibility improvements – review of survey responses with Transportation Program Manager • Historic resource surveys update o PaleoWest, LLC / Chronical Heritage survey of Town-owned his [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 1DQWXFNHW+LVWRULFDO&RPPLVVLRQ $SULO0HHWLQJ $0 3OHDVDQW6WUHHW1DQWXFNHW0$DQGYLD=RRP $WWHQGHHV %HWV\7\OHU &RPPLVVLRQHU %DUEDUD+DOVWHG &RPPLVVLRQHURQOLQH  *HRUJH%XWWHUZRUWK &RPPLVVLRQHU  5LWD&DUU &RPPLVVLRQHU $QJXV0DF/HRG &RPPLVVLRQHU 6DUDK0F/DQH &RPPLVVLRQHU $EE\'H0ROLQD &RPPLVVLRQHURQOLQH +ROO\%DFNXV VWDII±3UHVHUYDWLRQ3ODQQHURQOLQH  $JHQGD ‡ 5ROOFDOODW$0 &RPPLVVLRQHUV5LWD*HRUJH%DUEDUD$QJXV6DUDKDQG%HWV\ DUHLQSHUVRQ%DUEDUDDQG$EE\DUHRQ=RRPDVLV+ROO\%DFNXV ‡ 3XEOLF&RPPHQW o 1RQH ‡ 6WDIIXSGDWH o 1RWKLQJDGGLWLRQDOEH\RQGWKHDJHQGD ‡ +LVWRULF5HKDELOLWDWLRQ7 D[&UHG LW5HYLHZ±1RUWK:DWHU6WUHHW o (ULQ'RKHUW\(SVLORQ$VVRFLDWHV&DLOHQ&DVH\RZQHUDQG'PLWUL.DSDOLV SURMHFWDUFKLWHFWSUHVHQWHGWKHSURMHFW1:DWHU6WZDVFRQVWUXFWHGF DQGKDVVHUYHGDVDJXHVWKRXVHVLQFHWKHODWHWKFHQWXU\SURMHFWZLOOUHWDLQ WKLVKLVWRULFXVHUHWDLQLQJJXHVWURRPVLQODUJHO\WKHVDPHFRQILJXUDWLRQZLWKD UHDUDGGLWLRQDQGWZRDGGLWLRQDODWWLFURRPV,QWHQGWRXVHERWKIHGHUDODQGVWDWH WD[FUHGLWV o +ROO\VWDWHGKRZJODGVKHLVWKDWWKHKLVWRULFXVHLVEHLQJUHWDLQHG o $QJXVDQG5LWDH[SUHVVHGFRQFHUQRYHUWKHORVVRIWKHUHDUZLQGHUVWDLUUHPRYDO DOORZVFUHDWLRQRIDFRGHFRPSOLDQWHJUHVVVWDLUIRUDOOWKUHHOHYHOV3XWWLQJD FRGHFRPSOLDQWVWDLULQWKHDGGLWLRQZRXOGUHTXLUHWKHDGGLWLRQEHWDOOHUGHVLUH ZDVWRNHHSWKHQHZDGGLWLRQVHFRQGDU\WRWKHH[LVWLQ [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
write a letter of support for the project (17 North Water Street)
7 yea
Angus yea · Sarah yea · Betsy yea · George yea · Abby yea · Barbara yea · Rita yea
recommend the proposed design alternatives (Pleasant Street accessibility improvements) to the Select Board
6 yea · 1 abstain
Angus yea · Sarah yea · Betsy yea · George abstain · Barbara yea · Abby yea · Rita yea
express the NHC is in favor of the intent of Article 72
7 yea
Angus yea · Sarah yea · Betsy yea · George yea · Abby yea · Barbara yea · Rita yea
adjourn
7 yea
Angus yea · Sarah yea · Betsy yea · George yea · Abby yea · Barbara yea · Rita yea
Thu Apr 16, 2026 · 16:00

Board of Health

Board to discuss Vito Capizzo Stadium renovation and artificial turf moratorium

The Nantucket Board of Health will consider several septic loan requests, a nitrogen loading variance, and an appeal of a sewer connection order. The meeting also includes continuations of public hearings on Hummock Pond Watershed and Wellhead Protection District regulation amendments. The most consequential item is a discussion of the Vito Capizzo Stadium Renovation Project, including a proposed moratorium on artificial turf and a joint agreement for preinstallation testing.

board-of-healthsepticloansvariancesewerpublic-hearingstadiumartificial-turf
✓ Decided: Board released lien on 45 Millbrook Rd and approved multiple septic loans

The Board voted 5‑0 to release the lien on 45 Millbrook Road. It also approved septic‑loan requests for 10 N. Cambridge St, 54 Arkansas Ave (at half the requested amount), and 28 Pocomo Rd. A variance for increased nitrogen loading at 48 Lovers Lane was approved 3‑2. The Board continued the Polpis Rd sewer‑connection appeal and two watershed‑regulation amendments to the May meeting, and unanimously authorized continued negotiations on the Vito Capizzo Stadium turf testing protocol.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, April 16, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/2_A8Mngj4hs Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_xlOMMhLNSOaz7rmMKWc_Wg AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Approval of minutes (2/19/2026, 3/2/2026, 3/16//2026, 3/19/2026) 4. Director’s Updates 5. 45 Millbrook Rd – Septic Betterment Loan Release 6. 10 N. Cambridge St - Septic Loan Request for property located in Madaket Harbor Watershed 7. 54 Arkansas Ave - Septic Loan Request for property [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH April 16, 2026 Adopted May 21, 2026 B OARD OF HEALTH ~~ MINUTES ~~ Thursday, April 16, 2026 Meeting PSF Community Room, 4 Fairgrounds Road, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:00 p.m. S taff in attendance: Roque Miramontes, Director of Public Health; Jerico Mele, Deputy Director of Health and Human Services, John Hedden, Chief Environmental Health Officer Remote Staff: Andrew Shaper, Environmental Contamination Administrator, Tomeka Gary, Public Health Coordinator; Members attending: Ann Smith (chair), Meredith Lepore, James Cooper, Thomas Dixon, Kerry McKenna Remote Members: Public Participant: Arthur Gasbarro, Meg Ruley, John W. Giorgio, Chip Clunie, Willa Arsenault, Erika Mooney, Charity Benz, Steve LaRosa; Senior Technical Leader with Weston & Samson Engineers, Leah Mojer, Elizabeth Denley; TRC Environmental as a chemistry director, Lisa Wisentanner, Mark Haft; Vice President of Engineering and Quality at Tencate, Dan Weber, Gary Hedman from Horseley Witten Group, Jamie Lure, Scot Capizzo, Brent Tartamella, Kate Garrett, Kit Murphy, Kareem Taha, Aaron Myers, Jenny Cook, Graham Veezy, Matthew Peel, Kim Latlippe I. P UBLIC ANNOUNCEMENT II. PUBLIC COMMENT Discussion: None provided III. APPROVAL OF MINUTES Discussion All minutes will get approved in May meeting IV. DIECTOR’S REPORT Discussion • Roque Maramontes' last meeting as Public Health Director; Jericho and J [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
approve 48 Lovers Lane as presented
3 yea · 2 nay
Smith yea · McKenna yea · Dixon yea · Lepore nay · Cooper nay
The other 7 items passed by unanimous or near-unanimous consent.
Thu Apr 16, 2026 · 16:00

Parks and Recreation Commission

Parks and Rec to attend Board of Health meeting

The agenda consists of only procedural items: call to order, attendance at a Board of Health meeting, and adjournment. No substantive decisions or discussions are listed.

parksrecreationboard-of-healthprocedural
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday, April 16, at 4:00 p.m. Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YouTube Link for Viewing Only: https://youtube.com/live/2_A8Mngj4hs Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_xlOMMhLNSOaz7rmMKWc_Wg Nantucket Parks and Recreation Commission Meeting Notice and Agenda Thursday, April 16 2026 Meeting to be held at 5:00 p.m. Remotely Via Zoom. 1. Call to Order 2. Attend Board of Health Meeting. 3. Adjournment
Thu Apr 16, 2026 · 17:00

Finance Committee

Finance Committee will discuss increasing airport fuel revolver spending limit

The Finance Committee will review a proposal to increase the spending limit on the town’s airport fuel revolving fund. The agenda does not specify the amount of the proposed increase. The meeting will also include an information session about the upcoming Annual Town Meeting. The remaining agenda items are standard procedural matters.

financeairport-fuelbudgetpublic-commenttown-meeting
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, APRIL 16, 2026 @ 5:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/83529177804?pwd=GRrub0bVTH7LQbRRIIFStF5HQwvpZX.1 Meeting ID: 835 2917 7804 Passcode: 016476 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review and Discussion of Airport Fuel Revolver Spending Limit Increase 6. Annual Town Meeting Information Session 7. Other Business 8. Date of Next Meeting – Thursday, April 30, 2026 @ 1:00 PM (Remote) 9. Adjournment
Thu Apr 16, 2026 · 17:00

Conservation Commission

Commission to hold hearings on Polpis Harbor and Hither Creek dredging

The Nantucket Conservation Commission will hold public hearings on several notices of intent, including a dredging plan for Polpis Harbor and Hither Creek. The body will also review certificates of compliance and potential enforcement actions.

conservationdredgingenvironmental-permitspublic-hearingsenforcement
✓ Decided: Commission closed 14 Bassett Road SE48‑3974 and issued certificates of compliance for five projects

The Conservation Commission voted unanimously to close the 14 Bassett Road SE48‑3974 case. It also approved a minor modification for 46 Tennessee Avenue SE48‑3919 and issued Certificates of Compliance for Nantucket Yacht Club, Winterwade Properties, Nantucket Electric Company, Dolan, and Butswinkas, with an ongoing condition noted for the Butswinkas site. All votes were 5‑0 except where a member recused.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 APR 13 AM 10:04 Original Posting Number: T 272 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, April 16, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Zoom Registration: https://us06web.zoom.us/webinar/register/WN_s4GeK0p6S6iYlTPsb4Waqg Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for April 16, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes April 16, 2026, adopted May 7, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, April 16, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: : https://youtube.com/live/uS0rcVBo0tE Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Schafer, Plandowski and Williams Absent Members: Braine, Turcotte Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:39) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Plandowski) Vote: Vote Carried: 5:0: Engelbourg, Misurelli, Plandowski, Schafer, and Williams (aye) III. Announcements Discussion: (00:02:25) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:02:50) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:02:58) none VI. Public Hearing A. Notice of Intent- No Waiver Required Discussion: (00:03:26) Engelbourg - Asks Commission and public if there is any interest in opening SE48-3974 Commissioners a [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
accept the agenda
5 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Williams yea
close SE48-3974
5 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Williams yea
issue OOC as Amended for 14 Bassett Road LLC- 14 Bassett Road (26-41) SE48-3974
5 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Williams yea
issue the Minor Modification for SE48-3919
5 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Williams yea
Thu Apr 16, 2026 · 17:00

Parks and Recreation Commission

Nantucket Parks and Rec meeting cancelled

This meeting of the Nantucket Parks and Recreation Commission scheduled for April 16, 2026, has been cancelled. No business will be conducted.

cancelledparksrecreationnantucket
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date _April 14, 2026_ Original Posting Number _T 274_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday April 16th at 5:00 pm Location / Address REMOTE PARTICIPATION ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager THIS MEETING HAS BEEN CANCELLED
Wed Apr 15, 2026 · 17:30

Select Board

Select Board to approve contracts and discuss town meeting logistics

The Select Board will approve pending contracts, including a $1.18 million stormwater master plan, and discuss the upcoming May 4th Annual Town Meeting. The board will also review a proposed license agreement for erosion control and accept public comment.

select-boardcontractsstormwatertown-meetingbudgetpublic-commentinfrastructure
✓ Decided: Select Board approved pending contracts, including stormwater repairs and master plan

The Board approved the minutes from prior meetings, payroll and treasury warrants, and pending contracts for April 15, 2026. They also accepted listed gifts and approved amendments to the Select Board committee appointment process. All items were approved by roll‑call vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, APRIL 15, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/_VXy8Vr3owk ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_oJAMya1nQT2ogtYC8vYU2g I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Select Board/Planning Board Accepting Applications for Vacant Seat on Planning Board until Noon on Friday, April 24, 2026; Submit Applications to Planning Board at 2 Fairgrounds Road, Nantucket, MA 02554; Joint Appointment to be Made at May 20, 2026 Select Board Meeting. 3. 2026 Annual Committee/Board/Commission Vacancies and Appointment Timeline; Committee A [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 15, 2026 at 5:30 PM Page 1 of 7 SELECT BOARD Minutes of the meeting of April 15, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Matt Fee, Thomas Dixon and Brooke Mohr. Dr. Malcolm MacNab participated remotely. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 pm and said that Dr. MacNab is participating remotely, therefore all votes will be taken by roll call. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Select Board/Planning Board Accepting Applications for Vacant Seat on Planning Board until Noon on Friday, April 24, 2026; Submit Applications to Planning Board at 2 Fairgrounds Road, Nantucket, MA 02554; Joint Appointment to be Made at May 20, 2026 Select Board Meeting. Operations Administrator Erika Mooney reviewed where pertinent information may be found on the Town website. 3. 2026 Annual Committee/Board/Commission Vacancies and Appointment Timeline; Committee Appointment Process: Boards, Commissions & Committees | Nantucket, MA - Official Website. Ms. Mooney reviewed the committee appointment timeline and list of current openings. 4. [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approval of items VII 1 – 4
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Wed Apr 15, 2026 · 15:00

Tree Advisory Committee

Tree committee to receive updates on Liberty Tree, Orange St., pruning

The Tree Advisory Committee will hear updates on several old business items, including the 250th Anniversary Liberty Tree Project and the status of 169 Orange St. They will also receive a winter pruning update. The committee will consider approving minutes from April 2025 and take public comment.

tree-advisory-committeenantucketliberty-treepruningpublic-comment
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time Wednesday, April 15, 2026, at 3:00PM Location / Address DPW CONFERENCE ROOM OR REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance II. COMMITTEE ACCEPTANCE OF AGENDA III. COMMITTEE APPROVAL OF MINUTES - April 23, 2025 IV. ANNOUNCEMENTS V. PUBLIC COMMENT /DISCUSSION VI. CITIZEN/DEPARTMENTAL REQUESTS VII. OLD BUSINESS - 250 TH Anniversary Liberty Tree Project (Mary Longacre)- Update - 169 Orange St. – Update - Winter Pruning Update 2
Tue Apr 14, 2026 · 18:00

Nantucket Public School Committee

School Committee to vote on High School Iceland field trip

The Nantucket Public School Committee will discuss a 3rd quarter budget update, a mid‑year update to the DIP Action Plan Year 3, and a self‑evaluation process. It will vote on several policies, including school food and nutrition, civil‑rights complaints, and data records. The committee will also vote to reject participation in a school‑choice program for 2026‑2027, approve a $331 donation for art‑room clay, and approve a high‑school field trip to Iceland scheduled for April 19‑23 2027.

school-committeebudgetpoliciesfield-tripnutritioncivil-rights
10 Surfside Road, Nantucket High School, LGI, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, April 14, 2026, 6:00 PM Location / Address HYBRID - Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road · Nantucket, MA 02544 https://zoom.us/webinar/register/WN_fDeNPKLmQliYjjJ6t0suYQ Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA To virtually attend the meeting, register using the Zoom Webinar link below: https://zoom.us/webinar/register/WN_fDeNPKLmQliYjjJ6t0suYQ To watch meeting live, click here: https://youtube.com/live/BP2X9dmjuFs I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. Student Enrollment b. Summer Meals, Nourish Nantucket c. MASC, Day on the Hill d. Additional Updates VI. Presentations and discussions of issues to the Committee a. 3rd Quarter Budget Update - Martin Anguelov, b. Mid-Year Update: DIP Action Plan Year 3 - Superintendent Elizabeth Hallett c. School Committee Self Evaluation Process VII. Committee discussions and votes to [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 14, 2026 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to review fuel spending and ramp management plans

The Nantucket Memorial Airport Commission will meet to review pending contracts, discuss a fuel revolver spending limit increase, and review a ramp management plan. The agenda includes updates on the Terminal Optimization Project and the Housing Production Plan.

airportbudgetfuelcontractsramp-managementhousingenvironment
✓ Decided: Commission approved airport leases, contracts and amendments

The commission adopted the March 10 draft minutes and ratified the March 18 and April 1 warrants. A motion to approve a series of leases, contracts and amendments—including a 10‑year TSA lease, surf school license, ground handling agreement, aircraft tug purchase, and consulting task orders—was passed unanimously. The FedEx sublease was discussed but not acted on.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, April 14, 2026 at 5:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/81150006437 The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Zoom Link to Virtually Attend Meeting: https://us06web.zoom.us/j/81150006437 Meeting ID: 811 5000 6437 The meeting will be posted at a later date on YouTube. 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 03/10/26 Draft Minutes c. Ratify 03/18/26, and 04/01/26 Warrants 3. Public Comment 4. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 5. 041426-01 Sub-Lease Guidelines 2 6. Pending Matters: a. 0714 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING April 14, 2026 The meeting was called to order at 5:0 1 PM by Chairman Arthur Gasbarro with the following Commissioners present: Andrea Planzer, Anthoney Bouscaren, Philip Marks III, and Michael Leavitt. This meeting was conducted remotely by video conference via Zoom and will be aired at a later date on the Town of Nantucket YouTube Channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Rich Lasdin, McFarland-Johnson. Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Gasbarro asked for comments and concerns on the 03/10/26 Draft minutes. Mr. Leavitt noted that the packet included minutes from the 03/10/26 meeting but not from the more recent 03/24/26 meeting, and asked why those minutes were not included. Mr. Gasbarro asked w [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
ratify the 03/18/26 and 04/01/26 Warrants
5 yea
Planzer yea · Bouscaren yea · Marks yea · Leavitt yea · Gasbarro yea
Tue Apr 14, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank Commission to discuss property management and legal strategy

The Nantucket Islands Land Bank Commission will review property use requests and management updates for various sites. The body will also hold an executive session to discuss litigation strategy and real property transactions.

property-managementland-uselitigationlicensingpublic-works
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, April 14, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/81815302556?pwd=NJ77AeGOeudwzkqXPtbWEBV9eymNuJ.1 Webinar ID: 818 1530 2556 Passcode: 277112 Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. AGRICULTURAL BUSINESS a. 160 Hummock Pond Road/Mt. Vernon Farm – Eat Fire Farm Annual Update 4. GOLF BUSINESS a. Sconset Golf – Liquor License Expansion Discussion 5. PROPERTY MANAGEMENT a. 74 Milestone Road – Wannacomet Water Company Request for Mitigation Assistance for New [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 14, 2026 · 16:00

Historic District Commission

Historic District Commission to review multiple new dwelling and building applications

The Historic District Commission will discuss a series of old business items involving new construction, hardscaping, and building modifications. The body will also hold a Q&A session with the Preservation Planner regarding contributing and infill structures.

zoninghistoric-preservationconstructionhardscapinghousing
✓ Decided: Commission approved the 5 Gingy Lane new dwelling application

The Historic District Commission approved the original submission for 5 Gingy Lane, a new dwelling, with a 4‑1 vote. It also approved revised designs for 198 Hummock Pond Rd and the Servants Heart project, both unanimously. Several other applications were held for revisions or placed on hold at the applicants’ request.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, April 14, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_KOO7WM6DTMulf05BqeX0wA#/registration To watch live feed, click here: https://www.youtube.com/live/Hc6UxWDKHHQ Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket -ma.gov. **Comments are due by 8:00am the Monday prior to the meeting. AG [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes April 14, 2026; adopted May 26, 2026 HISTORIC DISTRICT COMISSION Minutes April 14, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Holly Backus and Fiona Johnson Meeting called at 4:05pm by Stephen Welch MacLeod: made the motion to approve the agenda. Approved by Welch, Patten, Oliver, MacLeod and Camp In person Welch, Oliver, Camp, MacLeod and Patten Zoom: Paul and Thornewill I. COMMISSIONER Q & A WITH PRESERVATION PLANNER • Holly Backus reported that there were no new updates since the prior week’s meeting, noted that two old business applications on 4/14 (1 Cherry and 7 Maxey Pond) would be held at the applicants’ request, confirmed she had provided comments to the board, and stated she was available for any questions. II. OLD BUSINESS 03/31/2026 Property owner name Street Address Scope of work Map/Parcel Agent 1. Cato Ln Prop Co. 14160 8 Cato Ln Pool-hardscape 55/663 Ridgevale Development • Commissioners: Welch, Pohl, Camp, MacLeod, Patten; Alternates: Paul; Recused: Oliver • NO SHOW 2. Cato Ln Prop Co. 14161 10 Cato Ln Pool-hardscape 55/125 Ridgevale Development • Commissioners: Welch, Pohl, Camp, MacLeod, Patten; Alternates: Paul; Recused: Oliver • NO SHOW 3. Tanner Powell 14267 Oliver’s Way Lot 31 New dwelling [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 2 divided votes
Named votes as recorded in the official record.
approve via Exhibit A (37 Squam Rd New gym structure)
3 yea · 1 nay · 1 abstain
Welch yea · MacLeod yea · Camp yea · Oliver nay · Thornewill abstain
approve the original submission for 5 Gingy Lane, specifically the prior (pre -revision) elevation
4 yea · 1 nay
Welch yea · Oliver yea · Patten yea · Paul yea · MacLeod nay
The other 1 item passed by unanimous or near-unanimous consent.
Tue Apr 14, 2026 · 08:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee meets to discuss events and reports

The Visitor Services Advisory Committee will hold a meeting to approve minutes from January 13th and receive reports from the Director, Visitor Services Coordinator, and Cultural Affairs and Event Coordinator. The meeting will be conducted remotely via Zoom.

visitor-servicescommitteeremote-meetingreportsevents
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Visitor Services Advisory Committee Day, Date, and Time Tuesday, April 14th at 8:00am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person David Sharpe WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85275837374?pwd=ZmlCOWNCUmZhZXVQYitGTStjWEJIdz09 Meeting ID: 852 7583 7374 Passcode: 056433 1. Welcome VSAC Members 2. Public Comment 3. Approval of January 13th Minutes 4. Conversation with Bianca Brown, Events Manager Nantucket Island Chamber of Commerce 5. Director’s Report 6. Visitor Services Coordinator’s Report 7. Cultural Affairs and Event Coordinator’s Report
Tue Apr 14, 2026 · 10:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee meeting cancelled

A meeting of the Nantucket County Coastal Resilience Advisory Committee was scheduled for Tuesday, April 14, 2026 at 10:00 a.m. via Zoom. The notice indicates the meeting has been cancelled. No agenda items were presented or decided.

coastal-resiliencemeeting-cancelled
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, April 14, 2026 at 10:00 a.m. Location / Address Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Mon Apr 13, 2026 · 10:30

Airport Commission, Nantucket Memorial

Airport Commission Aviation Fuel Subcommittee to discuss fuel farm expansion

The Aviation Fuel Subcommittee is meeting to discuss planning and funding for fuel farm expansion. The body will also review fuel supply, pricing policies, and staffing for the summer 2027 season.

aviation-fuelinfrastructureairport-operationscapital-budget
✓ Decided: Airport Commission unanimously approves $3 million for fuel farm expansion

The commission unanimously approved adding $3,000,000 to the FY27 capital budget for a fuel farm expansion. They also approved using existing professional services funds to start engineering work on the project. Staff were directed to review procurement rules to determine if an exemption applies to the engineering contract. Staff were tasked to confirm Sunday hazmat ferry options with the Steamship Authority, prepare a support letter for the operator’s approval, and request rate information.

14 Airport Road, Administration Building
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission – Aviation Fuel Subcommittee Day, Date, and Time Monday, April 13, 2026 at 10:30 AM Location / Address This meeting will be held In-Person at 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Monday, April 13, 2026, at 10:30 AM 1. Call to Order 2. Review and Approve: a. Agenda b. 02/10/26 Draft Minutes 3. 041326-01 – Discussions Regarding Aviation Fuel: a. Fuel Farm Expansion FY 2027 Capital Request b. Fuel Farm Expansion Engineering and Planning c. Options for Additional Ferry Reservations d. Summer 2027 Supply Increase e. Seasonal Staffing f. Fuel Supply RFP g. Retail Fuel Pricing Policy h. Minimum Jet Fuel Purchase Policy 4. Public Comment 5. Adjourn
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AVIATION FUEL SUBCOMMITTEE MEETING April 13, 2026 The meeting was called to order at 10:30 AM by Airport Manager Warren Smith with the following Commissioners present: Michael Leavitt and Philip Marks III. This meeting was conducted in person at 14 Airport Road, Nantucket, MA. Airport employees present were: Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; and Elizabeth Reuss, Administrative Assistant. Mr. Smith read the Town’s virtual meeting statement. Mr. Smith asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Smith asked for comments and concerns on the 02/10/26 Draft minutes. Mr. Leavitt asked for clarification regarding the number of fuel uplift restrictions reported in the draft minutes, noting that the minutes reflected three (3). Mr. Harimon confirmed that the correct total was four (4). Mr. Leavitt stated that the minutes should be updated to reflect the accurate number. Mr. Marks made a Motion to adopt the 02/10/26 draft minutes as amended to reflect four (4) uplift restrictions. Second by Mr. Leavitt. 041326-01 – Discussion Regarding Aviation Fuel: [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Apr 13, 2026 · 16:00

Nantucket Cultural Council

Nantucket Cultural Council to hold elections and review grant report

The Nantucket Cultural Council will meet to conduct council elections and review a grant cycle report. The body will also vote on the approval of minutes from January 12, 2025.

arts-and-culturegrantselections
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
JOIN ZOOM MEETING https://us06web.zoom.us/j/81736441523?pwd=MhAnhdIFjPx2QQSBkoJwRmeRG1dhZV.1 Meeting ID: 817 3644 1523 Passcode: 216717 AGENDA 1. Welcome Nantucket Cultural Council Members 2. Agenda Protocol 3. Approval of January 12, 2025 Minutes 4. Public Comment 5. Cultural Council Elections 6. Grant Cycle Report 7. Other Business 8. Next Meeting May 11, 2026 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cultural Council Day, Date, and Time Monday, April 13, 2026 at 4:00pm Location / Address OR REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person Deana Weatherly WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD!
Mon Apr 13, 2026 · 16:00

Planning Board

Planning Board will hold public hearings on multiple development applications

The Nantucket Planning Board will approve meeting minutes and discuss a second‑dwelling request for 31 Daffodil Lane. It will approve several ANR plans, including sites on Fairgrounds Road, Emily Street, and Folger Avenue. The board will conduct public hearings on numerous development applications, some of which are continued to May 11, 2026. Additional business includes scheduling a special joint meeting for a Master Plan update and upcoming town meetings.

zoningdevelopmentpublic-hearingsmaster-plansecond-dwellingsplanning-board
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 04-13-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: Zoom Registration Link - April 13, 2026 To view the meeting only, see link below: YouTube Live Meeting Link Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, April 13, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Zoom Registration Link - April 13, 2026 Meeting Packet Link 2026 Meeting Packet Link Signature of Chair or [Excerpt truncated on this listing page; use the official record for the full text.]
Sat Apr 11, 2026 · 10:00

Advisory Committee of Non-voting Taxpayers

Committee will discuss Finance and Capital Program recommendations for the 2026 ATM

The Advisory Committee of Non‑Voting Taxpayers will review recommendations from the Finance Committee and Capital Program Committee for the 2026 Annual Town Meeting and future capital needs. Members will consider whether to provide advice on various ATM article positions and examine an OIH financial analysis. The meeting also includes training on open‑meeting law and conflict‑of‑interest rules, and discussion of upcoming issues such as the Residential Tax Exemption review and succession planning.

financecapital-programannual-town-meetingtax-exemptiontrainingsuccession-planning
✓ Decided: Committee voted to send a letter opposing Article 11 nursing‑home project

The Advisory Committee approved its agenda and the prior meeting minutes unanimously. Members voted to have Chair Peter Halle and Pam send a letter to the Town Manager and Select Board recommending against Article 11, the Our Island Home nursing‑home project. The committee also decided not to appoint a speaker for the Annual Town Meeting, to take no position on the revised Noise Bylaw (Article 68), and to request term re‑applications from members with expiring appointments. The meeting was adjourned unanimously.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Advisory Committee of Non-Voting Taxpayers Day, Date, and Time Saturday April 11, 2025 at 10 a.m. Location / Address REMOTELY VIA ZOOM; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/@nantucketgov/videos Signature of Chair or Authorized Person Kathy Baird, Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81681188728 Meeting ID: 816 8118 8728 Call to Order This meeting is being audio and video recorded - read statement for Remote Zoom Meeting Membership count for quorum Approval of Agenda for today’s meeting, if quorum present Approval of draft minutes for meeting of November 15, 2025 if quorum present Discussion of Finance Committee (FINCOM) and Capital Program Committee (CAPCOM) Recommendations for ATM 2026 and likely future Capital Program needs Guest Speaker – Jill Vieth, FINCOM/CAPCOM Chair CAPCOM Report and Recommendations (FY2 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
ADVISORY COMMITTEE OF NON-VOTING TAXPAYERS Minutes of Public meeting 10:00 am, Saturday, April 11, 2026 1. Attending members: Kathy Baird, Gene Briskman, Michael Cody, Patti Deuster, Lynn Filipski, Peter Halle, Donna Martino, Steve Perelman, Pam Suan. Members absent: Lou Bassano, Gary Beller, Bill Gardner, Don Green, Peter Kahn, Scott Ulm 2. Chair Peter Halle convened the meeting at 10:01 am and read the Virtual Meeting Script, confirming a quorum was present. 3. The Agenda for today’s meeting was moved for approval, seconded and passed unanimously. 4. Approval of the corrected minutes from the November 15, 2025 meeting was moved, seconded and passed unanimously. 5. Peter H. initiated a general discussion of Annual Town Meeting (ATM) 2026 Capital Project articles while we waited for our guest speaker to join us. An overall concern for non-voting taxpayers is the full list of currently proposed projects along with those in the queue. Current total of the largest debt override requests are for Article 11 - Our Island Home (OIH), Article 15 – Somerset Sewer Extension and Article 12 - School Athletic Facilities Improvements is approximately $200M. 6. Peter H. began the discussion with OIH which has been resubmitted with updated costs. Committee members concluded, with a vote, to have chair Peter H., with assistance from Pam, send a letter to the Town Manager, Select Board with a follow up to the local newspapers. It will acknowledge heartfelt sympathy for the [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Apr 10, 2026 · 16:00

Certified Local Government Commission

Historic Properties Survey Plan adopted by joint HDC and NHC meeting

The joint Historic District Commission and Nantucket Historical Commission meeting will review and adopt the Historic Properties Survey Plan prepared by PAL, Public Archaeology Laboratory, Inc. They will receive updates on ongoing and future preservation survey projects and discuss annual town meeting articles of preservation concern. The commission will also consider proposed state legislation that could amend historic district statutes.

historic-preservationsurveylegislationgrantseducation
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CERTIFIED LOCAL GOVERNMENT COMMISSION Historic District Commission (HDC) Nantucket Historical Commission (NHC)– Special Joint Meeting Day, Date, and Time Friday, April 10, 2026; 4:00pm Location / Address REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Stephen Welch Chair (HDC) Rita Carr, Chair (NHC) If there is no quorum of members present, or if the meeting posting is not in compliance with the OML statute, no meeting may be held. NANTUCKET CERTIFIED LOCAL GOVERNMENT Signature of Chair/Authorized Person: Holly Backus, Preservation Planner / Local CLG Coordinator To join the JOINT Historic District Commission & Nantucket Historical Commission CLG Special Meeting, click on the Zoom Link below: https://us06web.zoom.us/j/87803228364?pwd=Nscv2bKsG7WisZmOMYj3Sg9uDJx5Jl.1 Meeting ID: 878 0322 8364 Passcode: 544891 HDC Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver Alternate Commissioners: Carrie Thornewill, Joe Paul, Connie Patton NHC Commissioners: Rita Carr (Chair), Angus MacLeod (Vice-Chair), Abby De Molina, Clement Durkes Staff: [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Apr 10, 2026 · 23:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The Washington Street Collaborative Work Group meeting scheduled for April 10, 2026 was cancelled. No agenda items were discussed or decided.

communitycollaborationmeeting
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, April 10, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/82209999469?pwd=7ziqFM1tcY0vIEFKMblhKOF3xcRGPp.1 Meeting ID: 822 0999 9469 Passcode: 394349 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Thu Apr 9, 2026 · 13:00

Zoning Board of Appeals

ZBA to consider withdrawal of variance request for 74 Monomoy Road

The Zoning Board of Appeals will meet to discuss a request to withdraw a variance application for a shed at 74 Monomoy Road. The board will also address a citizen article regarding a Zoning Bylaw Amendment.

zoningvarianceland-use
✓ Decided: Board approved withdrawal of Mayflower Crescent variance request

The Zoning Board of Appeals approved its agenda and the February and March 2026 meeting minutes. It voted 5‑0 to approve the applicant’s request to withdraw a variance application for 74 Monomoy Road without prejudice. The board discussed a proposed zoning bylaw amendment but took no formal position. The meeting was adjourned with a 5‑0 vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, April 09, 2026, at 1:00 PM Location / Address 4 Fairgrounds Road, Nantucket, MA 02554 PSF COMMUNITY ROOM & REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Nicky Sheriff, Land Use Specialist WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA (Subject to Change) The meeting will be recorded and archived at www.nantucket-ma.gov. ZOOM WEBINAR REGISTRATION LINK: https://us06web.zoom.us/webinar/register/WN_5L45hCnbQQ2jlrfkdGKllA To view the LIVE broadcast of the meeting, see YouTube Link at https://youtube.com/live/homJ2ZRc_qw BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CALL TO ORDER: II. APPROVAL OF THE AGENDA: III. PUBLIC COMMENT for items not listed on the agenda: IV. APPROVAL OF MINUTES: FEBRUARY 12, 2026 MARCH 12, 2026 2 V. OLD BUSINESS (VOTES MAY BE TAKEN): 2026-0035 Mayflower Crescent LLC 74 Monomoy Road Alger Request to Withdraw [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved ZBA Minutes – April 09, 2026 1 ZONING BOARD OF APPEALS 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket- ma.gov Commissioners: Susan McCarthy (Chair), John Brescher (Vice Chair), Elisa Allen (Clerk), Lisa Botticelli, Alternates: Jim Mondani, Robert Constable, Mark Poor ~~ MINUTES ~~ (ADOPTED ON 07/09/26) Thursday, April 09, 2026 This meeting was held in person and via remote participation using ZOOM and YouTube. I. CALL TO ORDER Called to order at 1:04 pm and Announcements made by Chair McCarthy Attending Members: McCarthy, Constable, Allen, Mondani, Brescher Staff in attendance: Nicky Sheriff; Land Use Specialist Absent: - Botticelli & Poor Remote Members: Late Arrivals: - John Brescher arrived at 1:09 PM Early Departures: II. APPROVAL OF AGENDA Motion: Motion to approve the agenda. (Made by: Allen) (Seconded by: Mondani) Vote: Carried 4-0// McCarthy, Allen, Mondani, Constable (Aye) III. PUBLIC COMMENT IV. APPROVAL OF MINUTES February 12, 2026 Motion: Motion to approve the February minutes as drafted. (Made by: Allen) (Seconded by: Mondani) Vote: Carried 4-0// McCarthy, Allen, Mondani, Constable, (Aye) March 12, 2026 Motion: Motion to approve the minutes as amended. (Made by: Mondani) (Seconded by: Allen) Vote: Carried 4-0// McCarthy, Allen, Mondani, Constable (Aye) V. OLD BUSINESS 2026-0035 Mayflower Crescent LLC 74 Monomoy Road Alger Request to Withdraw without Prejudice Acti [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (5 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
4 yea
McCarthy yea · Allen yea · Mondani yea · Constable yea
approve the February minutes as drafted
4 yea
McCarthy yea · Allen yea · Mondani yea · Constable yea
approve the minutes as amended
4 yea
McCarthy yea · Allen yea · Mondani yea · Constable yea
approve the withdrawal without prejudice
5 yea
McCarthy yea · Allen yea · Mondani yea · Constable yea · Brescher yea
adjourn
5 yea
McCarthy yea · Allen yea · Mondani yea · Constable yea · Brescher yea
Thu Apr 9, 2026 · 08:00

Nantucket Water Commissioners

Commission will consider several vendor contracts, including emergency excavation services

The Nantucket Water Commissioners will review production, billing and rainfall reports and receive updates on water quality, Chatham Road, drought conditions, the sewer force main, fee structures, and leak‑abatement processes. They will also discuss and potentially approve personnel or vendor contracts such as Emergency Excavation Services, Invoice Cloud, and consulting services for PFAS treatment and lead remediation. The meeting includes routine items like agenda acceptance, public comment, and review of prior minutes.

watercontractsbillingleak-abatementdroughtsewerfees
1 Milestone Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, April 9, 2026, at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Nantucket Water Commission Regular Meeting – in person at the Water Company conference room 1 Milestone Road, Nantucket, MA 02554 Thursday, April 9, 2026, at 8:00 AM 1. Call Meeting to Order 2. Acceptance of Agenda 3. Public Comment 4. Review of Minutes from January 8, 2026 and February 12, 2026 meetings. 5. Production, Billing and Rainfall Reports 6. Director’s review and updates: a. Water Quality b. Chatham Rd c. Drought Condition d. Sewer Force Main e. Fee Structures f. Review of Leak Abatement Processes – Requests, Abatement and Appeals g. 31 Miacomet Ave Leak Adjustment Appeal Request 7. Discussion, amendment and execution of any personnel or vendor contracts (Emergency Excavation Services and Invoice Cloud pending; bids were due in March for Misc Parts & Steel Building for PFAS Treatment; CDM Smith Lead Consulting; General Engineering Weston & Sampson) 8. Commissioner’s Com [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Apr 9, 2026 · 13:00

Nantucket Islands Land Bank Commission

Commission to view proposed building relocation and conduct site visit

The Nantucket Islands Land Bank Commission will meet to consider agricultural business matters. Members will view the proposed building relocation at 198 Hummock Pond Road and conduct a site visit to 160 Hummock Pond Road/Mt. Vernon Farm.

land-useagriculturezoning
198 & 160 Hummock Pond Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Thursday, April 9, 2026, at 1:00 p.m. Location / Address 198 & 160 Hummock Pond Road, Nantucket, MA Signature of Chair or Authorized Person Susan C. Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA CALL TO ORDER: 1:00 P.M. A. CONVENE IN OPEN SESSION 1. AGRICULTURAL BUSINESS a. 198 Hummock Pond Road – View Proposed Building to be Relocated b. 160 Hummock Pond Road/Mt. Vernon Farm – Site Visit ADJOURNMENT
Wed Apr 8, 2026 · 14:30

Abatement Advisory Committee

Committee will review FY2026 real estate abatement applications

The Abatement Advisory Committee will open with a call to order, approve the minutes from the April 8, 2025 meeting, and allow a public comment period. It will then discuss any new business. In an executive session, the committee will review Fiscal Year 2026 applications for real estate tax abatement as required by MGL Chapter 59 Section 60.

tax-abatementfinancepublic-commentexecutive-sessiontown-meeting
37 Washington Street, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s ABATEMENT ADVISORY COMMITTEE Day, Date, and Time WEDNESDAY, APRIL 8, 2026 AT 2:30 PM Location / Address 37 WASHINGTON ST, NANTUCKET Or via ZOOM https://us06web.zoom.us/j/83823340555?pwd=woa60C5lyPIXS60sFiKroMcDM7 fAho.1 Signature of Chair or Authorized Person ROB RANNEY, ASSESSOR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION Join Zoom Meeting https://us06web.zoom.us/j/83823340555?pwd=woa60C5lyPIXS60sFiKroMcDM7fAho.1 Meeting ID: 838 2334 0555 Passcode: 052712 1. Call to Order 2. Approval of Minutes of AAC Meeting in Open Session on April 8, 2025 3. Public Comment 4. New Business II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, MGL Chapter 59, Section 60: Review of Fiscal Year 2026 Applications for Real Estate Abatement. III. ADJOURNMENT
Wed Apr 8, 2026 · 13:30

Procurement Review Committee

Committee will consider awarding the Jetties Beach concession lease

The Nantucket Procurement Review Committee will review proposals submitted for the Jetties Beach concession lease. The Evaluation Committee will discuss the received proposals and make a recommendation on which lease to award. The meeting is scheduled for April 8, 2026 at 1:30 pm via Zoom.

procurementleasesbeachtown-government
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Jetties Beach Concession Lease RFP Review Committee Day, Date, and Time Wednesday, April 8, 2026 @ 1:30pm Location / Address REMOTE PARTICIPATION VIA ZOOM ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Brian E. Turbitt WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86914729130?pwd=nbUa2YYNNVoOtFi4z0RZpWeHbpl6X2.1 Meeting ID: 869 1472 9130 Passcode: 984599 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review of Proposals for the Lease of Jetties Concession *Sandbar ACK, LLC d/b/a Sandbar at Jetties Beach 6. Discussion by Evaluation Committee on the Proposals Received 7. Recommendation for Award of Lease for the Jetties Concession 8. Adjournment 2
Wed Apr 8, 2026 · 15:00

Cemetery Commission

Cemetery Commission reviews monument updates and future cemetery projects

The Nantucket Cemetery Commission will meet on April 8, 2026 at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. The agenda includes public comments, approval of minutes from March 11, 2026, and updates on Polpis Cemetery monuments and corner markers, Monument Restoration projects at New North Cemetery and Newtown Cemetery, and discussion of the commission’s future. Additional project items cover lot consolidation at Newtown Cemetery, fencing at the Historic Coloured Cemetery, and map and marker installations at Polpis Cemetery. The meeting will adjourn and the next regular meeting is scheduled for May 13, 2026.

cemeterymonumentsrestorationland-usehistoric-preservation
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cemetery Commission Day, Date, and Time Wednesday, April 8, 2026 at 3:00 p.m. Location / Address DPW Conference Area, 188 Madaket Road Signature of Chair or Authorized Person Allen B. Reinhard, Chairman AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 Nantucket Cemetery Commission Meeting Notice and Agenda Wednesday, April 8, 2026 Meeting to be held at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. 1. Public and Commissioners comments. 2. Approval of Minutes from March 11. 2026. 4. Polpis Cemetery: New monuments in white stone, update on corner markers for new lots layout. 5. Monument Restoration Project update: New North Cemetery. 6. Newtown Cemetery: Progress update. Bob Bystrowski, or Tracy McDonald if available. 7. Thoughts and discussion regarding future of the Commission. 8. Old, New and other business and final comments. 2 9. Adjourn. Next regular meeting: 3:00 p.m. Wednesday, May 13, 2026. Nantucket Cemetery Projects List: Consolidation of lots at Newtown Cemetery wit [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 NANTUCKET CEMETERY COMMISSION Posted Meeting of April 8, 2026, at 3:00 pm DPW Conference Room, 188 Madaket Road, with Zoom Connectivity DRAFT MINUTES FOR REVIEW AND APPROVAL Attendance, by Roll Call: Commissioners: Jascin Finger, Scott McIver, Allen Reinhard, and Lee Saperstein; Charlie Polachi, Cemetery Administrator; Robert Bystrowski, Real Estate Specialist. It was determined by roll call that there was a quorum at all times; for reference, the correct Zoom link to join Cemetery Commission meetings is Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 Absent: Frances Karttunen. 1. Call to Order. Allen Reinhard called the meeting to order at 3:00 pm; a roll call established the listed attendance. The link to the video recording is https://www.youtube.com/watch?v=cC8NbkBLip8&list=PL49sKqpy7VAhIyX1ozdd1bZ3zV8k XFp8M&index=69. 2. Public and Commissioners Comments. Before beginning, Allen Reinhard asked if the lot corner markers for Polpis Cemetery had arrived. He was assured by Charlie Polachi that they had and that Scott McIver had them. Allen Reinhard said that they would be discussed in Agenda Item 4. 3. Minutes of February 11, 2026. Allen Reinhard asked for approval of the minutes of March 11, 2026; Scott McIver made that motion and Jascin Finger seconded it; it was approved unanimously by roll-call vote (Allen Reinhard, aye; Jascin Finger, [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approval of the minutes of March 11, 2026
4 yea
Allen Reinhard yea · Jascin Finger yea · Scott McIver yea · Lee Saperstein yea
Tue Apr 7, 2026 · 09:00

Sign Advisory Council (HDC)

Council will review and approve dozens of new sign applications

The Sign Advisory Council will consider a list of proposed signs for various property owners, including wall, banner, projecting, and directional signs at locations such as Evergreen Way, Broad Street, Easy Street, Federal Street, Main Street, and Eel Point Road. The council will vote on whether to grant the permits for each listed sign. The meeting also includes routine procedural items, public comment, and discussion of future meeting logistics.

signagepermitszoningpublic-signstown-meeting
✓ Decided: Council approved 16 sign applications and postponed revisions on 11 others

The Sign Advisory Council unanimously approved sixteen sign applications, including new wall, banner, and projecting signs, and also approved one application by a 2‑1 vote. Eleven applications were held for further revision or compliance with the Master Sign Plan. All decisions were recorded with unanimous votes unless noted otherwise.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 APR 01 PM 02:34 Original Posting Number: T 242 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, April 7, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURA [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC SAC Minutes April 7, 2026; adopted May 5, 2026 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday April 7, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:03 am. Attending members: Chris Young, Ben Normand, Mark Cutone, Paul Wolf, Kevin Kuester Absent members: None Late arrivals: Kevin Kuester at 10:05am and Paul Wolf at 10:13 am Early Departures: Ben Normand at 10:02 am and Mark Cutone at 10:05 am Motion to adopt agenda made by Cutone; seconded by Normand. Vote: Carried unanimously. Approval of Minutes, March 24, 2026 made Cutone; seconded by Normand Vote: Carried unanimously. II. Public Comment- none III. Commissioner Comments-none HDC Sign Advisory Council minutes 4/7/26; adopted 5/5/2026 New Business 1. NISHA 14287 1 Evergreen Wy Wall sign- NISHA 68/727 Jardins International Discussion- sign larger. Application needs to be updated to reflect the changes Motion to approve made by Normand; seconded by Cutone. Vote: carries unanimously. 2. Nant Historical Assoc.14378 15 Broad St Banner sign- 1 42.4.2/61 Ashley Santos Discussion: material should be canvas- type material. Whatever was approved last year should be the same material Motion to approve with the material to match previous years made by Normand; seconded by Cutone. Vote: carries unanimously. 3. Nant Historical Assoc. [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 7, 2026 · 17:30

Nantucket Public School Committee

Nantucket School Committee meeting cancelled, no agenda items

The Nantucket Public School Committee meeting scheduled for April 7, 2026 at 5:30 PM in the Nantucket Community School conference room was cancelled. As a result, none of the listed agenda items—including the Assistant Superintendent’s update, Open Meeting Law review, and mid‑year goal reviews—will be discussed or decided at this time.

educationschool-committeemeeting-cancellednantucket
56 Center Street
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
C A N C E L L E D CANCELLED MEETING POSTING Original Posting Date __04/03/2026 Original Posting Number __T247 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting, Workshop Day, Date, and Time Tuesday, April 7, 2026, 5:30 PM Location / Address Nantucket CommunitySchool, Conference Room 56 Center Street Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell THIS MEETING HAS BEEN CANCELLED I. Call to order II. Welcome and approval of agenda III. Assistant Superintendents Update IV. Open Meeting Law Review and Discussion V. School Committee Goals - Midyear Review VI. School Committee Self-Evaluation VII. Superintendent Goals: Midyear Review VIII. Adjournment 1 C A N C E L L E D 2
Tue Apr 7, 2026 · 12:30

Affordable Housing Trust

Affordable Housing Trust to review property purchase at 158 Madaket Road

The Affordable Housing Trust will discuss the execution of closing documents for 158 Madaket Road and review Closing Cost Assistance Program applications. The body will also review housing-related Town Meeting Warrant Articles and a $175,000 Seasonal Communities Grant.

affordable-housingreal-estategrantshousing-policy
✓ Decided: Trust approved FY ’27 grant and awarded two $15,000 housing purchases

The Affordable Housing Trust executed the Community Preservation Committee Grant Agreement for fiscal year 2027. It approved $15,000 awards to Harper Kissell for 10 Evergreen Way and to Aderene Grizzle for 7B Waitt Drive. The Trust also approved the acceptance of the deed and settlement for the property at 158 Madaket Road. Minutes from the March meetings were formally adopted.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, April 7, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, APRIL 7, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is now accepting nominations for the 2026 Dr. Howard Dickler Citizen Award, which honors a [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on April 7, 2026, at 12:30 PM Approved the 19th day of May 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, April 7, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Brian Sullivan and Brooke Mohr. Penny Dey, Forest Bell, Mary Mack, Shantaw Bloise-Murphy, and Abby De Molina joined remotely. Staff members present were Dylan Metsch- Ampel (Deputy Housing Director) , and Caroline Ferguson (Administrative Specialist) . Kristie Ferrantella (Housing Director), Brian Turbitt (Finance Director ), Vicki Marsh (Town Counsel ), and Keelin Ciccariello (Town Counsel) joined remotely. Speaker(s) present were Megan Trudel (Deputy Planning Director), Judi Barrett (Barrett Planning LLC), and Tony Duong (Barrett Planning LLC), all remote participation. All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order at 12:33 pm. II. ACCEPTANCE OF AGENDA Brooke Mohr made a MOTION to approve the agenda. Mary Mack seconded the motion; by roll call vote: Forest Bell – Aye; Penny Dey – Aye; Mary Mack – Aye; Brooke Mohr – Aye; Brian Sullivan – Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is being Audio and Video Recorded 2. The Nantucket Affordable Housing Trust is now [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (6 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
5 yea
Forest Bell yea · Penny Dey yea · Mary Mack yea · Brooke Mohr yea · Brian Sullivan yea
approve the minutes of March 3, March 16, and March 17, 2026
6 yea
Brooke Mohr yea · Mary Mack yea · Forest Bell yea · Penny Dey yea · Brian Sullivan yea · Shantaw Bloise-Murphy yea
execute the Grant Agreement for FY ‘27
6 yea
Penny Dey yea · Mary Mack yea · Forest Bell yea · Shantaw Bloise-Murphy yea · Brooke Mohr yea · Brian Sullivan yea
award up to $15,000.00 to Harper Kissell for the purchase of the property at 10 Evergreen Way
6 yea
Mary Mack yea · Forest Bell yea · Penny Dey yea · Shantaw Bloise-Murphy yea · Brooke Mohr yea · Brian Sullivan yea
award up to $15,000.00 to Aderene Grizzle for the purchase of the property at 7B Waitt Drive
7 yea
Mary Mack yea · Forest Bell yea · Penny Dey yea · Shantaw Bloise-Murphy yea · Abby De Molina yea · Brooke Mohr yea · Brian Sullivan yea
Approval and Execution of Acceptance of the Deed and Settlement Statement and any other related closing documents by the Affordable Housing Trust for the property at 158 Madaket Road, and to…
5 yea · 1 abstain
Forest Bell yea · Mary Mack yea · Shantaw Bloise-Murphy yea · Brooke Mohr yea · Brian Sullivan yea · Penny Dey abstain
Tue Apr 7, 2026 · 17:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss eelgrass and shellfish regulations

The board will review reports from the Marine and Natural Resources departments. Members will discuss eelgrass management, commercial scalloping apprenticeship guidelines, and diesel fuel transfer protocols.

shellfishenvironmentmaritimeregulationseelgrass
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, April 7, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting – https://us06web.zoom.us/j/83356580447?pwd=HJ3dgm2oUcMFhAhXBqa0pVPCCbg5oj.1 Meeting ID: 833 5658 0447 Password: 205803 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, April 7, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/83356580447?pwd=HJ3dgm2oUcMFhAhXBqa0pV PCCbg5oj.1 Meeting ID: 833 5658 0447 Password: 205803 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of March 17, 2026 CHAIRMAN’S REPORT Potential 2027 Town Meeting articles MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOURCES [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 7, 2026 · 16:00

Historic District Commission

HDC reviews dozens of property alteration consents and sign approvals

The Historic District Commission will consider a large list of consent applications for exterior changes such as additions, roof alterations, and fence work on properties across Nantucket. It will also vote on motions to approve various signage projects, including projecting and quarter board signs on Federal Street and Main Street. Additional items include a Q&A with the preservation planner and a brief discussion of pending items from previous meetings.

historic-districtsignsexterior-alterationsroofinghardscape
✓ Decided: Historic District Commission unanimously approved dozens of project consents and sign permits

The commission first approved its agenda. It then unanimously approved a slate of regular project consents and a separate slate of consents with conditions. Numerous sign applications were approved while several others were held for revisions, and the commission voted to hold one solar proposal for changes and to approve another as submitted.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 APR 03 PM 01:46 Original Posting Number: T 252 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, April 7, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_CjmFpwcMQASY_KLr47TZ1g To watch live feed, click here: https://youtube.com/live/5tDKuVEgfoI Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Packs, click here. ** [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes April 7, 2026; adopted 5/26/26 HISTORIC DISTRICT COMISSION Minutes April 7, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Holly Backus and Fiona Johnson In person, Oliver, MacLeod Camp and Patten Zoom: Paul Meeting called to order at 4:00 pm by Angus MacLeod Board: MacLeod, Camp, Oliver, Paul and Patten Oliver made the motion to approve the agenda Motion carries unanimously Camp left the meeting at 7:30 pm I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Nant. Island Resorts 14385 6 White Elephant Wy Rev- color clarification 42.4.2/3.3 Emeritus, LTD AM 2. 32 Flintlock Rd, LLC 14398 32 Flintlock Rd Rev. 11644; windowchanges 75/77 Emeritus, LTD AM 3. Elizabeth Whelden 14410 2 Fishers Landing Fence 38/154 Alex Whelden VO 4. WETU Real Estate 14480 83 Squam Rd Addition 13/5 Studio Ppark VO 5. Charles Paget 14482 33 Millbrook Rd Rev. 13414; new entry enclosur 56/316 DTA VO 6. Kian Ross 14448 16 Trotters Ln Move on garage frm 10 New Ln 67/140 Self VO 7. Berkeley Heights, LLC 14455 6 Berkeley Av Move/demo MH 54/150 Self VO 8. Wiggins Family Tr 14478 22 Berkley St Addition/rear staircase 76.1.3/214 LINK VO 9. Karl Phillips 14298 19 Folger Av 280 sf addition 80/110 Self VO 10. Dan West [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 7, 2026 · 16:00

Select Board

Select Board to hold Municipal Housing Strategic Plan workshop

The Select Board will meet to conduct a workshop regarding the Municipal Housing Strategic Plan.

housingstrategic-planning
✓ Decided: Board adopts Municipal Housing Strategic Plan

The Select Board voted unanimously to adopt the Municipal Housing Strategic Plan presented by Housing Director Kristie Ferrantella. The motion was moved by Ms. Mohr and seconded by Mr. Fee, passing 4‑0. No other substantive actions were decided, and the meeting was then adjourned.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time TUESDAY, APRIL 7, 2026, 4:00 PM Location / Address MEETING TRAILER, ROOM A, 131 PLEASANT STREET AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/-z-5T1pipFE ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_WL2NEcmAQOKEo7CVFV4MHQ I. CALL TO ORDER II. MUNICIPAL HOUSING STRATEGIC PLAN WORKSHOP III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 7, 2026 at 4:00 PM Page 1 of 3 SELECT BOARD Minutes of the Meeting of April 7, 2026. The hybrid meeting took place in person in Room A at the Meeting Trailer at 131 Pleasant Street; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Tom Dixon and Matt Fee. Brooke Mohr arrived later in the meeting as noted. Dr. Malcolm MacNab was absent. Also present in person were Town Manager C. Elizabeth Gibson, Operations Administrator Erika Mooney, Housing Director Kristie Ferrantella, Deputy Housing Director Dylan Metsch-Ampel, Rental Property Manager Rachel Field, Real Estate Manager Tracy MacDonald, and Finance Committee member Peter Schaeffer. Present remotely were Project Manager Kevin Manuel and Deputy Town Manager Gregg Tivnan. I. CALL TO ORDER Chair Hill called the meeting to order at 4:03 PM. II. MUNICIPAL HOUSING STRATEGIC PLAN WORKSHOP Ms. Ferrantella introduced the workshop topics and reviewed the presentation as contained in the Board’s agenda packet. A brief discussion arose as to the cost per bed, for rental housing with Mr. Fee stating that the “going rate” is currently $1,000 per month per bed. Ms. Mohr joined the meeting in person at 4:08 PM. Ms. Ferrantella continued with review of the presentation. Airport Manager Warren Smith joined the meeting in person at 4:13 PM. Chair Hill asked about the potential sale of Affordable Housing Trust proper [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Apr 7, 2026 · 15:30

Board of Health

Board to discuss responses to two Open Meeting Law complaints

The Nantucket Board of Health will meet to discuss responses to complaints filed by Kate Garrette and Kimberly Latlippe. The board is authorized to submit responses to the Town Council and Town Counsel, respectively. The meeting will be held remotely via Zoom.

board-of-healthopen-meeting-lawcomplaintremote-meetinglegalnantucket
✓ Decided: Board approves draft response to open‑meeting complaints

The Board of Health voted 5‑0 to approve the draft response letters addressing two open‑meeting complaints filed about the March 19 meeting. The approved draft authorizes the town council to finalize and send the responses and includes the letters in the public packet for the April 16 meeting. The board also agreed to release the contested emails with the April 7 minutes.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Tuesday, April 7, 2026, 3:30PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89867003342?pwd=oXoQo0a1LrT8xMIa64TSPbFRQ1BJCP.1 1. Call to Order 2. Board of Health Acceptance of the Agenda. 3. Public Announcement -This meeting of the Board of Health is being Audio and Video Recorded. 4. Board of Health Discussion a. Open Meeting Law Complaint filed against the Board of Health by Kate Garrette, dated March 19, 2026:Acknowledge Receipt of Complaint; Review and Discuss Response; and Authorize Submission of Response by Town Council. Votes may be taken. b. Open Meeting Law Complaint filed against the Board of Health by Kimberly Latlippe , dated March 23,2026:Acknowledge Receipt of Complaint; Review and Discuss Response; and Authorize Submission of Response by Town Counsel. Votes may be taken. 5. Adjournment
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH April 07, 2026 Adopted May 21, 2026 Submitted by: Tomeka Gary BOARD OF HEALTH ~~ MINUTES ~~ Thursday, April 7, 2026 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 3:30 p.m. Staff in attendance: Remote Staff: Janelle Austin, Town Council’s Office Members attending: Remote Members: Ann Smith (chair), Meredith Lepore, James Cooper, Thomas Dixon, Kerry McKenna Public Participant: I. CALL TO ORDER II. BOARD OF HEALTH ACCEPTANCE OF THE AGENDA Discussion: III. PUBLIC ANNOUNCEMENT Discussion IV. BOARD OF HEALTH DISCUSSION Discussion Open meeting law complaints overview • 2 complaints were filed — one by Kimberly Latlippie (dated March 23rd, 2026) and one by Kate Garrett (dated March 19th, 2026) — both regarding the board's March 19th, 2026 meeting • Both complaints raise the same 2 allegations: • The meeting notice for March 19th wasn't sufficiently specific about the board's intended discussion • Emails sent to board members that day constituted deliberation outside a properly posted meeting • Tom Dixon clarified that the complaints referenced were from the filers, not from Town Counsel's office Proposed remedial actions • Janelle Austin outlined 3 remedial steps proposed in the draft responses: 1. Public release of the emails at issue, to be included with the minutes of the April 7th meeting 2. A further substantive meeting on the project at the next regularly scheduled meeting on [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
approve the draft responses, to authorize town council to finalize and send the response to the complainant and division of open government and includes the draft letter in the packet for the April…
5 yea
Smith yea · Lepore yea · McKenna yea · Dixon yea · Cooper yea
adjourn at pm 3:42pm
5 yea
Smith yea · Lepore yea · McKenna yea · Dixon yea · Cooper yea
Mon Apr 6, 2026 · 13:00

Select Board

Select Board to host discussion on Steamship Authority report

The Select Board will host Senator Cyr, Representative Moakley, and Inspector General Shapiro. The group will discuss a report regarding the Steamship Authority.

transportationsteamship-authoritystate-government
✓ Decided: No actions taken as quorum was not met

The Select Board met remotely via Zoom. Only two members were present, so a quorum was not met. Consequently, no items were voted on or decided.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, APRIL 6, 2026, 1:00 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/webinar/register/WN_XmqVEYCMQGqfD3oO2gcl2A I. CALL TO ORDER II. ATTEND PUBLIC MEETING SENATOR CYR AND REPRESENTATIVE MOAKLEY ARE HOSTING IN PARTNERSHIP WITH INSPECTOR GENERAL SHAPIRO TO DISCUSS REPORT ON THE STEAMSHIP AUTHORITY III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 6, 2026 at 1:00 PM Page 1 of 2 SELECT BOARD Minutes of the Meeting of April 6, 2026. The remote meeting took place via remote participation using Zoom. Members of the Board present were Thomas Dixon and Brooke Mohr. Dawn E. Hill, Matt Fee and Dr. Malcolm MacNab were absent. A quorum was not met. I. CALL TO ORDER II. ATTEND PUBLIC MEETING SENATOR CYR AND REPRESENTATIVE MOAKLEY ARE HOSTING IN PARTNERSHIP WITH INSPECTOR GENERAL SHAPIRO TO DISCUSS REPORT ON THE STEAMSHIP AUTHORITY III. ADJOURNMENT Select Board Minutes of the Meeting of April 6, 2026 at 1:00 PM Page 2 of 2 SELECT BOARD APRIL 6, 2026 – 1:00 PM REMOTE PARTICIPATION VIA ZOOM NANTUCKET, MASSACHUSETTS List of documents used at the meeting: None.
Mon Apr 6, 2026 · 14:30

Nantucket Elementary School Council

Nantucket Elementary School Council to review communication survey and teacher appreciation

The Nantucket Elementary School Council will meet to review a communication survey and discuss a Teacher Appreciation Plan. The body will also approve minutes from the March 5, 2026 meeting.

educationschool-councilteacher-appreciation
30 Surfside Road, NES Library
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Elementary (NES) School Council Meeting Day, Date, and Time Monday, April 6 2026 2:30-3:15PM Location / Address NES Library 30 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Jane Melville WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to order II. Welcome and approval of agenda III. Review and Approve minutes from 3/5/26 IV. Communication Survey review V. Teacher Appreciation Plan VI. For the Good of the Order VII. Teacher Appreciation VIII. For the Good of the Order IX. Next Meeting May 7, 2026 OUR MISSION: Nantucket Public Schools, in partnership with a caring community, will create a dynamic and equitable learning environment which engages each of us to be inspired learners and responsible citizens, prepared to meet local and global challenges.
Thu Apr 2, 2026 · 17:00

Conservation Commission

Public hearing on West Ashored LLC’s notice of intent for 62 Wanoma Way

The Nantucket Conservation Commission will hold a public hearing on a Notice of Intent that does not require a waiver for West Ashored LLC at 62 Wanoma Way. The meeting will also consider two waiver‑required notices of intent—one from Robert F. Greenhill Revocable Trust for 16 Hoicks Hollow Road and another from Nantucket Islands Land Bank for 16 & 19 East Creek Road. Additional agenda items include a certificate of compliance for Ack‑N‑Back, LLC at 33 Quidnet Road, enforcement actions such as the Baxter Road geotubes case, and approval of the March 19, 2026 minutes.

conservationpublic-hearingdevelopmentland-useenforcementzoning
✓ Decided: Commission approved amended orders of conditions for two development projects

The Conservation Commission adopted amended Orders of Conditions for West Ashored LLC at 62 Wanoma Way and for the Nantucket Islands Land Bank at 16‑19 East Creek Road, both with unanimous votes. It also issued a Certificate of Compliance for Ack‑N‑Back, LLC at 33 Quidnet Road and approved the March 19 minutes. All motions were carried unanimously.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 MAR 09 PM 02:03 Original Posting Number: T189 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, April 2, 2026, at 5PM Location / Address Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for April 2, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/sEPr8AoUZoQ Zoom Registration: https://us06web.zoom.us/webinar/register/WN_kDbO06v8TGu05GX5Y-XBLw *Indicates items not previously opened/discussed I. Call To Order II. Acceptance of the [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes April 2, 2026, adopted April 16, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, April 2, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/sEPr8AoUZoQ Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Schafer, Turcotte, Plandowski; Braine arrives at 5:03pm; Williams at 5:05pm Absent Members: - Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:15) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Turcotte) Vote: Vote Carried: 5:0: Engelbourg, Misurelli, Plandowski, Schafer, and Turcotte (aye) III. Announcements Discussion: (00:01:59) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:02:29) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:02:30) none VI. Public Hearing A. Notice of Intent- No Waiver Required 1. *West Ashored LLC- 62 Wanoma Way (92-16) SE48-3972 Sitting: Engelbourg, Misurelli, Plandowski, Sc [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
accept the agenda
5 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea
close: West Ashored LLC- 62 Wanoma Way (92-16) SE48-3972
7 yea
Engelbourg yea · Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
close: Nantucket Islands Land Bank- 16 -19 East Creek Road (55-58 & 60) SE48-3971
7 yea
Engelbourg yea · Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
issue OOC as Amended: West Ashored LLC- 62 Wanoma Way (92-16) SE48-3972
7 yea
Engelbourg yea · Braine yea · Misurelli yea · Plandowski yea · Schafer yea · Turcotte yea · Williams yea
Thu Apr 2, 2026 · 09:00

Zoning Board of Appeals

Zoning Board of Appeals to discuss Surfside Crossing litigation strategy

The Zoning Board of Appeals will hold a joint meeting with the Select Board. The session is dedicated to discussing legal strategy regarding the case Surfside Crossing, LLC v. Nantucket Zoning Board of Appeals.

zoninglitigationlegal-strategy
16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, April 2, 2026, at 9:00 AM Location / Address Town Building Conference Room – 16 Broad Street Signature of Chair or Authorized Person William Saad, Zoning Administrator WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, Pursuant to MGL C. 30A §21(A): (Votes may be taken). Purpose 3: Joint Meeting with the Select Board to Discuss Strategy with Respect to Litigation Regarding Surfside Crossing, LLC v. Nantucket Zoning Board of Appeals, H.A.C. No. 2019-07, where an Open Meeting May have a Detrimental Effect on the Litigating Position of the Zoning Board of Appeals and the Chair so Declares. III. ADJOURNMENT (VOTE WILL BE TAKEN)
Thu Apr 2, 2026 · 09:00

Select Board/County Commissioners

Select Board to discuss litigation and real estate in executive session

The Select Board and County Commissioners will meet in executive session to discuss legal strategies and real estate matters. The session includes discussions on collective bargaining, zoning litigation, and a proposed settlement regarding national prescription opiate litigation.

litigationcollective-bargainingreal-estatezoningcannabis-business
✓ Decided: Board approved unanimous motion to adjourn to executive session

The Select Board moved to adjourn the meeting to executive session to address several matters, including litigation strategy, collective bargaining, a property transaction at 20 Nancy Ann Lane, and other legal issues. The motion was seconded and approved by roll‑call vote, with all five members voting Yes. No other actions were taken during the open session.

16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 AMENDED MEETING POSTING Original posting date: 3/27/2026 Original Posting # T 233 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, APRIL 2, 2026 AT 9:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of March 5, 2026. 2. Purpose 3: To Discuss Strategy with Respect to Litigation, Specifically Surfside Crossing, LLC v. Nantucket Zoning Board of Appeals, HAC No. 2019-07, where an Open Meeting May have a Detrimental Effect on the Litigating Position of the Select Board/County Commissioners and the Chair so Declares; Votes May Be Taken. 3. Purpose 3: To Discuss Strategy with Respect to Collective Bargaining (Li [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 2, 2026 Page 1 of 3 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of April 2, 2026. The meeting was held in the Town Building Conference Room, Nantucket and via Zoom. Select Board Members present were Dawn E. Hill, Tom Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Town Manager C. Elizabeth Gibson was present in person. Deputy Town Manager Gregg Tivnan and Operations Administrator Erika Mooney were present remotely. I. CONVENE IN OPEN SESSION Chair Hill called the meeting to order at 9:02 AM. Ms. Mohr moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purposes of: 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of March 5, 2026. 2. Purpose 3: To Discuss Strategy with Respect to Litigation, Specifically Surfside Crossing, LLC v. Nantucket Zoning Board of Appeals, HAC No. 2019-07, where an Open Meeting May have a Detrimental Effect on the Litigating Position of the Select Board/County Commissioners and the Chair so Declares; Votes May Be Taken. 3. Purpose 3: To Discuss Strategy with Respect to Collective Bargaining (Police Superior Officers Union 330A), where an Open Meeting May have a Detrimental Effect on the Bargaining Position of the Select Board/County Commissioners and the Chair so Declares. 4. Purpose [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Thu Apr 2, 2026 · 15:00

Nantucket Public School Committee

School committee meeting cancelled

The Nantucket Public School Committee meeting scheduled for April 2, 2026, has been cancelled. The agenda included a hybrid executive session regarding collective bargaining with the Nantucket Teachers Association.

cancellededucationexecutive-sessioncollective-bargainingteachers-associationhybrid
30 Surfside Road, NIS Cafeteria, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
C A N C E L L E D CANCELLED MEETING POSTING Original Posting Date: March 30, 2026 Original Posting Number __T 235 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Thursday, April 2, 2026, 3:00 PM Location / Address HYBRID https://zoom.us/j/96348905867?pwd=LW7wAMcaYMzIq3MOv9P5PNX00fEMmk.1 Nantucket Intermediate School, Cafeteria 30 Surfside Road Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell THIS MEETING HAS BEEN CANCELLED I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session and not return to open session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Wed Apr 1, 2026 · 17:30

Select Board

Select Board to hold hearings on landfill fees and public assembly permits

The Select Board will conduct public hearings regarding commercial and residential landfill tipping fees and a public assembly permit for the Maria Mitchell Association. The board will also review several professional service contracts and a request for private pay rate increases at Our Island Home.

waste-managementpublic-permitscontractshealthcarepolice
✓ Decided: Select Board approved private‑pay rate hikes for Our Island Home nursing home

The Board unanimously approved several routine items, including the March 25 minutes, payroll and treasury warrants, and pending contracts. It also approved the Nantucket Wine and Food Festival charitable wine license applications, accepted a Zoning Board resignation, and raised private‑pay rates at Our Island Home to $645 for semi‑private rooms and $665 for single rooms effective July 1 2026. Additional approvals were given for the Maria Mitchell Association’s “Stargazer Circus” event and for amendments to landfill tipping fees.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, APRIL 1, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/DkP2gtNPCBE ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_oRGnGAM9RkmfbLcgdhCMDA I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town Awarded $30,000 Historic Survey and Preservation Planning Grant The Town of Nantucket has been Awarded $30,000 by Massachusetts Historical Commission for its Certified Local Government (CLG) Community Project Towards the Creation of a Preservation Plan for the Island. 3. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howar [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of April 1, 2026 at 5:30 PM Page 1 of 7 SELECT BOARD Minutes of the meeting of April 1, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Matt Fee, Thomas Dixon, Dr. Malcolm MacNab and Brooke Mohr. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: The March/April Town Manager E-newsletter will be issued tomorrow. 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town Awarded $30,000 Historic Survey and Preservation Planning Grant The Town of Nantucket has been Awarded $30,000 by Massachusetts Historical Commission for its Certified Local Government (CLG) Community Project Towards the Creation of a Preservation Plan for the Island. Ms. Gibson thanked Preservation Planner Holly Backus for her work to secure the grant. 3. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to Housing@nantucket- [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Apr 1, 2026 · 15:00

Council on Aging

Guest speakers will address senior health and community outreach

The Council on Aging will conduct routine business, including establishing quorum, approving the agenda and prior meeting minutes. It will hear two guest speakers on senior health and outreach, receive a Senior of the Year update, and get reports from the Saltmarsh Senior Center coordinator and the deputy director of Health and Human Services. The meeting will also consider any new or other business items raised.

aginghealth-caresenior-servicescommunity-outreachreports
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date _Feb 9, 2026_ Original Posting Number _T 118_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, April 1, 2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person ROBERT M KUCHARAVY, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Approval of minutes of February 4 and March 4, 2026 V. Official business 1. Guest speakers: Lara Hanson PASCON Foundation Board Vice-Chair, Chair of the Development & Outreach Committee Debbie Dolan C [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 31, 2026 · 16:00

Historic District Commission

Historic District Commission to review multiple new dwelling and building applications

The Historic District Commission is meeting to discuss old business regarding various property alterations and new construction projects. The body will review applications for new dwellings, additions, and hardscaping across several Nantucket properties.

zoninghistoric-preservationhousingconstruction
✓ Decided: Commission held 9 New Jersey Avenue project pending full documentation

The commission voted unanimously to place the 9 New Jersey Avenue application on hold until a complete record of all submissions, drawings, meeting minutes, and video timestamps is provided. It also approved several Irwin projects on 115 Cliff Road, including a guest house, re‑site shed, pool house, and pool‑hardscape (the latter passed 4‑1). The board approved a new dwelling at 1 Pawguvet Lane with a 3‑1 vote and unanimously approved a 400‑sq ft addition at 4 Westmoor Lane. Two other applications – a new dwelling at 14203 198 Hummock Pond Road and alterations at 28 Pine Street – were held for minor revisions, each by unanimous consent.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, March 31, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_Ws_G9nMFSMm4PAn6DKVO0A#/registration To watch live feed, click here: https://www.youtube.com/live/3iV2LhPm4gQ Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket -ma.gov. **Comments are due by 8:00am the Monday prior to the meeting. AGEN [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes March 31, 2026; adopted 5/19/26 HISTORIC DISTRICT COMISSION Minutes March 31, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice -Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson Holly Backus left the meeting at 4:30 pm In person Welch, Oliver, Camp, MacLeod and Patten Pohl arrived at 5: 20 pm Zoom: Paul Meeting called to order at 4:05 pm by Stephen Welch Board: Welch, Oliver, MacLeod, Camp and Patten Oliver made the motion to approve the agenda Motion carries unanimously I. COMMISSIONER Q & A WITH PRESERVATION PLANNER • Holly Backus reported that IT updates delayed her completion of the Cliff Road (15) public-comment emails, which were sent afterward; she apologized and noted she prioritized other items. She also reminded members of the April 10 CLG meeting at 4:00 PM (agenda/link forthcoming) and the requirement to complete Town open meeting law training. II. OLD BUSINESS 03/17/2026 Property owner name Street Address Scope of work Map/Parcel Agent 1. 198 HP, LLC 14203 198 Hummock Pond Rd VIEW New dwelling 65/29 Emeritus, LTD • Commissioners: Welch, Patten, Camp, Oliver, MacLeod; Alternates: Paul • The Commission acknowledged the applicant’s revisions, including removal of the cupola, lowering of the second floor to [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted — 1 divided vote
Named votes as recorded in the official record.
approve through an Exhibit A for 1 Pawguvet Ln
3 yea · 1 nay
Camp yea · Oliver yea · Patten yea · MacLeod nay
Fri Mar 27, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The scheduled March 27, 2026 meeting of the Washington Street Collaborative Work Group was cancelled. No agenda items or decisions will be considered at this time.

22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, March 27, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/82209999469?pwd=7ziqFM1tcY0vIEFKMblhKOF3xcRGPp.1 Meeting ID: 822 0999 9469 Passcode: 394349 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Wed Mar 25, 2026 · 17:30

Select Board

Board to consider amendment to short‑term rental regulations (Chapter 338‑4(C))

The Select Board will discuss and vote on an amendment to Town Regulations Chapter 338‑4(C) that adds a new subsection for short‑term rental properties. The meeting also includes approval of March 16 and March 18, 2026 minutes and Treasury warrants, a request for a statutory exemption for the Town Manager’s family internship, and a National Grid update on its Smart Meter program. Public comment will be accepted according to the town’s Public Comment Policy.

short-term-rentalhousingregulationsbudgetutilitiestown-government
✓ Decided: Select Board approves new short‑term rental regulation subsection

The Board voted to add Subsection 7 to Chapter 338‑4(C) on short‑term rentals. It also approved a G.L. c.268A §19(b)(1) exemption for the Town Manager’s family internship, Treasury warrants, and the minutes from March 16 and 18. All listed Annual Town Meeting warrant articles were adopted, with Article 73 passing 4‑Yes to 1‑No.

PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 AMENDED MEETING POSTING Original posting date: 3/20/2026 Original Posting # T 225 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MARCH 25, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/tCistMVirUk ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_YM1gX8kCTJye9drq25RCbw I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to Housing@nantuck [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 25, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of March 25, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Matt Fee, Thomas Dixon, Dr. Malcolm MacNab and Brooke Mohr. Dawn E. Hill participated remotely. I. CALL TO ORDER Vice Chair Fee called the meeting to order at 5:30 PM following the Pledge of Allegiance. He noted that while Chair Hill is participating remotely, he will be acting chair, and all votes will be taken by roll call. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to [email protected] through April 10, 2026. Learn More at: https://nantucket-ma.gov/3621/Dr- Howard-Dickler-Citizen-Award. 3. May 4, 2026 Annual Town Meeting Warrant Article Information May be Found at https://www.nantucket-ma.gov/3722/2026-Annual-Town- Meeting; and Public Outreach Sessions (Re [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approval of items VII 1 – 2
5 yea
Fee yea · Dixon yea · Hill yea · MacNab yea · Mohr yea
determine that the financial interest is not so substantial as to be deemed likely to affect the integrity of the services which the municipality may expect from Ms. Gibson
5 yea
Fee yea · Dixon yea · Hill yea · MacNab yea · Mohr yea
approval of the amendments to Chapter 338-4(C) by adding a new subsection 7, as presented
5 yea
Fee yea · Dixon yea · Hill yea · MacNab yea · Mohr yea
Wed Mar 25, 2026 · 13:30

Nantucket Housing Authority

Approval of $93,674.26 Building Envelope Project final completion

The Nantucket Housing Authority will consider its March 2026 payroll warrant and approve the meeting agenda. It will review two housing covenants for properties on Ipswich and Evergreen Way. The board will decide on two work plans: tree trimming and removal costing $8,475 and the final completion of a building envelope project costing $93,674.26, pending architect and EOHLC approval. Reports from partner committees will also be presented.

housingfinancecontractstree-maintenancebuilding-envelope
3 Manta Drive, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Housing Authority Day, Date, and Time Wednesday, March 25, 2026, 1:30 PM Location / Address 3 Manta Drive, Nantucket and or via hybrid remote participation Signature of Chair or Authorized Person Nancy Friend, Executive Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://zoom.us/j/93325066784?pwd=gAFa19pRO2WdntbzAcnz5zBFNjap6o.1 933 2506 6784 Passcode 515660 AGENDA Open Session 1. Call to order/roll call 2. Approval of Agenda 3. Bill roll/Payroll Signing of Warrant March 2026 4. Minutes of February 25, 2025 5. Housing Nantucket Covenant 12 Ipswich 6. Housing Nantucket Covenant 10B Evergreen Way 7. Work Plan 201049 Final Completion Tree Trimming/removal, Nantucket Green Tree $8,475.00 8. Work Plan 201043 Building Envelope Project -Certificate of Substantial Completion 9. Work Plan 201043 Certificate of Final Completion $93,674.26, pending Architect/EOHLC approval 10. Executive Director’s Report Other Business: Report from Other Committees: CPC, AHT, Habitat for Humanity, NP & EDC Adjournment:
Tue Mar 24, 2026 · 10:00

Coastal Resilience Advisory Committee

Committee to discuss strategic retreat and relocation program

The Coastal Resilience Advisory Committee will convene via Zoom to approve minutes and discuss the Town's Island-wide Strategic Retreat and Relocation Program. The group will also review a grant submission to ECO-OneStop and committee reports.

coastal-resiliencezoomstrategic-retreatgrant-submissionnatural-resourcesselect-board
✓ Decided: CRAC approved prior minutes and unanimously adjourned the meeting

The Coastal Resilience Advisory Committee approved the minutes from the January 13 and January 27, 2026 meetings after brief discussion. The committee then voted unanimously to adjourn the March 24, 2026 meeting. No other substantive actions were taken.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, March 24, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, March 24, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes January 13, 2026; January 27, 2026 5. Presentation and discussion on the Town’s Island-wide Strategic Retreat and Relocation Prog [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Nantucket Coastal Resilience Advisory Commi6ee (CRAC) Tuesday, March 24, 2026 Via Zoom *Mee$ngs are audio- and video-recorded Members present: Gary Beller, Liz Phelps, Peter Brace, Doug Rose, Tim Braine, Emily Junkins, Joanna Roche, MaD Fee, Hillary Hedges Rayport, Sarah Bois Members Absent: Christy Kickham Staff present: Leah Hill Scheduled Speakers: Laura MareD (SCAPE), Jessy Rojas (SCAPE) , Daniel Berdichevsky(SCAPE), Devon McKaye (Arcadis), Trevor Johnson (Arcadis), Members of the public: Art Gasbarro, D. Anne Atherton, JohnCarl McGrady Recording available here: https://www.youtube.com/watch?v=A7eL_haujDY Packet available here: hDps://nantucketma.portal.civicclerk.com/event/24213/files/agenda/ 34447 1. Call to order • The mee$ng was called to order by Chair Peter Brace 2. Mee$ng announcements • Script for remotely conduc$ng Open Mee$ngs, read by Chair • The mee$ng is being audio/visually recorded 3. Public comment on topics not on the agenda • No public comments 4. Approval of minutes • January 13, 2026 and January 27, 2026 minutes approved a_er brief discussion of details. 5. Presenta$on and discussion on the Town’s Island-wide Strategic Retreat and Reloca$on Program by SCAPE • Presenta$on made by Laura MareD, Devon McKaye • Comments and ques$ons discussed: - Should there be a short term reac$on strategy for emergency situa$ons while plan is being created? Building dept. Health dept. ConCom etc - House moving companies should be encouraged to par$ [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 24, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review nine sign applications

The Sign Advisory Council is meeting to discuss and review sign applications for various properties. The council will consider requests for wall and projecting signs at multiple locations.

signszoningbusiness-permits
✓ Decided: Council approved two new signs and held several others for revisions

The Sign Advisory Council unanimously approved the wall sign for VTT Moby Dick, LLC at 2 Union St and the projecting sign for CLACK, LLC at 33 Main St. It voted to hold for revisions the signs for NISHA at 1 Evergreen Way, NIR Retail at 12 Old South Wharf, and Susan Thurston’s signs on Washington St, as well as to amend the master sign plan for 29 Center St. All procedural motions, including agenda adoption and minutes approval, also passed unanimously.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, March 24, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn, Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 011693 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 812 0038 2018 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of A [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC SAC Minutes March 24, 2026; adotped 4/7/2026 P age 1 of 2 H istoric District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday March 24, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Kevin Kuester Absent members: Mark Cutone Late arrivals: Ben Normand at 9:02 am. Early Departures: None M otion to adopt agenda made by Wolf; seconded by Kuester. Vote: Carried unanimously. A pproval of Minutes: Approve minutes of February 17, 2026 made by Wolf; seconded by Kuester. Vote: Carried unanimously. II. P ublic Comment- none III. Co mmissioner Comments-none Proposed HDC SAC, March 24, 2026 IV. Signs 1. NISHA 14287 1 Evergreen Way Wall sign 68/727 Jardins International Discussion: Wolf- logo to large. Kuester- border and scalloped corners seem large for scale of sign. Why is it not by the entrance? Normand- too small and under scale for the building. Young- agrees with what’s been said. Logo looks close to 15%. Motion- Hold for representation made by Kuester; seconded by Wolf Vote-carries unanimously 2. 29 Center St, LLC 14320 29 Center St Projecting sign 42.3.1/122.2 Brad Guidi Discussion: Young- the guidelines 4 sf for a projecting sign. Kuester- no concerns Normand- no concerns. Wolf- asked about wording Motion to approve scaled down to 5 sf made by Kuester; seconded by Wolf V [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 24, 2026 · 18:00

Nantucket Public School Committee

School Committee will vote on FY27 budget and approve several donor gifts

The Nantucket Public School Committee will vote to adopt the FY27 budget. It will also consider and vote on multiple donations ranging from $300 to $10,000 for programs such as music, STEM, and the woodshop. Additional agenda items include updates on MCAS testing, registration review, and the DIP Action Plan Year 3.

budgetdonationseducationschool-committeefinancemusicstemwoodshop
10 Surfside Road, Nantucket High School, LGI, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, March 24, 2026, 6:00 PM Location / Address HYBRID - Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road · Nantucket, MA 02544 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA To virtually attend the meeting, register using the Zoom Webinar link below: https://zoom.us/webinar/register/WN_1RLtCeHcSG--ap-Qpf_SsA To watch meeting live, click here: https://youtube.com/live/phJ2w6qn2mM I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. MCAS testing update b. NES/NIS change in dismissal procedures c. Additional Updates VI. Presentations and discussions of issues to the Committee a. Project 351 - Ms. Pellegrino, CPS Guidance Counselor and Grade 8 Students Ben Potter and Raphelia Matheney b. Central Registration Review - Sarah Kirk, Central Registrar c. Mid-Year Update: DIP Action Plan Year 3 - Superintendent Elizabeth Hallett d. Policy Updates 1. EFBA [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 24, 2026 · 16:00

Historic District Commission

Historic District Commission to review demolition definitions and approve permits

The Historic District Commission will meet to discuss the definition of demolition and unapproved demolitions, and to vote on permits for new dwellings, renovations, and sign installations across Nantucket.

historic-districtzoningbuilding-permitsdemolitionrenovationsignagehousing
✓ Decided: Historic District Commission adopts new demolition definition and approves many project consents

The commission adopted a broader definition of “demolition” and will send it to Town Counsel for review. It approved all listed consents and consent‑with‑conditions items, including new dwellings, sheds, and hardscape projects, by unanimous vote. Sign committee recommendations were adopted, approving several wall and projecting signs while holding others for revision. The board also approved planting a deciduous tree to screen a solar panel installation.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAR 19 PM 02:03 Original Posting Number: T 222 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, March 24, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_3UZKQSndQ0uos8HnWolQEA#/registration To watch live feed, click here: https://www.youtube.com/live/PtyiiPF9zew Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Pac [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes March 24, 2026; adopted 5/19/2026 DATE: March 24th, 2026 Community Room, 4 Fairgrounds Road & Remote Participation via ZOOM Called to order at 4.05 pm, and announcements by Stephen Welch Staff in attendance: (Fiona Johnson, Holly Backus, Cathy Flynn) Members Present: Welch, Pohl, Oliver, Camp, Patten, MacLeod Remote Participants: Paul Absent Members: Thornewill Early Departures: Backus at 5:00pm. Welch at 6:22pm Adoption of Agenda made by Val. Motion to Approve: (Motion was approved by a unanimous vote) Vote: Carried 5-0 I. RATIFY COMMISSIONER VOTE AND/OR DISCUSSION FROM MARCH 17, 2026 • Definition of demolition (inclusive levels of demolition) • Unapproved demolitions & fines Commissioners: Welch, Pohl, Camp, Oliver, MacLeod; Alternates: Patten, Paul The HDC voted to adopt a new definition of “demolition” that includes multiple levels or tiers of removal, expanding beyond full teardowns and agreed to send a letter to Town Counsel (through proper channels) for review of this definition. The Commission also directed that through the Planning Director, planning staff and preservation plan staff research demolition fees and regulatory frameworks used in comparable communities, with the goal of assembling a range of approaches to enforcement, including for unapproved demolitions. Staff will compile and summarize these findings for HDC review, after which the Commission will decide whether and how to modify Nantucket’s existing [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 24, 2026 · 17:00

Airport Commission, Nantucket Memorial

Airport Commission to review leases and Hardstand 2A construction

The Nantucket Memorial Airport Commission will discuss pending leases, contracts, and a Housing Production Plan. The body will also receive an update from the Fuel Subcommittee and hold an executive session regarding LIUNA collective bargaining or litigation.

airportcontractsleasingconstructionhousing
✓ Decided: Commission unanimously approved airport contracts, except the TSA lease

The Airport Commission approved the McFarland‑Johnson contract amendment, the Trac Builders hardstand construction contract, and the Nantucket Island Rent‑a‑Car loan financing agreement, while holding the TSA lease for further review. The motion was made by Mark, seconded by Bouscaren, and passed with all ayes. The commission also agreed to keep using Thompson House and the new dormitory for seasonal staff this season.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, March 24, 2026 at 5:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/81980001463 The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Zoom Link to Virtually Attend Meeting: https://us06web.zoom.us/j/81980001463 Meeting ID: 819 8000 1463 The meeting will be posted at a later date on YouTube. 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda 3. Public Comment 4. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 5. Pending Matters: a. 031026-01 Housing Production Plan 6. 031026-02 Fuel Subcommittee Update 2 7. Commissioners’ Comment 8. Pub [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING March 24, 2026 The meeting was called to order at 5:0 0 PM by Chairman Arthur Gasbarro with the following Commissioners present: Andrea Planzer, Anthoney Bouscaren, Philip Marks III, and Michael Leavitt. This meeting was conducted remotely by video conference via Zoom and will be aired at a later date on the Town of Nantucket YouTube Channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Rich Lasdin, McFarland-Johnson. Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Public Comment: None. Pending Leases/Contracts Mr. Smith presented Exhibit 1 for approval of the following contracts, leases, and contract amendments.  The United States of America General Services Administration (TSA) - Lease Agreement A Lease Agreement for TSA O [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve the leases, contracts, and contract amendments as set forth in Exhibit One (1), excluding the United States of America General Services Administration (TSA) Lease Agreement
5 yea
Planzer yea · Leavitt yea · Bouscaren yea · Marks yea · Gasbarro yea
Mon Mar 23, 2026 · 10:00

Affordable Housing Trust

Affordable Housing Trust reviews deed‑restriction pilot proposals and award options

The Affordable Housing Trust will evaluate proposals submitted under the Deed Restriction Pilot Program II and consider recommendations for awards. The board will also approve the minutes from the January 13, 2026 meeting and provide a public comment period. The meeting is held remotely via Zoom.

affordable-housingdeed-restrictionpilot-programpublic-commentminutes
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Monday, March 23, 2026, at 10:00 AM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) The meeting will be aired at a later time on the Town’s Government TV You Tube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Kristie Ferrantella Municipal Housing Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR MONDAY, MARCH 23, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89464425944?pwd=lDMAh2qDSgwWKXKlNOpIyMETFPymkL.1 Meeting ID 894 6442 5944 Passcode 310460 I. CALL TO ORDER, ROLL CALL II. ANNOUNCEMENTS 1. This meeting of the Evaluation Committee for the Year-Round Deed Restriction Pilot Program II is Beig Audio and Video Recorded. III. APPROVAL OF AGENDA IV. PUBLIC COMMENT* V. APPROVAL OF MINUTES 1. Approval of Minutes of Januar [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 23, 2026 · 17:00

Nantucket Planning & Economic Development Commission

Four-way stop sign pilot on Surfside Road at Miacomet Road discussed

The commission will discuss a pilot program to install a four-way stop sign at the intersection of Surfside Road, Miacomet Road, and Surfside Drive. It will also hear a guest speaker from the Nantucket Islands Land Bank and consider a letter of support for a MassDOT highway access permit for a proposed bike park. Additional items include updates to the Transportation Improvement Program and reports from various advisory committees.

transportationroadsbike-parkhousingbudget
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Monday, March 23, 2026 at 5:00 pm Location / Address REMOTE ONLY via Zoom https://us06web.zoom.us/j/81935721657?pwd=dKza7q7tvcBeMphvPo5boQ2zxnsCIY.1 Signature of Chair or Authorized Person Leslie Snell, AICP, Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGENDA This meeting is being audio/video recorded and will be uploaded to the Town of Nantucket YouTube page at a later date. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Public Comment for items not included on the agenda: V. Minutes: VI. Announcements: • Four-way stop sign pilot program for Surfside Road at Miacomet Road/Surfside Drive VII. Action/Discussion Items: A. Guest Speaker- Rachael Freeman, Executive Director, Nantucket Islands Land Bank B. Letter of Support to MassDOT District 5 RE: Land Bank’s Highway Access Permit onto Milestone Road for the Proposed Bi [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Mar 20, 2026 · 10:00

Nantucket Historical Commission

Historic commission to discuss survey updates and grant award

The Nantucket Historical Commission will meet to discuss updates on historic resource surveys, including a site visit by PaleoWest, LLC, and the FY26 Preservation Plan grant award. The agenda also includes a review of the Civil War monument damage repair and the approval of minutes from the previous meeting.

historic-commissionsurveysgrantmonumentnpspaleowest
✓ Decided: No substantive actions taken; minutes adopted

The March 20, 2026 Nantucket Historical Commission meeting minutes record only the adoption of the minutes on 05‑15‑26. No specific decisions, approvals, or votes are documented in the provided text.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, March 20, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Staff update • Historic resource surveys update o PaleoWest, LLC / Chronical Heritage survey of Town-owned historic resources  April site visit o Massachusetts Historical Commission FY23 Brant Point and Cliffside surveys  Narrow down list of properties to be surveyed o FY26 Grant Awar [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 1DQWXFNHW+LVWRULFDO&RPPLVVLRQ 0DUFK0HHWLQJ $0 3OHDVDQW6WUHHW1DQWXFNHW0$DQGYLD=RRP $WWHQGHHV %HWV\7\OHU &RPPLVVLRQHU %DUEDUD+DOVWHG &RPPLVVLRQHU  5LWD&DUU &RPPLVVLRQHU +ROO\%DFNXV VWDII±3UHVHUYDWLRQ3ODQQHU RQOLQH $QJXV0DF/HRG &RPPLVVLRQHU ±RQOLQH 6DUDK0F/DQH &RPPLVVLRQHU $EE\'H0ROLQD &RPPLVVLRQHU $EVHQW *HRUJH%XWWHUZRUWK &RPPLVVLRQHU $JHQGD ‡ 5ROOFDOODW$0&RPPLVVLRQHUV5LWD%DUEDUDDQG%HWV\DQG6DUDKDUHLQSHUVRQ &RPPLVVLRQHUV$QJXVLVRQOLQH6WDII+ROO\LVDOVRLQSHUVRQ ‡ 3XEOLFFRPPHQW1RQH ‡ 6WDIIXSGDWH1RWKLQJEH\RQGWKHDJHQGD ‡ +LVWRULFUHVRXUFHVXUYH\VXSGDWH o 3DOHR:HVW//&&KURQLFDO+HULWDJHVXUYH\RI7 RZQRZQHGKLVWRULFUHVRXUFHV ƒ &RQVXOWDQWVZLOOFRPSOHWHWKHLUVLWHYLVLWLQODWH$SULO o (DVWRQ$UFKLWHFWV0DVVDFKXVHWWV+LVWRULFDO&RPPLVVLRQ)<%UDQW3RLQWDQG &OLIIVLGH$UHD ƒ 5LWDDQG+ROO\PHWYLD=RRPZLWKWKHSURMHFWWHDPDQG0+&PHPEHUV ƒ 7LJKWWLPHOLQHIRUFRPSOHWLRQGXHWRSUHYLRXVGHOD\VVXUYH\ZLOOJHQHUDWH VXUYH\IRUPV ƒ /LVWRISURSHUWLHVZDVUHYLHZHGDGGLWLRQDOIRUPVZLOOIRFXVRQ(DVWRQ VWUHHWDQGFRPSOHWLQJIRUPVIRUWKHUHPDLQGHURIWKH%UDQW3RLQWDUHDWKDW KDVQRW\HWEHHQVXUYH\HG ‡ 0DVVDFKXVHWWV+LVWRULFDO&RPPLVVLRQ6XUYH\ 3ODQQLQJ*UDQWIRU3UHVHUYDWLRQ 3ODQ o +ROO\ZDVQRWLILHGWKDW1DQWXFNHWZDVDSSURYHGIRUWKLVJUDQW o 1H[WVWHSLVDNLFNRIIPHHWLQJZLWKWKHVWDWH&RPPLVVLRQWRPRYHIRUZDUGL [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
approve the minutes by October 17, 2025 and January 26, 2026 meetings
5 yea · 1 abstain
Angus yea · Sarah yea · Barbara yea · Betsy yea · Abby abstain · Rita yea
adjourn
6 yea
Betsy yea · Barbara yea · Angus yea · Sarah yea · Abby yea · Rita yea
Thu Mar 19, 2026 · 15:00

Cyrus Peirce Middle School

CPS School Council to discuss FY27 budget and student substance use

The CPS School Council will meet to discuss the FY27 budget and concerns regarding vaping and alcohol at CPS and NHS. The body will also review fundraiser events and Teacher Appreciation Week.

educationbudgetstudent-healthschool-council
10 Surfside Road, Nantucket High School
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
RECEIVED _iY 2026 MAR 09 AM 10:15 4 MEETING POSTING NANTUCKET TOWN CLERK TOWN OF NANTUCKET Posting Number:T 186 Pursuant to MGL Chapter 30A, § 18-25 SA All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPS School Council Meeting Day, Date, and Time | 3:00pm Thursday, March 19, 2026 Location / Address c/o Nantucket Public Schools Nantucket High School 10 Surfside Road NANTUCKET, MA 02554 CPS Cafeteria Signature of Chair or Authorized Person Pct? AAS WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 1) Review and approval of 1/15/26 Minutes (Feb meeting canceled) 2) FY27 Budget Discussion 3) Vaping/Alcohol Concerns at CPS/NHS 4) Fundraiser Events with FONPS 5) Teacher Appreciation Week in May 6) Parent Q&A
Thu Mar 19, 2026 · 15:00

Nantucket Intermediate School Council

School Council will review minutes, survey results, and set action steps

The council will review the February meeting minutes. It will examine the NIS Family Survey results and comments using a data‑driven protocol. The board will then discuss short‑ and long‑term action steps and a communication plan for the School Improvement Plan.

educationschool-councilsurveyplanninggoalscommunication
30 Surfside Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
RECEIVED _) 2026 MAR 16 AM 10:22 MEETING POSTING NANTUCKET TOWN CLERK Posting Number:T 209 TOWN OF NANTUCKET Y Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NIS School Council Day, Date, and Time | Thursday, March 19, 2026 — 3:00 PM Location / Address " 30 Surfside Road, Nantucket, MA 0 NIS Conference Room Signature of Chair or Ps Authorized Person JODZE — WARNING: IF THERE UM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 1. Review of minutes from February NIS School Council 2. School Improvement Plan Focus Goal Work a. Review of results notes of NIS Family Survey using Data Driven Protocol from February meeting . b. Review Comments from Survey 3. Next Steps a. Action Steps i. Short-Term Goals/Action Steps ii. Long-Term Goals/Action Steps b. Communication Plan
Thu Mar 19, 2026 · 15:00

Nantucket Public School Committee

School Committee holds collective bargaining session with teachers

The Nantucket Public School Committee will meet in executive session on March 19, 2026. The purpose is to conduct a collective bargaining session with the Nantucket Teachers Association. No other agenda items are listed.

educationlaborbargaining
30 Surfside Road, NIS Caferteria, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Thursday, March 19, 2026, 3:00 PM Location / Address HYBRID https://zoom.us/j/98181641216?pwd=MgdUbZFFVAu3sKJUEq8MYfiDJgLcFo.1 Nantucket Intermediate School, Cafeteria 30 Surfside Road Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session and not return to open session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Thu Mar 19, 2026 · 16:00

Board of Health

Board to consider short‑term rental regulation amendment and septic upgrades

The Nantucket Board of Health will hold an open public hearing on a proposed amendment to short‑term rental regulations, clarifying owner/operator requirements under town bylaw Chapter 123. The board will also review local upgrade requests for Title 5 septic system setbacks at 42 and 66 Arkansas Avenue, and consider several septic loan requests for properties in the Madaket Harbor and Hummock Pond watersheds. Additional agenda items include routine updates, minutes approval, and continuation of public hearings on watershed and wellhead protection regulations.

housingsepticenvironmenthealthzoning
✓ Decided: Board adopts short‑term rental amendment and approves multiple septic upgrades

The Board adopted an amendment to short‑term rental regulations, adding subsection 7 to section 338‑4 of the town code. It also approved local upgrades for septic setbacks at 42 and 66 Arkansas Avenue and approved loan funding for septic projects at 2 West Way, 11 H Street, and 113 Hummock Pond. All actions were carried unanimously or with unanimous support where noted.

PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, March 19, 2026, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://www.youtube.com/live/j-JMiiYCWA4 Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_0BKltNFKTt-_q4qcA5fzRQ#/registration AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Approval of minutes (2/19/2026, 3/2/2026) 4. Director’s Updates 5. Short-term rental regulations amendment proposal – Open Public Hearing and consider adoption of amendment. The amendment clarifies short-term rental owner/operator requirements as defined in Na [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH March 19, 2026 Adopted May 21, 2026 BOARD OF HEALTH ~~ MINUTES ~~ Thursday, March 19, 2025 Meeting PSF Community Room, 4 Fairgrounds Road, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:00 p.m. Staff in attendance: Roque Miramontes, Director of Public Health; Jerico Mele, Deputy Director of Health and Human Services, John Hedden, Chief Environmental Health Officer Andrew Shapero, Environmental Contamination Administrator Remote Staff: Andrew Shaper, Environmental Contamination Administrator, Tomeka Gary, Public Health Coordinator; Members attending: Ann Smith (chair), Meredith Lepore, James Cooper, Thomas Dixon, Kerry McKenna Remote Members: Public Participant: Devan Braun, Rebec Duhaime, Aron Myers, Travis Lombardi, Willa Arsenault, Graham Veazey, Kim Latlippe, Gary Hedman, Jenny Cook, Matthew Peel, Brent Tardamela, Elizbeth Weber, Linda Williams, Richard Branigan, Ayesha Khan, Chip Clunie, Dawn Hill, Mike Hugo I. PUBLIC ANNOUNCEMENT II. PUBLIC COMMENT Discussion: None provided III. APPROVAL OF MINUTES Discussion All minutes will get approved in April meeting IV. DIECTOR’S REPORT Discussion • Roque Miramontes presented to the select board on March 4th on HHS department priorities • US measles cases are at 1,362 so far in 2026 (vs. ~1,100 all of 2025); 94% are outbreak-associated; Massachusetts has had only 2 cases this year, none on Nantucket • Two Ser [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (8 roll-call votes)
Named votes as recorded in the official record.
open a public hearing
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
close the public hearing
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
amend chapter 338 as presented in the packet
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
approve local upgrade at 42 Arkansas
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
approve local upgrade to 66 Arkansas
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
approve loan for 2 West Way at 50%
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
approve loan for 11 H St
5 yea
Smith yea · Lepore yea · McKenna yea · Cooper yea · Dixon yea
approve loan at 113 Hummock Pond
5 yea
Smith yea · Lepore yea · McKenna yea · Dixon yea · Cooper yea
Thu Mar 19, 2026 · 16:00

Nantucket Islands Land Bank Commission

Commission to consider Golf Capital funds transfer and property management approvals

The Nantucket Islands Land Bank Commission will review monthly updates for Sconset and Miacomet golf courses and authorize a warrant for a Golf Capital funds transfer. It will also approve design signage for a rain garden at 65/67 Easton Street and a contract to move buildings at 41 Jefferson Avenue. An update on the Long‑Range Objectives workgroup and the February financial report will be presented.

golffinanceproperty-managementland-banklong-rangelitigation
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, March 24, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/87269277471?pwd=OnXfMXdsmtG2oLB01xJ2953q9GjbET.1  Webinar ID: 872 6927 7471  Passcode: 860289    Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. GOLF BUSINESS a. Sconset Golf Course – Monthly Review b. Miacomet Golf Course – Monthly Review c. Warrant Authorization – Golf Capital Funds Transfer Request d. Golf Capital Workgroup – Recommendations 4. PROPERTY MANAGEMENT a. 65/67 Easton Street / Land Bank Rain Garden – E [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 19, 2026 · 17:00

Conservation Commission

Commission will hear waiver requests for multiple development projects

The Nantucket Conservation Commission meeting on March 19, 2026 will include a public hearing on several Notice of Intent waiver requests. Items include waiver requests for properties at 16 Hoicks Hollow Road, Baxter Road Alternative Access, 16 & 19 East Creek Road, and 130 Tom Nevers Road. The agenda also lists discussion of orders of conditions, monitoring reports, enforcement actions, and the SBPF Sand Plan.

conservationpublic-hearingwaiversland-usesand-planenforcement
✓ Decided: Commission accepted agenda, continued Hoicks Hollow case, and closed meeting

The commission voted 4‑0 to accept the meeting agenda. The Robert F. Greenhill Revocable Trust case for 16 Hoicks Hollow Road was continued until April 2, 2026. A motion to close the meeting was carried unanimously, 5‑0.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 MAR 9 PM 02:03 Original Posting Number: T189 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, March 19, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/58ciN3pF8xM Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for Thursday, March 19, 2026, 5:00 P.M. The meeting will be held in hybrid format In-person participation located in the Trailer, Room A, 131 Pleasant Street Remote participation via Zoom Webinar (Register at lin [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes March 19, 2026, adopted April 2, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, March 19, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/58ciN3pF8xM Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Schafer, and Plandowski; Williams arrives at 5:17pm Absent Members: Braine, RJ Turcotte Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:00:58) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Plandowski) Vote: Vote Carried: 4:0: Engelbourg, Misurelli, Plandowski, and Schafer (aye) III. Announcements Discussion: (00:01:49) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:02:16) Engelbourg - The Commission received some questions via email from the Nantucket Coastal Conservancy regarding some updates on the discussion we had last meeting about the state of the Baxter Road geotubes. - We don’t have a response for you at tonight’s meeting, but we are [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (2 roll-call votes)
Named votes as recorded in the official record.
accept the agenda
4 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea
close [Public Hearing regarding Town of Nantucket- Baxter Road Alternative Access]
5 yea
Engelbourg yea · Misurelli yea · Plandowski yea · Schafer yea · Williams yea
Thu Mar 19, 2026 · 17:00

Parks and Recreation Commission

Parks and Recreation Commission to review beach and field use requests

The Commission is meeting to discuss the use of public spaces by local organizations and individuals. The body will also receive updates on the Nobadeer Project and debris removal at Tom Nevers. A discussion is scheduled regarding a potential Board of Health ban on turf.

parks-and-recreationpublic-space-useenvironmental-healthinfrastructure
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday, March 19, at 5:00 p.m. Location / Address REMOTE PARTICIPATION ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW.1 Meeting ID: 817 4815 2269 Passcode: 983395 Nantucket Parks and Recreation Commission Meeting Notice and Agenda Thursday, March 19 2026 Meeting to be held at 5:00 p.m. Remotely Via Zoom. 1. Call to Order 2. Reminder this meeting is being audio and video recorded 4. Approval of Agenda for March 16, 2026 5. Public Comment 6. Approval of Minutes from January 15 2025 2 7. Culture and Tourism: Deana Weatherly -Cultural Affairs and Special Events Coordinator • Nantucket Island Chamber of Commerce use of Children's Beach on April 25th • Maria Mitchell A [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 19, 2026 · 13:00

Cannabis Advisory Committee

Committee will discuss the future of social cannabis consumption on Nantucket

The Cannabis Advisory Committee will review updates from the Massachusetts Cannabis Control Commission, including the new social consumption regulations that took effect on January 2, 2026. Members will discuss the future of social consumption venues on the island and consider local implications. The meeting also includes public comment, approval of past minutes, and scheduling of the next meeting.

cannabissocial-consumptionregulationspublic-commentmeeting
✓ Decided: Committee approved agenda, minutes and adjourned meeting

The Cannabis Advisory Committee approved its meeting agenda and the draft minutes from four prior meetings. Both approvals were passed unanimously by roll‑call vote. The committee then voted to adjourn the meeting, also unanimously.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Cannabis Advisory Committee (CAC) Day, Date, and Time Thursday March 19, 2026, 1:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Barry Rector WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Board Members: Barry G. Rector (Chair), Abby DeMolina (Vice-Chair), Joe Plandowski (Secretary), Dawn Hill, Jacques Zimicki Join Zoom Meeting https://us06web.zoom.us/j/84056571521?pwd=TzVQMVZXdkV6SGt6MmpmTFM5dm9rZz09 Meeting ID: 840 5657 1521 Find your local number: https://us06web.zoom.us/u/kZpvpnBWV One tap mobile +13092053325,,88677055726#,,,,*027151# US Dial by your location +1 309 205 3325 US +1 646 558 8656 US (New York) +1 301 715 8592 US (Washington DC) 2 AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. I. Call to Order II. Acceptance of Agenda III. Announcements a. The Cannabis Advisory Committee [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Cannabis Advisory Committee DRAFT Minutes Remote Participation via Zoom March 19, 2026 @ 1:05pm Board Members: Barry Rector (Chair), Abby DeMolina (Vice-Chair), Dawn Hill, Joe Plandowski (Secretary), Jacques Zimicki ______________________________________________________________________________ I. Call to Order Chair Rector called the meeting to order at approximately 1:10pm. In Attendance: Board Members: Public: Barry Rector Aye Kaie Quigley Abby DeMolina Aye Dawn Hill Aye Joe Plandowski Aye Quorum established. II. Approval of Agenda Abby DeMolina made a motion to approve the agenda, seconded by Joe Plandowski. Vote taken by Roll Call: Barry Rector Aye Abby DeMolina Aye Dawn Hill Aye Joe Plandowski Aye III. Approval of Draft Minutes a. October 19, 2023, at 1:00pm b. January 16, 2025, at 1:00pm c. April 17, 2025, at 1:00pm d. November 20, 2025, at 1:00pm Abby DeMolina made a motion to approve the minutes, seconded by Joe Plandowski. Vote taken by Roll Call: Barry Rector Aye Abby DeMolina Aye Dawn Hill Aye Joe Plandowski Aye IV. Public Comment None V. New Business None VI. Reappointments to the Committee None VII. Election of Officers None VIII. Updates from MA Cannabis Control Commission (CCC) Barry Rector noted that social consumption is a major topic to occupy our time over the next year. Meetings to sort out any local concerns will be held with Nantucket Police and Fire Departments, Zoning, Boa [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
4 yea
Barry Rector yea · Abby DeMolina yea · Dawn Hill yea · Joe Plandowski yea
approve the minutes
4 yea
Barry Rector yea · Abby DeMolina yea · Dawn Hill yea · Joe Plandowski yea
adjournment
4 yea
Barry Rector yea · Abby DeMolina yea · Dawn Hill yea · Joe Plandowski yea
Wed Mar 18, 2026 · 15:00

Tree Advisory Committee

Tree Advisory Committee to review updates on local tree projects

The Tree Advisory Committee will meet to discuss updates on specific properties and projects. The agenda includes reviews of storm damage and the 250th Anniversary Liberty Tree Project.

treesstorm-damagepublic-workslandscaping
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time Wednesday, March 18, 2026 at 3:00PM Location / Address DPW CONFERENCE ROOM OR REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance II. COMMITTEE ACCEPTANCE OF AGENDA III. COMMITTEE APPROVAL OF MINUTES IV. CITIZEN/DEPARTMENTAL REQUESTS V. OLD BUSINESS - 159 Orange St. Update - 250th Anniversary Liberty Tree Project (Mary Longacre)- Update - 43 Union St. Update - Storm Damage Update VI. ADJOURNMENT
Wed Mar 18, 2026 · 17:30

Select Board

Select Board to approve contracts and discuss town meeting warrant

The Select Board will approve pending contracts, including a $158,400 residential lease and a $42,744.60 purchase of ATVs for police. The board will also review warrant articles for the May 4, 2026 Annual Town Meeting.

select-boardcontractsbudgetpolicehousingtown-meetingpublic-comment
✓ Decided: Board unanimously proclaimed April 13‑20 as International Dark Sky Week

The Select Board voted unanimously to proclaim April 13‑20, 2026 as International Dark Sky Week on Nantucket. The Board also approved the minutes from the March 11 and 12 meetings, payroll and treasury warrants for March, and pending contracts listed in Exhibit 1. Additionally, the Board agreed to draft supportive comments for several Annual Town Meeting warrant articles, including the Off‑shore Wind Stabilization Fund, Town Employee Housing, LORAN Barracks Housing, and the Somerset Sewer Extension.

PSF COMMUNITY ROOM, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MARCH 18, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/K6Mq24Qc6Wg ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_4CUkYBJ2TmSJmLbyOljW9w I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to [email protected] through April 10, 2026. Learn More at: https://nantuck [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 18, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of March 18, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to [email protected] through April 10, 2026. Learn More at: https://nantucket-ma.gov/3621/Dr- Howard-Dickler-Citizen-Award. 3. May 4, 2026 Annual Town Meeting Warrant Article Information May be Found at https://www.nantucket-ma.gov/3722/2026-Annual-Town- Meeting. The webpage was displayed on the screen and Ms. Gibson reviewed the features. 4. The Community Claims Fund Launched on Monday, January 26, 2026 to Accept Claims. This Fund was Crea [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026 · 17:00

Harbor & Shellfish Advisory Board

Board will discuss the Eelgrass Management Plan priorities

The Harbor & Shellfish Advisory Board meeting on March 17, 2026 will consider several marine and natural resources topics. Items include the Eelgrass Management Plan priorities, Chapter 91 licensing requirements, safe diesel fuel transfer for commercial fishermen, recreational scalloping schedules, and moving no‑wake zone buoys farther out in the main harbor channel. The board will also review commercial scalloping apprenticeship guidelines. Public comment will be taken on marine and natural resources issues.

harborshellfisheelgrassscallopinglicensingno-wake-zonemarine-resources
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, March 17, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting - https://us06web.zoom.us/j/82030123398?pwd=2QHFe2XUr83yUppxbOCwnDl9SZxCZm.1 Meeting ID: 820 3012 3398 Password: 719347 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, March 17, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/82030123398?pwd=2QHFe2XUr83yUppxbOCwnD l9SZxCZm.1 Meeting ID: 820 3012 3398 Password: 719347 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of March 3, 2026 CHAIRMAN’S REPORT MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOURCES REPORT General Natural Resource [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026 · 16:00

Roads and Right of Way Committee

Committee will discuss transportation projects including Pleasant Street sidewalk options

The Roads and Right of Way Committee will review several transportation items, such as sidewalk improvement options on Pleasant Street, an all‑way stop pilot at Surfside Road/Miacomet Road, and a one‑way pilot on Amelia Drive. The meeting will also cover the status of committee reorganization, real‑estate matters like the Boynton Lane encroachment policy, and updates from the DPW and Harbor Plan.

transportationsidewalkstrafficreal-estatecommittee-reorg
✓ Decided: Committee approved Dec 2025 minutes and recommended monument replacements

The Roads and Right‑of‑Way Committee unanimously approved the December 16, 2025 meeting minutes. It recommended prioritizing the replacement of deteriorating concrete markers with donated granite monuments, pending Select Board approval. The meeting was adjourned by unanimous vote.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Roads and Right of Way Committee Day, Date, and Time Tuesday, March 17, 2026, at 4:00 pm Location / Address Room A, The Trailer, 131 Pleasant Street; or by Zoom: Join Zoom Meeting https://us06web.zoom.us/j/87669110695?pwd=mIL8nMalDNshfRZ9D5DiaDEjIs0ZP5.1 Meeting ID: 876 6911 0695 Passcode: 487956 Signature of Chair or Authorized Person Lee W. Saperstein WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Expected Attendance: Members: Rick Atherton, Gordon Auchterlonie, Ed Gillum, Nelson (Snookie) Eldridge, Nat Lowell, Rob Ranney, Allen Reinhard, Lee Saperstein, and Phil Smith; ex officio: Mike Burns, Drew Patnode, Bob Bystrowski, and Tracy MacDonald. 1. Call to Order and Roll Call; this meeting is being audio and video recorded: Lee Saperstein. 2. Public and Commissioners’ Comments on Items not on the Agenda. 2. Approval of December Minutes: Lee Saperstein. 3. Status of Committee Reorganization: Robert Bystrowski and Lee Saperstein. To coincide with all other co [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
TOWN OF NANTUCKET ROADS AND RIGHT-OF-WAY COMMITTEE Final and Approved Meeting Minutes – March 17, 2026 1. CALL TO ORDER Chair Lee Saperstein called the meeting to order at 3:54 PM. The meeting was recorded: https://www.youtube.com/watch?v=YXCdMN6AkeQ. 2. ROLL CALL Committee Members Present: Rick Atherton (leave at 4:30 pm), Gordon Auchterlonie, Snookie Eldridge, Ed Gillum, Alan Reinhard, Phil Smith, Lee Saperstein (Chair). There was a quorum at all times. Staff/Ex Officio Present: Mike Burns, Drew Patnode, Robert Bystrowski, Tracy MacDonald. Guests: Debora Goudemond (New Committee Organizer), Neil Paterson, Yordan Petkov, Jim Mondani. Absent: Nat Lowell, Rob Ranney 3. PUBLIC COMMENT Jim Mondani raised concerns regarding the Select Board's decisions on Sconset Bluff, arguing that public access rights must be preserved and cautioning against private control of public ways. Chair Saperstein responded that the Board's decisions were advisory and based on suggestions rather than being binding mandates. 4. APPROVAL OF MINUTES The committee reviewed the minutes from the December 16, 2025, meeting. Motion: To accept the December minutes as presented. Moved/Seconded: Unanimously approved by roll-call vote (Gillum, Reinhardt, Smith, Saperstein: Aye). 5. COMMITTEE TRANSITION Lee Saperstein provided a detailed update on the transition from the Roads and Right-of- Way Committee to the new Transportation and Public Access Committee. This new body will [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
To accept the December minutes as presented
4 yea
Gillum yea · Reinhardt yea · Smith yea · Saperstein yea
Tue Mar 17, 2026 · 12:30

Affordable Housing Trust

Affordable Housing Trust to discuss real property at five locations

The Affordable Housing Trust will meet in executive session to consider the purchase, exchange, lease, or value of five specific real estate properties. The board will also review executive session minutes from February and March 2026.

affordable-housingreal-estateproperty-acquisition
✓ Decided: Board approved motion to adjourn to executive session for property matters

The Affordable Housing Trust voted to adjourn the March 17 meeting to an executive session. The motion covered approval of prior executive session minutes and discussion of several real‑property transactions. All five members present voted aye, so the motion passed unanimously.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, March 17, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, MARCH 17, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89243722122?pwd=q3T4GrZVBtz4GUbOxWUJu68vfEqoNK.1 Meeting ID: 892 4372 2122 Passcode: 461305 I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18- 23) to Approve Executive Session Minutes from February 17, 2026, and March 3, 2026. 2. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at 14 Somer [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on March 17, 2026, at 12:30 PM Approved the 7th day of April 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, March 17, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present : Penny Dey and Brooke Mohr. Forest Bell, Mary Mack, and Abby De Molina joined remotely. Staff members present were Kristie Ferrantella (Housing Director), Dylan Metsch-Ampel (Deputy Housing Director) , and Caroline Ferguson (Administrative Specialist) . Vicki Marsh (Town Counsel), Eric Barth (Town Counsel), and Keelin Ciccariello (Town Counsel) joined remotely. CONVENE IN OPEN SESSION All votes were taken by roll call. I. CALL TO ORDER Vice-Chair Dey called the meeting to order at 12:34 pm. Ms. Mohr made a MOTION to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purpose of: 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18- 23) to Approve Executive Session Minutes from February 17, 2026, and March 3, 2026. 2. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property at 14 Somerset Road where an Open Meeting May have a Detrimental Effect on the Negotiating Position of the Affordable Housing Trust [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn to executive session pursuant to MGL C. 30A § 21(A)
5 yea
Forest Bell yea · Mary Mack yea · Abby De Molina yea · Brooke Mohr yea · Penny Dey yea
Tue Mar 17, 2026 · 10:00

Community Preservation Committee

Committee reviews fund requisitions totaling over $1.2 million for FY 26 projects

The Community Preservation Committee will consider fund requisitions for FY 26, including $48,000 for the Maria Mitchell Association’s Mitchell House Conservation, $830,110.90 for St. Paul’s Church, $250,000 for the Nantucket Racket Sports Association, $56,114 for Interfaith Council rental assistance, and $16,430 for the Linda Loring Restoration project. The meeting will also include updates on an office move and staffing, a letter of appreciation to Glena Stokes‑Scarlett, a report on the Finance Committee meeting held March 9, 2026, and discussion of project assignments for FY 2025 and FY 2026.

fundingbudgetcommunity-preservationstaffingprojects
✓ Decided: Committee unanimously approves $1.2M in project requisitions

The agenda was approved unanimously. The committee voted unanimously to approve five project requisitions totaling $1,200,654: Mariah Mitchell ($48,000), Linda Luring ($16,430), St. Paul’s ($830,110), Racket Club ($250,000) and Interfaith Council ($56,114). The next CPC meeting was set for April 21, 2026, and the meeting was adjourned unanimously.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time TUESDAY, MARCH 17, 2026 10:00 AM Location / Address 131 PLEASANT STREET – ROOM A (HYBRID) Remote Participation via Zoom Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Approval of Minutes None Correspondence: None AMENDED MEETING POSTING Original posting date: 3/12/26 Original Posting # T196 2 Guests: None New Business: 1. Fund Requisitions: Maria Mitchell Association – Mitchell House Conservation FY 26 $48,000.00 (Richen) Linda Loring Restoration -Long Pond – FY 25 $16,430.00 (Richen) St. Paul’s Church – FY 26 $830,110.90 (Williams) Nantucket Racket Sports Association – FY 26 $250,000.00 (Dutra) Interfaith Council – Rental Assista [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
7C Hanabea Lane, Nantucket, MA. 02554 508-325-6682 Community Preservation Committee Meeting Minutes for 3/17/2026 YouTube Link: https://www.youtube.com/watch?v=c6dC-8dOPd0 Meeting Opening and Preliminary Technical Issues [00:00:00] Meeting Opening and Attendance Confirmation - The Community Preservation Committee (CPC) meeting convened on Tuesday, March 17th, 2026, at 10:18 AM in Room A at 131 Pleasant Street. - Opening greetings included St. Patrick's Day wishes and mention of Burns Day in April. - Attendance was confirmed with all members present: Tom Dixon, Jesse Dutra, Neville Richen, John Schafer, Connie Patten, Tim Soverino, Jesse Dutra, Eleanor Antonietti, and Madam Chair Linda Williams. - The agenda was approved unanimously. **Agenda and Correspondence Overview** [00:01:30] - No new correspondence was received for this meeting; correspondence was expected for the next meeting regarding fund reallocation. - No guests were present. - Several requisitions were reviewed: - Mariah Mitchell: $48,000 - Linda Luring: $16,430 - St. Paul's: $830,110 - Racket Club: $250,000 - Interfaith Council: $56,114 (monthly bills for assistance payments) - Discussion noted that the Racket Club project is nearing fiscal year closeout; St. Paul’s project has a significant outstanding balance; Linda Luring and Mariah Mitchell projects are ongoing. **Questions on Requisitions and Project Billing** [00:02:56] - Clarification was given regarding St. Paul’s large invoice appearing as a lump sum near p [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 17, 2026 · 16:00

Historic District Commission

Historic District Commission to review residential construction and renovations

The Historic District Commission will discuss and vote on various property alterations, including new dwellings and rooftop solar installations. The body is also reviewing old business regarding additions and hardscaping across several properties.

zoninghistoric-preservationhousingsolarconstruction
✓ Decided: Historic District Commission approved projects and sought demolition guidance

The commission unanimously approved multiple property consent applications, as well as specific projects at 10 Meadowview Dr and 94 Hulbert Ave. It also voted to seek Town Counsel guidance on demolition definitions. Several other applications were held for revisions, and the meeting was adjourned at 6:58 PM.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAR 11 PM 02:10 Original Posting Number: T 195 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, March 17, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_yq-gKrrxSEuqQrxebcSCYQ#/registration To watch live feed, click here: https://www.youtube.com/live/iJxE4twtAbs Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcp [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HISTORIC DISTRICT COMISSION Minutes March 17, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-C hair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul S taff: Cathy Flynn, Holly Backus and Fiona Johnson H olly Backus left the meeting at 4:50pm Present: Welch, Camp, MacLeod, Patten Remote: Pohl, Thornewill, Paul Late arrivals: Oliver at 5:35PM M eeting called order at 4:05pm by Stephen Welch MacLeod made the motion to approve the agenda. Board: Welch, Patten, MacLeod and Camp I.COMMISSIONER DISCUSSION AND/OR VOTE • Definition of demolition (inclusive levels of demolition) *not anticipated by the Chair with 48 hours • Unapproved demolition & fines *not anticipated by the Chair with 48 hours Request through the Planning Director; How do other Historic Districts handle fees for demolition without approval? Demolition happens in different ways. Would like a more granulated definition through Town Counsel based on levels and/or classification , including fee structure. Commissioners: Welch, Pohl, Camp, MacLeod, Thornewill; Alternates: Patten, Paul Motion to support recommendation through the Chair acquiring information and guidance through Town Counsel what best practice s are throughout Massachusetts made by MacLeod. Carries unanimously I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. 6 Tautemo L [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 16, 2026 · 16:00

Affordable Housing Trust

Joint meeting to discuss Hummock Pond Watershed and Wellhead Protection regulation changes

The Affordable Housing Trust will hold a joint meeting with the Board of Health and the Planning Board. The discussion will focus on proposed amendments to the Board of Health's Hummock Pond Watershed and Wellhead Protection District regulations. No other agenda items are listed.

environmenthealthwaterhousingregulation
✓ Decided: Agenda approved; meeting adjourned; septic regulation amendments not decided

The joint meeting approved its agenda by roll‑call vote. Members later voted to adjourn the Affordable Housing Trust meeting. No vote was taken on the proposed septic‑regulation amendments; the boards only discussed concerns and next steps.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Monday, March 16, 2026, at 4:00 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Dylan Metsch-Ampel Deputy Housing Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR MONDAY, MARCH 16, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/87463497410?pwd=ybBZjqjbc5SqxJ3am70qis7KIO7whK.1 Meeting ID: 874 6349 7410 Passcode: 876586 I. CALL TO ORDER II. JOINT MEETING WITH AFFORDABLE HOUSING TRUST, BOARD OF HEALTH , AND PLANNING BOARD REGARDING BOARD OF HEALTH HUMMOCK POND WATERSHED AND WELLHEAD PROTECTON DISTRICT REGULATION AMENDMENTS III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Joint Meeting on March 16, 2026, at 4:00 PM Approved the 7th day of April 2026 NANTUCKET AFFORDABLE HOUSING TRUST JOINT MEETING WITH PLANNING BOARD AND BOARD OF HEALTH MEETING MINUTES Monday, March 16, 2026 Participation via Zoom – 4:00 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Planning Board Members: David Iverson (Chair), Nathaniel Lowell (Vice- Chair), Joseph Topham, Hilary Hedges Rayport, John Kitchener Board of Health: Ann Smith (Chair), Meredith Lepore (Vice- Chair), James Cooper, Thomas Dixon, Kerry McKenna Attending Members: • Affordable Housing Trust: Penny Dey, Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Brooke Mohr • Planning Board: David Iverson, Nathaniel Lowell, John Kitchener, Hillary Hedges Rayport, Joseph Topham; alternates: Abby De Molina, Howard Matz • Board of Health: Meredith Lepore, Ann Smith, Thomas Dixon, and Kerry McKenna Staff in Attendance: Kristie Ferrantella (Housing Director), Dylan Metsch- Ampel (Deputy Housing Director), Caroline Ferguson (Administrative Specialist), Leslie Snell (Planning Director), Megan Trudel (Deputy Planning Director ), Catherine Ancero (Administrative Specialist), Roque Miramontes (Health & Human Services Director), John Hedden (Chief Environmental Health Office), Jerico Mele (Deputy Director of Health & Human Services), Andrew Shapero (Environmental Contamination Administrator) [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
approve the agenda
5 yea
Joseph Topham yea · John Kitchener yea · Hillary Hedges Rayport yea · Nathaniel Lowell yea · David Iverson yea
Mon Mar 16, 2026 · 16:00

Board of Health

Board of Health, Housing Trust, and Planning Board discuss watershed regulation changes

The Nantucket Board of Health will hold a joint meeting with the Affordable Housing Trust and the Planning Board. The meeting will focus on proposed amendments to the Hummock Pond Watershed and Wellhead Protection District regulations. The session will be conducted remotely via Zoom and will be streamed later on the town’s YouTube channel.

healthenvironmentwater-qualityplanninghousing
✓ Decided: Board approved the meeting agenda

The Board of Health voted 4‑0 to approve the meeting agenda and then voted 4‑0 to adjourn the session. No substantive policy or regulatory actions were decided during this meeting; discussion focused on proposed watershed regulations and related housing recommendations.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Monday, March 16, 2026, at 4:00 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Ann Smith WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR MONDAY, MARCH 16, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/87463497410?pwd=ybBZjqjbc5SqxJ3am70qis7KIO7whK.1 Meeting ID: 874 6349 7410 Passcode: 876586 I. CALL TO ORDER II. JOINT MEETING OF BOARD OF HEALTH, AFFORDABLE HOUSING TRUST , AND PLANNING BOARD REGARDING BOARD OF HEALTH HUMMOCK POND WATERSHED AND WELLHEAD PROTECTON DISTRICT REGULATION AMENDMENTS III. ADJOURNMENT - 2 -
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH March 16, 2026 Adopted May 21, 2026 BOARD OF HEALTH ~~ MINUTES ~~ Monday, March 16, 2026 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:20 p.m. Remote Staff: Roque Miramontes, Director of Public Health; Jerico Mele, Deputy Director of Health and Human Service; John Hedden, Chief Environmental Health Officer; Andre Shapero, Environmental Contamination Administrator Remote Members: Ann Smith (chair), Meredith Lepore, Kerry McKenna, Thomas Dixon Public Participant: I. CALL TO ORDER II. JOINT MEETING OF BOARD OF HEALTH, AFFORDABLE HOUSING TRUST, AND PLANNING BOARD REGARDING BOARD OF HEALTH HUMMOCK POND WATERSHED AND WELLHEAD PROTECTION DISTRICT REGULATION AMENDMENTS Discussion: Why IA systems are being required • The existing IA regulations covering Nantucket Harbor and Madaket have had a positive impact on water quality, and the BOH wants to extend the same framework to the Hummock Pond watershed and Wellhead Protection District for consistency and broader protection • Kerry McKenna explained the core rationale: protecting the sole-source aquifer and surface water in the island's most densely populated areas, the same logic that drove the earlier Madaket and harbor regulations • The BOH noted that Long Pond is now the healthiest pond on the island, which they attribute in part to the IA regulations in the Madaket area Water quality science: nitrogen and PFAS • Andrew Shapero presented da [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 16, 2026 · 11:00

Select Board

Select Board reviews liquor license renewals, festival permits, and utility petitions

The Select Board will consider renewal of seasonal liquor licenses and approve charitable wine license applications for the Nantucket Wine and Food Festival. It will hold a compliance hearing for multiple violations of the all‑alcoholic beverages restaurant license for Bar Yoshi at 21 Old South Wharf. The board will also conduct public hearings on new restaurant and live‑entertainment licenses for The Dive at 15 South Water Street and on several utility conduit installations proposed by Nantucket Electric Company/National Grid.

licensingalcoholutilitiespublic-hearingseventspermits
✓ Decided: Select Board approves seasonal liquor license renewals and Daffodil Festival waiver

The board unanimously approved the renewal of all seasonal liquor licenses, noting the non‑renewal of The Green's license. It also approved the Chamber of Commerce's request for the Daffodil Parade and Tailgate Picnic event notification and a waiver of the open‑container bylaw for that event. The Wine Festival charitable wine license application was held for further information, and a two‑day suspension for Bar Yoshi was issued in abeyance pending future violations.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, MARCH 16, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/Vb6HE5_Wml4 ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_XqzLdZLcS5K9yMHpbCNGqg I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Request for Renewal of Seasonal Liquor Licenses. 2. Nantucket Wine and Food Festival Charitable Foundation, Inc.: Request for Approval and Execution of Alcoholic Beverages Control Commission Charitable Wine License Applications for Festival Events May 27 - 31, 2026. 3. Nantucket Island Chamber of Commerce: a) Request for Approval and Execution of Massachusetts Department of Transportation (MassDOT) Ev [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 16, 2026 Page 1 of 5 SELECT BOARD Minutes of the meeting of March 16, 2026. The meeting took place by remote participation via Zoom Webinar. Select Board Members present were Dawn E. Hill, Tom Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Also present were Operations Administrator Erika Mooney and Licensing Administrator Amy Baxter. I. CALL TO ORDER Chair Hill called the meeting to order at 11:00 AM. II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING – DEPARTMENTAL REQUESTS 1. Request for Renewal of Seasonal Liquor Licenses. Ms. Baxter noted that the Agenda Item Summary (AIS) form in the packet is not correct, but that the renewal list and certification form are correct. She reviewed the request and the list of seasonal liquor license renewals as found in the Select Board’s agenda packet, noting that there are still two weeks left until renewals are due so there may be a couple of additions or changes and she might need to bring them to a Wednesday Select Board meeting in order to get the renewals to the Alcoholic Beverages Control Commission (ABCC) in time. She noted one non- renewal: The Green Gull LLC dba The Green, which has “abandoned” its license with no communication to the Town. She said the Board voted on the seasonal estimated population at its December meeting, which limits the number of seasonal package stores to nine, and with the non-renewal [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
approval of the seasonal liquor license renewals noting the one non-renewal for The Green
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
hold this matter for further information and to allow it to come before the Board at the next available Wednesday night meeting (Nantucket Wine and Food Festival Charitable Foundation, Inc. request)
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
approval of items a) and b) (Nantucket Island Chamber of Commerce MassDOT Event Notification Form and waiver of Chapter 54(1)(c))
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
close the evidentiary hearing (Bar Yoshi)
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Mon Mar 16, 2026 · 10:30

Affordable Housing Trust

Affordable Housing Trust meeting cancelled, no items will be considered

The scheduled Affordable Housing Trust meeting for March 16, 2026 has been cancelled. No agenda items will be discussed or decided. The meeting was to be held via Zoom and later posted on the town's YouTube channel.

housing
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date _2026 MAR 06 PM 02:55_ Original Posting Number _T 184_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time March 16, 2026, 10:30 am Location / Address REMOTE PARTICIPATION via ZOOM (See Below) The meeting will be aired at a later time on the Town’s Government TV You Tube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Kristie Ferrantella Municipal Housing Director THIS MEETING HAS BEEN CANCELLED
Mon Mar 16, 2026 · 16:00

Planning Board

Joint meeting to discuss Hummock Pond watershed and wellhead protection regulation changes

The Planning Board will hold a joint meeting with the Board of Health and the Affordable Housing Trust. The agenda item concerns proposed amendments to the Hummock Pond Watershed and Wellhead Protection District regulations. No other items are listed for this meeting.

environmenthealthhousingplanning
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Planning Board Day, Date, and Time Monday, March 16, 2026, at 4:00 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Megan Trudel Deputy Planning Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR MONDAY, MARCH 16, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/87463497410?pwd=ybBZjqjbc5SqxJ3am70qis7KIO7whK.1 Meeting ID: 874 6349 7410 Passcode: 876586 I. CALL TO ORDER II. JOINT MEETING WITH BOARD OF HEALTH AND AFFORDABLE HOUSING TRUST REGARDING THE BOARD OF HEALTH HUMMOCK POND WATERSHED AND WELLHEAD PROTECTON DISTRICT REGULATION AMENDMENTS III. ADJOURNMENT - 2 -
Fri Mar 13, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The scheduled Washington Street Collaborative Work Group meeting for March 13, 2026 was cancelled. No agenda items will be considered at this time. Residents should await a rescheduled notice.

meetingcancellationcommunitynantucket
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, March 13, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/82209999469?pwd=7ziqFM1tcY0vIEFKMblhKOF3xcRGPp.1 Meeting ID: 822 0999 9469 Passcode: 394349 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Thu Mar 12, 2026 · 16:00

Finance Committee

Finance Committee to review 2026 Town Meeting warrant

The Finance Committee will hold a joint meeting with the Select Board and Planning Board to review and make motions on the final 2026 Annual Town Meeting Warrant. The meeting will be held remotely via Zoom.

financewarrantmeetingselect-boardplanning-boardzoomremote
REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, MARCH 12, 2026 @ 4:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOUTUBE LINK FOR VIEWING ONLY: https://www.youtube.com/live/shP1LvTsKmc ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_cNyWyzMoTaSBM1BVMfNFpg 1. CALL TO ORDER 2. JOINT MEETING WITH SELECT BOARD AND PLANNING BOARD TO REVIEW FINAL 2026 ANNUAL TOWN MEETING WARRANT WITH MOTIONS 3. ADJOURNMENT
Thu Mar 12, 2026 · 16:00

Planning Board

Joint meeting to review 2026 Annual Town Meeting warrant

The Planning Board will hold a joint session with the Select Board and Finance Committee to examine the final 2026 Annual Town Meeting warrant and related motions. The meeting is scheduled for March 12, 2026 at 4:00 PM via Zoom. No other agenda items are listed.

planningfinanceselect-boardwarranttown-meeting
✓ Decided: Planning Board approved minutes, held joint meeting and adjourned

The Planning Board approved its March 12, 2026 minutes and participated in a joint meeting with the Select Board and Finance Committee to review the final 2026 Annual Town Meeting warrant articles. No substantive approvals, denials, or amendments were voted on. The Board, Finance Committee, and Select Board each moved to adjourn the meeting unanimously.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 03-12-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_cNyWyzMoTaSBM1BVMfNFpg To view the meeting only, see link below: https://youtube.com/live/shP1LvTsKmc Committee/Board/s PLANNING BOARD Day, Date, and Time Thursday, March 12, 2026, at 4:00PM Location / Address REMOTE ONLY –ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_cNyWyzMoTaSBM1BVMfNFpg Signature of Chair or Authorized Person MEGAN TRUDEL, DEPUTY [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Planning Board Minutes of the Meeting of March 12, 2026 Page 1 of 3 PLANNING BOARD APPROVED MINUTES OF 03-12-2026 JOINT MEETING WITH SELECT BOARD & FINANCE COMMITTEE *The Planning Board meeting will be audio and video recorded Board Members: David Iverson, Chair (remote participation), Nat Lowell Vice-Chair (remote participation), Joseph Topham (remote participation), John Kitchener (remote participation), and Hillary Hedges Rayport (remote participation), Alternates: Stephen Welch (Absent), Abby De Molina (Absent), and Howard Matz (remote participation) Staff: Leslie Snell (Director of Planning) (remote participation), Meg Trudel (Deputy Director of Planning) (remote participation), William Saad (Zoning Administrator/Land Use Specialist) (remote participation), and Catherine Ancero (PLUS Administrative Specialist) (Absent) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ I. Call to order Chair Iverson called the Planning Board meeting to order at 4:02PM. Chair Hill called the Select Board meeting to order at 4:02 PM. Chair Jill Vieth called the Finance Committee meeting to order at 4:02PM. Attendance taken by roll call: Finance Committee members: Chair Jill Veith, Aye (remote participation) Anthonie Goudemond, Aye (remote participation) Martin McKerrow, Aye (remote participation) Joanna Roche, Aye (remote participation) Joseph Wright, Aye (remote participation) Jeremy Bloomer, Aye (remote participation) Absent: Rob Giacchetti Christopher Glow [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn the meeting at 4:48PM
5 yea
John Kitchener yea · Hillary Hedges Rayport yea · Nat Lowell yea · Dave Iverson yea · Joseph Topham yea
Thu Mar 12, 2026 · 13:00

Zoning Board of Appeals

Special permit sought to raise garage height at 54 Cliff Road

The Zoning Board of Appeals will consider an old‑business vote on a special permit to vertically expand a non‑conforming garage at 54 Cliff Road, increasing its height by about five feet. New‑business items include a request to withdraw an appeal for a storage‑container violation at 9 Hinsdale Road, a variance to locate a shed closer than required at 74 Monomoy Road, and special permits for large residential pools at 308 Madaket Road and 13 Starbuck Road. The board may also take votes on other routine matters and will allow public comment on items not listed.

zoningspecial-permitvarianceresidentialwater-featuregarageshed
✓ Decided: Board approved a special permit for a large residential pool at 308 Madaket Road.

The Zoning Board of Appeals approved a special permit to install an 880‑sq‑ft pool and spa at 308 Madaket Road, with conditions on chemicals, water source, lighting and historic‑district compliance. It also approved a special permit for a vertical garage expansion at 54 Cliff Road, approved the withdrawal of a violation order for 9 Hinsdale Road, and continued the shed setback variance request for 74 Monomoy Road to the April 9 meeting. All motions passed unanimously (5‑0). No decision was made on the pool variance at 13 Starbuck Road, which was noted as a conflict.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, March 12, 2026, at 1:00 PM Location / Address 4 Fairgrounds Road, Nantucket, MA 02554 PSF COMMUNITY ROOM & REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Nicky Sheriff, Land Use Specialist WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA (Subject to Change) The meeting will be recorded and archived at www.nantucket-ma.gov. ZOOM WEBINAR REGISTRATION LINK: https://us06web.zoom.us/webinar/register/WN_YpjqIl_-Qm6VzsvOwkgO0w To view the LIVE broadcast of the meeting, see YouTube Link at https://youtube.com/live/SlzNgOtnDNE BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CALL TO ORDER: II. APPROVAL OF THE AGENDA: III. PUBLIC COMMENT for items not listed on the agenda: IV. APPROVAL OF MINUTES: 2 V. OLD BUSINESS (VOTES MAY BE TAKEN): 2026-0034 Pamela Washburn Griffin Trust 54 Cliff Road Link02554 Sitting-SM, LB, EA, JB, JM Action Deadline Apr [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved ZBA Minutes – March 12, 2026 1 ZONING BOARD OF APPEALS 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket. ma.gov Commissioners: Susan McCarthy (Chair), John Brescher (Vice Chair), Elisa Allen (Clerk), Joe Marcklinger, Lisa Botticelli Alternates: Mark Poor, Jim Mondani, Robert Constable ~~ MINUTES ~~ Thursday, March 12, 2026 *Adopted April 09, 2026* This meeting was held via remote participation using ZOOM and YouTube. I. CALL TO ORDER Called to order at 1:05 pm and Announcements made by Chair McCarthy Attending Members: McCarthy, Brescher, Constable, Allen, Mondani Staff in attendance: Nicky Sheriff; Land Use Specialist Absent: Poor, Marcklinger, Botticelli Remote Members: - Late Arrivals: - Early Departures: - II. APPROVAL OF AGENDA Motion: Motion to approve the agenda. (Made by: Brescher) (Seconded by: Elisa) Vote: Carried 5-0// McCarthy, Brescher, Allen, Mondani, Constable (Aye) III. PUBLIC COMMENT IV. APPROVAL OF MINUTES V. OLD BUSINESS 2026-0034 Pamela Washburn Griffin Trust 54 Cliff Road Link02554 Action Deadline April 14, 2026 The Applicant seeks relief by Special Permit pursuant to Nantucket Zoning Bylaw Sections 139-30 and 139-33A(1)(a) to alter a nonconforming garage structure by vertical expansion to the west and south, including dormers, resulting in an increase in height of approximately five (5) feet. The garage structure is nonconforming with respect to rear and westerly side [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (3 roll-call votes)
Named votes as recorded in the official record.
approve the agenda
5 yea
McCarthy yea · Brescher yea · Allen yea · Mondani yea · Constable yea
approve relief by Special Permit pursuant to Nantucket Zoning Bylaw Sections 139-30 and 139-33A(1)(a) to alter a nonconforming garage structure by vertical expansion to the west and south, including…
5 yea
McCarthy yea · Brescher yea · Allen yea · Constable yea · Mondani yea
approve the withdrawal without prejudice
5 yea
McCarthy yea · Brescher yea · Allen yea · Mondani yea · Constable yea
Thu Mar 12, 2026 · 08:00

Nantucket Water Commissioners

Nantucket Water Commissioners meeting cancelled

The meeting scheduled for March 12, 2026, was cancelled because the body was unable to meet the required quorum.

water-commissionerscancelled-meeting
1 Milestone Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date _03/09/2026_____ Original Posting Number 187____ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, March 12, 2026, at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts Unable to meet the quorum required THIS MEETING HAS BEEN CANCELLED
Thu Mar 12, 2026 · 16:00

Select Board

Select Board to review 2026 Town Meeting warrant

The Select Board will hold a joint meeting with the Finance Committee and Planning Board to review the final 2026 Annual Town Meeting warrant and make motions.

town-meetingfinanceplanningselect-boardwarrant
✓ Decided: Select Board adjourned after reviewing 2026 Town Meeting warrant

The Select Board, Finance Committee, and Planning Board met remotely to review the draft 2026 Annual Town Meeting warrant. No motions were adopted or denied; the meeting concluded with a motion to adjourn that was approved by all members present.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time THURSDAY, MARCH 12, 2026, 4:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/shP1LvTsKmc ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_cNyWyzMoTaSBM1BVMfNFpg I. CALL TO ORDER II. JOINT MEETING WITH FINANCE COMMITTEE AND PLANNING BOARD TO REVIEW FINAL 2026 ANNUAL TOWN MEETING WARRANT WITH MOTIONS. III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 12, 2026 Page 1 of 2 SELECT BOARD JOINT MEETING WITH FINANCE COMMITTEE AND PLANNING BOARD Minutes of the meeting of March 12, 2026. The meeting took place via remote participation using Zoom Webinar. Select Board Members present were Dawn E. Hill, Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Also present were Town Manager C. Elizabeth Gibson, Deputy Town Manager Rick Sears, Operations Administrator Erika Mooney, Finance Director Brian E. Turbitt, Deputy Finance Director Susan Carmel, Assistant Town Accountant Steven Hunter, Planning Director Leslie Snell, Deputy Planning Director Megan Trudel, Land Use Specialist Billy Saad and Attorney John Giorgio of Town Counsel’s office. Finance Committee members present were Jill Vieth, Jeremy Bloomer, Anthonie Goudemond, Martin McKerrow, Joanna Roche and Joseph Wright. Rob Giacchetti, Christopher Glowacki and Peter Schaeffer were not present. Planning Board members present were David Iverson, John Kitchener, Nat Lowell, Hillary Hedges Rayport and Joseph Topham. Planning Board Alternate member Howard Matz was also present. I. CALL TO ORDER Chair Hill called the Select Board meeting to order at 4:01 PM. Chair Jill Vieth called the Finance Committee meeting to order at 4:02 PM. Chair David Iverson called the Planning Board to order at 4:02 PM. II. JOINT MEETING WITH FINANCE COMMITTEE AND PLANNING BOARD TO REVIEW FINAL 2026 ANNUAL TOWN MEETING WARRANT W [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
adjourn
5 yea
Hill yea · Dixon yea · Fee yea · MacNab yea · Mohr yea
Wed Mar 11, 2026 · 17:30

Select Board

Select Board to vote on $9.3 million bond sale for housing and airport projects

The Nantucket Select Board will consider several approvals, including a $9,325,000 bond anticipation note for affordable housing land acquisition, a sea‑street pump station, and airport runway work. The board will also hear a public hearing on year‑round use of two private aquaculture leases and a request to waive fees for a property at 9 Pine Grove Lane. Additional items include approval of minutes, treasury warrants, and a $175,000 seasonal communities grant award.

budgethousingairportenvironmentpublic-hearing
✓ Decided: Select Board approves $9.3 M bond sale and removes aquaculture lease restrictions

The Board approved a $9,325,000 Bond Anticipation Note sale to fund a pump station, affordable‑housing land acquisition, and airport projects. It also voted to remove the seasonal use restrictions on six private aquaculture leases, allowing year‑round operation. Additional actions included waiving certain historic‑district and sewer fees, extending an emergency yard‑waste regulation, scheduling a public hearing on solid‑waste fee changes, and approving pilot stop signs on Surfside Road.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MARCH 11, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/xM2tREL-x_Q ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_q8LmGapeQ5m2y7_9JZrenQ I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to [email protected] through April 10, 2026. Learn More at: https://nantuck [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 11, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of March 11, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented, with two changes: item X-1 was moved earlier in the agenda as indicated; the HDC appeal at the end of the agenda will be continued to April 1, 2026 and not heard tonight. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is Accepting Nominations for the 2026 Dr. Howard Dickler Citizen Award, which Honors a Community Member who Demonstrates Exceptional Voluntary Leadership and Advocacy in Support of Affordable Housing on Nantucket. Nominations may be Submitted to [email protected] through April 10, 2026. Learn More at: https://nantucket-ma.gov/3621/Dr- Howard-Dickler-Citizen-Award. 3. Stay Current with Town News The Town of Nantucket’s Latest Monthly E-News Updates are Now Available. The Housing Department Newsletter was Distribut [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 11, 2026 · 15:00

Cemetery Commission

Cemetery Commission to discuss lot markers, consolidation and restoration projects

The Nantucket Cemetery Commission will approve the minutes from its February 11, 2026 meeting and review several project updates. Commissioners will consider a plan to install corner markers for new lots at Polpis Cemetery, receive an update on the Monument Restoration Project at New North Cemetery, and discuss the consolidation and improvement plans for Newtown Cemetery, including parking and lot layout. The commission will also review progress on a stone installation at the Quaker Cemetery entrance on Vestal Street and the replacement of a painted wooden sign opposite Caton Circle.

cemeteryconsolidationrestorationinfrastructurepublic-comments
✓ Decided: Boston family memorial dedication set for Juneteenth approved

The commission unanimously approved dedicating the Boston family memorial on Juneteenth, June 19, 2026, at 9:30 am in the Historic Coloured Cemetery. The minutes from the February 11, 2026 meeting were approved unanimously. The agenda was reordered to discuss the Quaker Cemetery item first, and the wording for the new Quaker Cemetery stone was approved unanimously.

188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cemetery Commission Day, Date, and Time Wednesday, March 11, 2026, at 3:00 p.m. Location / Address DPW Conference Area, 188 Madaket Road Signature of Chair or Authorized Person Allen B. Reinhard, Chairman AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 Nantucket Cemetery Commission Meeting Notice and Agenda Wednesday, March 11, 2026 Meeting to be held at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. 1. Public and Commissioners comments. 2. Approval of Minutes from February 11, 2026. 3. Polpis Cemetery: Plan for installation of corner markers for new lots facing Polpis Rd. 4. Monument Restoration Project update: New North Cemetery. 5. Newtown Cemetery: Plan for Consolidation update and Future projects to improve the cemetery such as parking, layout of lots, brush removal, etc. Progress update. Bob Bystrowski, or Tracy McDonald if available. Article 81 at Town Meeting, acquisition of lot adjacent to cemetery. 6. Quaker Cemetery: Progress of stone at Vestal Street entrance, and r [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 NANTUCKET CEMETERY COMMISSION Posted Meeting of March 11, 2026, at 3:00 pm DPW Conference Room, 188 Madaket Road, with Zoom Connectivity FINAL AND APPROVED MINUTES Attendance, by Roll Call: Commissioners: Jascin Finger (@3:18 pm), Frances Karttunen, Scott McIver, Allen Reinhard, and Lee Saperstein; Charlie Polachi, Cemetery Administrator, Debora Goudemond, Committee Operations Coordinator; Jonny Trusz of Ludlow Memorial (left at 3:15 pm). It was determined by roll call that there was a quorum at all times; for reference, the correct Zoom link to join Cemetery Commission meetings is Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 1. Call to Order. Allen Reinhard called the meeting to order at 3:00 pm; a roll call established the listed attendance. The link to the video recording is https://www.youtube.com/watch?v=jo7dMpEhYiI&list=PL49sKqpy7VAhIyX1ozdd1bZ3zV8kX Fp8M&index=68. 2. Public and Commissioners Comments. Frances Karttunen proposed, in a Commissioner’s Comment, that the memorial to the Boston family be dedicated on Juneteenth (June 19, 2026) at 9:30 am in the Historic Coloured Cemetery. The date and time were chosen to coincide with Juneteenth celebrations to occur at the Museum of African-American History. The proposal was seconded by Scott McIver and approved unanimously by roll-call vote (Frances Karttunen, aye, Scott McIver, aye, Allen Re [Excerpt truncated on this listing page; use the official record for the full text.]
🗳️ How they voted (4 roll-call votes)
Named votes as recorded in the official record.
dedicate the memorial to the Boston family on Juneteenth (June 19, 2026) at 9:30 am in the Historic Coloured Cemetery
4 yea
Frances Karttunen yea · Scott McIver yea · Allen Reinhard yea · Lee Saperstein yea
approval of the minutes of February 11, 2026
5 yea
Allen Reinhard yea · Jascin Finger yea · Frances Karttunen yea · Scott McIver yea · Lee Saperstein yea
move Agenda Item 6 to be the first discussion item
5 yea
Allen Reinhard yea · Jascin Finger yea · Frances Karttunen yea · Scott McIver yea · Lee Saperstein yea
approve the text to be inscribed on the stone for the Quaker Cemetery
5 yea
Allen Reinhard yea · Jascin Finger yea · Frances Karttunen yea · Scott McIver yea · Lee Saperstein yea
Tue Mar 10, 2026 · 10:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee meeting cancelled

The Coastal Resilience Advisory Committee meeting scheduled for March 10, 2026, has been cancelled.

cancelledcoastal-resiliencenantucketmeeting
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, March 10, 2026 at 10:00 a.m. Location / Address Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Tue Mar 10, 2026 · 16:00

Finance Committee

Finance Committee will review the FY2027 school budget

The Nantucket Finance Committee meeting will discuss the proposed FY2027 school budget and examine the town's property tax base, including taxable and tax‑exempt properties. Members will also consider outstanding warrant articles from the 2026 Annual Town Meeting, which may include budget transfers, operating and capital appropriations, and other initiatives. The committee will receive reports and take public comment before adjourning.

financeschool-budgetproperty-taxwarrant-articleszoning
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, MARCH 10, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81524955656?pwd=CeFY8Vib17O11HpyIDyG98imoEB3RE.1 Meeting ID: 815 2495 5656 Passcode: 229896 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review and Discussion of FY2027 School Budget 6. Overview of Property Tax Base, Including Taxable and Tax-Exempt Properties 7. Discussion, Deliberation and Potential Motions for the Outstanding Warrant Articles for Annual Town Meeting 2026, Including Any Articles That May Need to Be Revisited. Article Primary Sponsor Description 6 Sel [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 10, 2026 · 17:00

Airport Commission, Nantucket Memorial

Commission will consider airport budget warrant articles for FY 2027 and related appropriations

The Nantucket Memorial Airport Commission will review and approve the meeting agenda, the draft minutes from February 3, 2026, and the warrants dated February 4, February 18, and March 4, 2026. Commissioners will discuss pending leases and contracts listed in Exhibit 1, including lease agreements for the Flat Roof Building, surf‑school license, and ground‑handling fees. Updates will be given on the PFAS investigation, the Terminal Optimization Project, the Housing Production Plan, and the Fuel Subcommittee. The body will vote on several FY 2027 airport warrant articles covering unpaid bills, prior‑year appropriations, spending limits, enterprise fund operations, capital expenditures, budget transfers, borrowing authority, and a stabilization fund.

financecontractsenvironmentinfrastructureaviationbudget
✓ Decided: Commission approved leases and contracts, except Airport Gas sublease

The commission ratified the 02/04/26, 02/18/26, and 03/04/26 warrants by unanimous vote. A motion to approve the leases and contracts listed in Exhibit 1, excluding the Airport Gas sublease, passed unanimously. The Airport Gas sublease was postponed for further discussion at a future meeting.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, March 10, 2026 at 5:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/4705644537?omn=87109440319 The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Zoom Link to Virtually Attend Meeting: https://us06web.zoom.us/j/4705644537?omn=87109440319 Meeting ID: 470 564 4537 The meeting will be posted at a later date on YouTube. 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 02/03/26 Draft Minutes c. Ratify 02/04/26, 02/18/26, and 03/04/26 Warrants 3. Public Comment 4. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 5. Pending Matters: a. 071420-03 P [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING March 10, 2026 The meeting was called to order at 5:0 4 PM by Chairman Arthur Gasbarro with the following Commissioners present: Anthoney Bouscaren, Philip Marks III, and Michael Leavitt. This meeting was conducted remotely by video conference via Zoom and will be aired at a later date on the Town of Nantucket YouTube Channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Dhruv Patel , McFarland -Johnson; Johnathan Mc Credie, Fennic k McCredie Architecture; Priyanka M enon, Fennick McCredie Architecture ; and Laura Martin, Fennick McCredie Architecture. Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Gasbarro asked for comments and concerns on the 02/03/26 Draft minutes; hearing none, the Draft Minutes were adopted by unanimous [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 10, 2026 · 18:00

Nantucket Public School Committee

School Committee will vote on the FY27 budget for Nantucket Public Schools

The Nantucket Public School Committee meeting will consider several votes, including approval of the FY27 budget and an overnight field trip for the high school Poetry Outloud State Finals in Boston on March 7‑8, 2026. The committee will also vote to approve the December 16, 2025 and January 20, 2026 meeting minutes. Presentations will cover a Grade 11 GPA proposal, a parent‑volunteer initiative for NES/NIS, and MAP Winter 2026 results.

budgeteducationfield-tripminutesassessmentparent-engagement
10 Surfside Road, Nantucket High School, LGI, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, March 10, 2026, 6:00 PM Location / Address HYBRID - Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road · Nantucket, MA 02544 https://zoom.us/webinar/register/WN_3lbl5qyiR86mJFl_uSpFIA Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA To virtually attend the meeting, register using the Zoom Webinar link below: https://zoom.us/webinar/register/WN_3lbl5qyiR86mJFl_uSpFIA To watch meeting live, click here: https://youtube.com/live/-e246AJwfLk I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. March Student Enrollment b. Poetry Outloud c. AASA Update d. Additional Updates VI. Presentations and discussions of issues to the Committee a. Nantucket High School Grade Point Average Proposal - Grade 11 students, Hunter Bistany, Jake Clarke, and Russell Simpson b. NES/NIS Parent Volunteer Initiative - Kimberly Kubisch, NES Principal, Jenny Williams, NES [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 10, 2026 · 16:00

Nantucket Islands Land Bank Commission

Commission will approve FY25 financial statements and consider several property and budget items

The Nantucket Islands Land Bank Commission meeting will review updates on agricultural farms, discuss property management matters such as a budget amendment for the Milestone Road Bike Park and an employee housing submission, and consider long‑range objectives. It will also approve the FY25 financial statements and several warrant authorizations, including a Golf Capital funds transfer. Additional items include property use requests for playground and clambake events.

financeproperty-managementagriculturelong-rangepermits
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, March 10, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/84709388465?pwd=kZuvnRntlQrnPGLEU0o5VZkdaAR3Xf.1 Webinar ID: 847 0938 8465 Passcode: 482112 Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. AGRICULTURAL BUSINESS a. 101 Hummock Pond Road – My Grandfather’s Farm Annual Update b. 19 Wauwinet Road & 168 Hummock Pond Road - Fog Town Farm Annual Update 4. PROPERTY MANAGEMENT a. Milestone Road/Bike Park – Horsley Witten Budget Amendment b. Various Properties – Project [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 10, 2026 · 16:00

Historic District Commission

Commission to set meeting schedule and review dozens of historic consent applications

The Historic District Commission will vote on the meeting and deadline schedule for May 12 – August 11 2026. Commissioners will consider a series of consent applications for historic determinations, consents with conditions, and new‑business items such as as‑built sheds and dwelling additions. The agenda also includes approval of the previous meeting minutes and a Q&A session with the preservation planner.

historic-districtconsentsschedulenew-businessminutes
✓ Decided: Commission approved 24 Nonantum Ave addition despite one dissenting vote

The Historic District Commission unanimously approved its meeting schedule and a series of consents with conditions. It approved the 24 Nonantum Ave addition with a 4‑1 vote, while holding the Maxey Pond guest house for revisions. Additional approvals included painting a roof black to match solar panels and several other project applications.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 MAR 06 PM 02:11 Original Posting Number: T 182 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, March 10, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_zyyouKm8Rx6Kso61egFfTQ#/registration To watch live feed, click here: https://www.youtube.com/live/dqOPRbyou5A Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Pac [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes March 10, 2026; adopted March 24, 2026 HISTORIC DISTRICT COMISSION Minutes March 10, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson Holly Backus left the meeting at 5:30 pm In person Welch, Oliver, Camp, MacLeod and Patten Pohl arrived at 4:05 Zoom: Thornewill and Paul Meeting called to order at 4:02 pm by Stephen Welch Board: Welch, Oliver MacLeod Camp and Patten Oliver made the motion to approve the agenda Motion carries unanimously I. COMMISSIONER VOTE AND/OR DISCUSSION • HDC Meeting and Deadline Schedule: May 12, 2026 – August 11, 2026 • Board: Welch, Oliver MacLeod Camp and Patten; Alternates: Thornewill, Paul • MacLeod made the motion to approve the HDC schedule. • Motion carries unanimously. II. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. 5 Seas Investment 14204 5 Bank St Historic Determination 73.2.4/8 Thornewill Design HB 2. 17 N. Water Holdings 14233 17 N. Water St Historical Determination 42.4.2/49 Emeritus, LTD HB 3. Erin Foley 14265 76 Orange St Re-site shed 55.1.4/25 Self VO 4. Alexis Plokas, ETAL 14207 147 Wauwinet Rd Driveway apron 11/6 LINK VO 5. ACKReit 1865, LLC 13215 9 Hinsdale Rd New dwelling 68/776 Kris Megna [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026 · 16:00

Finance Committee

Finance Committee to discuss outstanding warrant articles for Annual Town Meeting 2026

The Nantucket Finance Committee will review and potentially vote on several warrant articles pending from the 2026 Annual Town Meeting. Items include appropriations for the Community Preservation Committee, unpaid bills, prior‑year articles, the Our Island Home program, enterprise fund operations and capital expenditures, and special purpose stabilization funds. The committee will also receive reports and set the date for its next meeting.

financebudgettown-meetingappropriationsenterprise-funds
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date March 5, 2026 Original Posting Number T 173 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time MONDAY, MARCH 9, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81917234134?pwd=aGLlsIynXGquec8tP3LHadfNbNXn5l.1 Meeting ID: 819 1723 4134 Passcode: 409014 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, Deliberation and Potential Motions for the Outstanding Warrant Articles for Annual Town Meeting 2026, Including Any Articles That May Need to Be Revisited. Article Primary Sponsor Description 33 Select Board for Community Preservati [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Mar 9, 2026 · 16:00

Planning Board

Planning Board to discuss housing workshop and second dwellings

The Nantucket Planning Board will meet to discuss updates to the Master Plan and a community housing workshop. The agenda includes public hearings on second dwellings and approval not required plans.

planninghousingzoningpublic-hearingsmaster-plansecond-dwellings
✓ Decided: Board approved five second‑dwelling applications with conditions

The Planning Board unanimously approved five second‑dwelling applications, adding size and owner‑occupancy conditions. It also approved two ANR endorsements, accepted a withdrawal request, and continued several pending applications to the April 13 meeting. The Board continued five sets of prior minutes and approved conditions for the 5 Rose Bud Lane project.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATE MEETING POSTING #2: Original Posting: 03-05-2026 Original Time: 02:27 PM Original Posting Number: T175 UPDATE MEETING POSTING #1: Original Posting: 03-04-2026 Original Time: 02:11 PM Original Posting Number: T171 MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 03-09-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, March 9, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Zoom Registration Link - March 9, 2026 Meeting Packet Link 2026 Meeting Packet Link Sign [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Page 1 of 11 Planning Board DRAFT Minutes of the meeting of March 9, 2026 PLANNING BOARD APPROVED MINUTES OF 03-09-2026 *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (remote participation), Nat Lowell (Acting-Chair), Joseph Topham, and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina (Remote Participation), and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist) and Catherine Ancero (PLUS Administrative Specialist) (Absent) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ I. Call to order: Acting Chair Lowell called the meeting to order at 4:08 PM. Attendance taken by roll call: Board Members: Joseph Topham, Aye Dave Iverson, Aye (remote participation) Hillary Hedges Rayport, Aye Acting-Chair Lowell, Aye Alternates: Stephen Welch, Aye Abby De Molina, Aye (remote participation) Howard Matz, Aye Staff: Leslie Snell, Aye Megan Trudel, Aye William Saad, Aye II. Approval of the agenda: MOTION/VOTE: Mr. Kitchener made a motion to approve the agenda, and the motion was duly seconded by Vice-Chair Lowell, and the motion was carried out unanimously. Board members roll call vote: John Kitchener, Aye (remote participation) Vice-Chair Nat Lowell, Aye Page 2 of 11 Planning Board DRAFT Minutes of the meeting of March 9, 2026 Hillary Hedges Rayport, Aye Dave Iverson, Ay [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Mar 6, 2026 · 14:00

Planning Board

Public hearing on rezoning parcels on Old South Rd, Forrest Ave, Rose Bud Ln, Hinsdale Rd

The Planning Board will hold a public hearing on a re‑advertised zoning map change that would move several parcels from Residential Commercial‑2 (RC‑2) to Residential‑5 (R‑5), Commercial Neighborhood (CN) or Commercial Mid‑Island (CMI). The board will also review motions and comments for the Nantucket 2026 Annual Town Meeting warrant. Additional items include scheduling the next regular meeting and a joint meeting with the Select Board and Finance Committee.

zoningplanningpublic-hearingtown-warrantmeetings
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 03-06-2026 (Subject to change) The complete text and map (if applicable) for each article is available at Planning & Land Use Services, 2 Fairgrounds Road, Nantucket, MA Monday- Friday 7:30am- 4:00pm, or may be reviewed digitally by emailing a request to [email protected]. This meeting is being audio and video recorded and will be posted to the Town of Nantucket’s YouTube page at a later date. Please list below the topics the chair anticipates will be discussed at the meeting. I. Call to order: II. Approval of the agenda: Committee/Board/s PLANNING BOARD Day, Date, and Time Friday, March 6, 2026, at 2:00PM Location / Address REMOTE ONLY VIA ZOOM https://us06web.zoom.us/j/83567251995?pwd=GHLvaRJ9WUhlHdH1PcIeoMOvxguXs3.1 Meeting Packet [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026 · 09:00

Select Board/County Commissioners

Select Board to discuss collective bargaining and wind litigation strategy

The Nantucket Select Board/County Commissioners will meet on March 5, 2026 at 9:00 am in the Town Building Conference Room. The agenda includes an open session and an executive session to approve the minutes from the January 8, 2026 executive session. The board will discuss strategy for collective bargaining and for potential litigation against the Bureau of Ocean Energy Management (BOEM) related to the SouthCoast Wind project. No other items are listed.

open-sessionexecutive-sessioncollective-bargaininglitigationwind-energy
✓ Decided: Board approved executive‑session motion and adopted March 11 minutes

The Select Board voted to adjourn to executive session for three specific purposes, including approving the January 8 executive‑session minutes and discussing collective‑bargaining and litigation strategy. The motion passed unanimously on roll‑call vote. The Board also approved the minutes dated March 11, 2026.

16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, MARCH 5, 2026 AT 9:00 AM Location / Address TOWN BUILDING CONFERENCE ROOM 16 BROAD STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of January 8, 2026. 2. Purpose 3: To Discuss Strategy with Respect to Collective Bargaining, where an Open Meeting May have a Detrimental Effect on the Bargaining Position of the Select Board/County Commissioners and the Chair so Declares. 3. Purpose 3: To Discuss Strategy with Respect to Threatened Litigation by the Town Against the Bureau of Ocean Energy Management (BOEM) Relative to the Town’s Litigation Strategy for Failures in the Federal Permitting Process for SouthCoa [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 5, 2026 Page 1 of 2 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of March 5, 2026. The meeting was held in the Town Building Conference Room, Nantucket and via Zoom. Select Board Members present remotely were Tom Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Dawn E. Hill was absent from Open Session. Town Manager C. Elizabeth Gibson and Deputy Town Manager Rick Sears were present in person. Attorney John Giorgio of Town Counsel’s office and Operations Administrator Erika Mooney were present remotely. I. CONVENE IN OPEN SESSION Vice Chair Fee called the meeting to order at 9:00 AM. Ms. Mohr moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purposes of: 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of January 8, 2026. 2. Purpose 3: To Discuss Strategy with Respect to Collective Bargaining, where an Open Meeting May have a Detrimental Effect on the Bargaining Position of the Select Board/County Commissioners and the Chair so Declares. 3. Purpose 3: To Discuss Strategy with Respect to Threatened Litigation by the Town Against the Bureau of Ocean Energy Management (BOEM) Relative to the Town’s Litigation Strategy for Failures in the Federal Permitting Process for SouthCoast Wind, where an Open Meeting May have [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026 · 15:00

Nantucket High School Council

School Council will review the 2026-2027 budget

The Nantucket High School Council meeting will discuss a budget update and staffing plans for the 2026-2027 school year. It will also set a date and speaker for a parent meeting, follow up on the NEASC Vision of a Graduate, and recognize teachers with a lunch. Additional items include celebrations and closing comments.

budgetstaffingeducationparent-engagementevents
10 Surfside Road, Nantucket High School
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
RECEIVED Nantucket High School 2026 FEB 27 AM 09:53 NANTUCKET TOWN CLERK School Council Meeting Posting Number:T 155 March 5, 2026 3:00p.m. Location: High School Conference Room Potential Attendees: Brent Tartemella, Kristen Dussault, Meghan Washington, Pauline Cronin, Jess Douglas, Dalena Garcia Sosa, Jenn Psaradelis, Tracy Mailloux, Mandy Hilemn 3:00 5 Celebrations 3:05 10 Budget Update 3:15 10 Staffing for the 2026-2027 school year 3:25 15 Prom Parent Meeting Date / Speaker 3:40 10 NEASC — Vision of a Graduate Follow Up 3:50 5 May - Teacher Appreciation Lunch 3:55 5 Closing comments / questions We are not a team because we work together. We are a team because we respect, trust, and care for each other. Abigail Johnson
Thu Mar 5, 2026 · 15:00

Nantucket Elementary School Council

School Council to review and approve minutes from the February 5 meeting

The Nantucket Elementary School Council will first approve the agenda and then vote to accept the minutes from the February 5, 2026 meeting. Council members will discuss the District Improvement Plan (DIP), School Improvement Plan (SIP), calendar ideas, and a parent survey to identify needs. The meeting includes a Teacher Appreciation segment and sets the next meeting for April 2, 2026.

educationschool-councilminutesplanningteacher-appreciationparent-survey
30 Surfside Road, NES Library
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Elementary (NES) School Council Meeting Day, Date, and Time Thursday, March 5, 2026 3:00PM Location / Address NES Library 30 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Jane Melville WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to order II. Welcome and approval of agenda III. Review and Approve minutes from 2/5/26 IV. Homework - Review DIP and SIP, bring calendar ideas (things we want to highlight, and format), come with questions for parent survey for what we need and what would be helpful as a teacher a. DIP - b. SIP - c. Calendar Ideas - d. Parent Survey V. Teacher Appreciation VI. For the Good of the Order VII. Next Meeting April 2, 2026 1 OUR MISSION: Nantucket Public Schools, in partnership with a caring community, will create a dynamic and equitable learning environment which engages each of us to be inspired learners and responsible citizens, prepared to meet local and global challenges.
Thu Mar 5, 2026 · 15:00

Nantucket Public School Committee

School Committee holds executive session for collective bargaining with teachers

The Nantucket Public School Committee Negotiation Subcommittee will meet in executive session on March 5, 2026. The session is called to conduct a collective bargaining discussion with the Nantucket Teachers Association. No other agenda items are listed.

educationlaborcollective-bargainingschool-committee
30 Surfside Road, NIS Cafeteria
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Thursday, March 5, 2026, 3:00 PM Location / Address Nantucket Intermediate School, Cafeteria 30 Surfside Road Nantucket, MA 02554 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session and not return to open session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Thu Mar 5, 2026 · 16:00

Finance Committee

Finance Committee to consider multiple warrant articles for the 2026 Annual Town Meeting

The Nantucket Finance Committee will discuss and possibly move motions on several warrant articles slated for the 2026 Annual Town Meeting. Items include appropriations for the Community Preservation Committee, funding for town employee housing design and construction, acceptance of a state affordable‑housing property tax exemption, and a sewer extension project in Somerset. The committee will also address a trust amendment for the Affordable Housing Trust Fund and the rescission of unused borrowing authority.

financebudgetaffordable-housingcommunity-preservationsewer
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, MARCH 5, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/84087858891?pwd=Vjvnwmv8eKzaWlv1L1aOOXAxvpVjF5.1 Meeting ID: 840 8785 8891 Passcode: 681619 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026: Article Primary Sponsor Description 33 Select Board for Community Preservation Committee Appropriation: Fiscal Year 2027 Community Preservation Committee 34 Select Board for Community Community Preservation Committee: Fiscal Year 2026 B [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Mar 5, 2026 · 18:00

Conservation Commission

Public hearing on multiple Notice of Intent development proposals

The Nantucket Conservation Commission will hold a public hearing to consider several Notice of Intent applications, some requiring waivers and others not. Items include proposals for 53 Wanoma Way, 16 Hoicks Hollow Road, Baxter Road alternative access, 94 Hulbert Avenue, and 74 Monomoy Road. The meeting will also address minutes approval, monitoring reports, the SBPF Sand Plan, and potential enforcement actions.

developmentland-usepublic-hearingenforcementplanning
✓ Decided: Commission unanimously approves Mayflower Crescent dwelling, closes two applications

The Conservation Commission accepted its agenda and unanimously closed the SE48‑3970 application for 51 WW LLC and the Harbourvue LLC 94 Hulbert Avenue application. Two other applications were postponed until March 19, 2026. The commission then approved the Mayflower Crescent LLC dwelling project at 74 Monomoy Road, requiring the applicant to remove the proposed shed.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 FEB 26 PM 09:53 Original Posting Number: T151 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, March 5, 2026, at 5PM Location / Address The meeting will be held in hybrid format In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/kVu7-F5GN78 Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for March 5, 2026, 5:00 P.M. The meeting will be held Remote Only Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commission [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes March 5, 2026, adopted March 19, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, March 5, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/kVu7-F5GN78 Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Braine, Misurelli, Schafer, Plandowski, Turcotte and Williams Absent Members: - Members Left Early: - I. Call To Order II. Acceptance of the Agenda Discussion: (00:00:57) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Plandowski) (Seconded by: Misurelli) Vote: Vote Carried: 7:0: Engelbourg, Braine, Misurelli, Plandowski, Schafer, Turcotte, and Williams (aye) III. Announcements Discussion: (00:02:06) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:02:33) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:02:42) none VI. Public Hearing A. Notice of Intent- No Waiver Required Discussion: (00:03:17) Engelbourg - Asks Commission and public if there is any interest in opening SE48-3 [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 4, 2026 · 17:30

Select Board

Select Board to review housing budget and infrastructure contracts

The Select Board will discuss budget authorization for a year-round rental preservation program and restrictions for the Sconset Bluff Walk. The board will also consider several professional service agreements and contract amendments for town infrastructure and maintenance.

housinginfrastructurebudgetroadsreal-estate
✓ Decided: Board authorizes docent pilot and new hours for Sconset Bluff Walk

The Select Board approved routine items including minutes from the February 18 meeting, payroll and treasury warrants, and pending contracts, each with a 4‑0 vote. It accepted fire department gifts, approved a real‑estate amendment for Vernon and Waverly Streets, and authorized a year‑round rental preservation program funded by the $6 M housing override. The Board also changed Bluff Walk signage to 8:30 AM–7:30 PM in July‑August, authorized a docent pilot, narrowed the walk’s opening, and ordered related website updates, all by a 4‑0 vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, MARCH 4, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/IlVronCGQ6o ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_V9sTjF_ZR5uAlHSC0ifutQ I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Update on Winter Storm Hernando. 3. The Housing Department and Barrett Planning Group are Hosting the First Community- Wide Housing Workshop for the Nantucket Housing Production Plan (HPP) and are Seeking your Participation. Please Join Us on Tuesday, March 10, 2026 at the Nantucket Inn, 1 Miller Lane, from 4:00 – 5:30 PM. 4. S elect Board Announcements/Comme [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of March 4, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of March 4, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Dawn E. Hill was not present. I. CALL TO ORDER Vice Chair Fee called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA Vice Chair Fee noted there will be one extra announcement. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Update on Winter Storm Hernando. Ms. Gibson thanked a number of staff and other officials for their assistance during the event which occurred last week, including Public Safety, Emergency Management, DPW, Information Technology, Sewer, Town Administration and Communications staff, as well as officials from National Grid, Comcast, Verizon, Senator Cyr and Representative Moakley, Steamship Authority, Red Cross representative Barry Rector, Nourish Nantucket, Nantucket Chamber of Commerce and 97.7. Ms. Gibson introduced Fire Chief/Emergency Management Director Michael Cranson who reviewed the specifics of the storm as well as the damage assessme [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Mar 4, 2026 · 15:00

Council on Aging

Council on Aging meeting to hear guest speaker and senior center reports

The Council on Aging will hold a hybrid meeting on March 4, 2026 to hear a guest speaker and discuss the Senior of the Year timeline. Reports will be presented by the coordinator of the Saltmarsh Senior Center and the deputy director of Nantucket Health and Human Services. The board will also consider any new business items that arise.

agingsenior-serviceshealthcommunitymeeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date _Feb 9, 2026_ Original Posting Number _T 118_ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, March 4, 2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person ROBERT M KUCHARAVY, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Approval of minutes of December 3, 2025 and January 7, 2026 V. Official business 1. Guest speaker: John Copenhaver, President, NCEA Friends of Saltmarsh 2. Senior of the Year Timeline VI. Report - C [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026 · 12:30

Affordable Housing Trust

Executive session to consider purchase or lease of property at 20 Nancy Ann Lane

The Affordable Housing Trust will review agenda items, announce a nomination period for the 2026 Dr. Howard Dickler Citizen Award, and provide updates on Habitat for Humanity projects and a marketing funding request. The board will hold an executive session to consider the purchase, exchange, or lease of real property at 20 Nancy Ann Lane and 158 Madaket Road. Public comment will be accepted and future meeting dates were set.

affordable-housinghousingpropertyawardscommunity-workshophabitat-for-humanityexecutive-session
✓ Decided: Trust voted to enter executive session to discuss two property deals

The Affordable Housing Trust approved an amendment to the agenda removing item 8.3. The board approved the minutes from the February 17, 2026 meeting. Members voted to adjourn to an executive session to consider the purchase, exchange, lease, or value of real property at 20 Nancy Ann Lane and 158 Madaket Road.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, March 3, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, MARCH 3, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Nantucket Affordable Housing Trust is now accepting nominations for the 2026 Dr. Howard Dickler Citizen Award, which honors a community member who demonstrates exceptional voluntary leadership and advocacy in su [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on March 3, 2026, at 12:30 PM Approved the 7th day of April 2026 NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, March 3, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Brooke Mohr. Penny Dey, Brian Sullivan, and Mary Mack joined remotely. Staff members present were Kristie Ferrantella (Housing Director), Dylan Metsch-Ampel (Deputy Housing Director) , and Caroline Ferguson (Administrative Specialist) . Vicki Marsh (Town Counsel), Keelin Ciccariello (Town Counsel), and Brian Turbitt (Municipal Finance Director) joined remotely. Speaker(s) present w as Gerry Keneal ly (Habitat for Humanity Nantucket ), remote participation. All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order at 12:32 pm. II. ACCEPTANCE OF AGENDA Mr. Metsch-Ampel asked that the Trust amend the agenda to remove agenda item 8.3, Placemate Funding Request for Lease to Locals Marketing Campaign. Ms. Mack made a MOTION to approve the amended agenda. Ms. Mohr seconded the motion; by roll call vote Mary Mack – Aye; Brooke Mohr – Aye; Penny Dey – Aye; Brian Sullivan – Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Nantucket Affordable Ho [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026 · 14:00

Airport Commission, Nantucket Memorial

Airport Facilities Subcommittee to discuss Terminal Optimization Project

The Nantucket Memorial Airport Commission Airport Facilities Subcommittee will meet to discuss the Terminal Optimization Project. The meeting is scheduled for March 3, 2026, via Zoom.

airportinfrastructuretransportation
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission – Airport Facilities Subcommittee Day, Date, and Time Tuesday, March 3, 2026 at 2:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/89213167611 The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Zoom Link to Virtually Attend Meeting: https://us06web.zoom.us/j/89213167611 Meeting ID: 892 1316 7611 The meeting will be posted at a later date on YouTube. 1. Call to Order 2. Approval of the Agenda 3. 030326-01 – Discussions of Terminal Optimization Project 4. Public Comment 5. Adjourn
Tue Mar 3, 2026 · 16:00

Nantucket Planning & Economic Development Commission

Commission to hold hearings on proposed amendments to NP&EDC legislation

The Nantucket Planning & Economic Development Commission will hold Finance Committee public hearings regarding two articles for the 2026 Annual Town Meeting. The body may take votes on these proposed legislative changes.

legislationtown-meetingeconomic-developmentplanning
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Tuesday, March 3, 2026 at 4:00 pm Location / Address HYBRID - 131 PLEASANT STREET, ROOM A AND REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/85649172620?pwd=N4ca6iCSM9z58JWKa8HvD0i2lPcXA2.1 Signature of Chair or Authorized Person Megan Trudel, AICP, Deputy Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC Join Zoom Meeting https://us06web.zoom.us/j/85649172620?pwd=N4ca6iCSM9z58JWKa8HvD0i2lPcXA2.1 Meeting ID: 856 4917 2620 Passcode: 409311 This meeting with be audio and video recorded and will be uploaded to the Nantucket Government TV YouTube page at a later time. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order II. Establishment of Quorum III. Finance Committee Public Hearings on Article 74 “An Act to Amend the Nantucket Planning and Economic Development Commission” and Article 75 “An Act to Amend the Nantucket Planning and Economic Development Commission (NP&EDC) Enabling Legislation” of t [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026 · 16:00

Historic District Commission

Historic District Commission to hold public hearing on fee schedule updates

The Historic District Commission will conduct a public hearing regarding updates to its fee schedule. The body will also review old business applications for new dwellings, alterations, and additions across various properties.

historic-districtzoningfeeshousingpublic-hearing
✓ Decided: Historic District Commission adopts new fee schedule with 10× multiplier

The commission unanimously approved a new HDC fee schedule effective June 1, adding staff‑time‑based application fees and a 10× multiplier for work done without a permit. The board also directed staff to update the schedule and ordered a legal/policy review to confirm limits on fee‑based penalties. Separate applications were either held for revisions or approved with Exhibit A, all by unanimous votes.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, March 3, 2026, at 4:00pm – no later than 7:00 PM *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_ZmOYVitWT_2Vl2S8MP6GHw#/registration To watch live feed, click here: https://www.youtube.com/live/Z20CrXoI_mI Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket -ma.gov. **Comments are due by 8:00am the Monday prior to the meeting. AGEND [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC Minutes March 03, 2026; adopted March 24, 2026 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Vallorie Oliver, Abby Camp, Angus MacLeod, Associate Commissioners: Carrie Thornewill, Connie Patten, Joe Paul DATE: March 3rd, 2026 Community Room, 4 Fairgrounds Road & Remote Participation via ZOOM Called to order at 4.15 Pm, and announcements by Ray Pohl Staff in attendance: (Fiona Johnson, Administrative Specialists, Cathy Flynn, Land Use Specialist, Holly Backus, Preservation Planner) Present: Pohl, Oliver, Camp, MacLeod, Patten Remote: Thornewill Absent: Welch, Paul Motion to approve agenda made Patten. Sitting Board: Pohl (Acting Chair), Oliver, Camp, MacLeod, Patten Vote: carried 5-0 PUBLIC HEARING- UPDATE TO HDC FEE SCHEDULE Legal Framework • HDC application fees must reflect actual administrative costs (staff time and overhead). • Fees cannot be used as punitive penalties; enforcement penalties must instead come through town code, Massachusetts General Laws, or district court citations. Work Without a Permit • Current practice imposes a 10× multiplier on the base application fee for work done without a permit (Building Department uses 4×). • This 10× penalty was not previously listed on the public fee schedule, so the board directed staff to add it for transparency. Concerns About Deterrence • Board members noted the 10× penalty may still be too small to deter violations. o Example: a $50 fence → $500 penalty. • Some [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026 · 16:00

Golf Capital Workgroup

Golf Capital Workgroup to discuss equipment and facility upgrades

The Golf Capital Workgroup is meeting to discuss equipment and facility needs for the Miacomet and Sconset golf courses. The group will also review minutes from the August 25, 2025, meeting.

golf-coursescapital-improvementsmiacometsconsetequipment
12 W. Miacomet Avenue
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Golf Capital Work Group Day, Date, and Time Tuesday, March 3, 2026, at 4:00 p.m. Location / Address Miacomet Golf Course, Conference Room, 12 W. Miacomet Avenue, Nantucket, MA Signature of Chair or Authorized Person Susan C. Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. MIACOMET GOLF COURSE: a. Additional Retractable Screens for Patio b. Range Picker - Replacement c. Upgrade Push Carts d. Patio Outdoor Sprinklers - Replacement e. Equipment for the Snack Shack and Bar f. Driving Range Mats - Replacement 2. SCONSET GOLF COURSE: a. Upgrade Push Carts 3. APPROVAL OF MINUTES: a. August 25, 2025 ADJOURNMENT
Tue Mar 3, 2026 · 16:00

Finance Committee

Finance Committee reviews 15 warrant articles for Annual Town Meeting 2026

The Finance Committee will discuss and deliberate on potential motions for various 2026 Annual Town Meeting warrant articles. These items include spending limits, appropriations, and home rule petitions.

budgetappropriationstown-meetingpublic-workszoning
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, MARCH 3, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85649172620?pwd=N4ca6iCSM9z58JWKa8HvD0i2lPcXA2.1 Meeting ID: 856 4917 2620 Passcode: 409311 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026: Article Primary Sponsor Description 4 Select Board Revolving Accounts: Spending Limits for FY2027 7 Select Board Personnel Compensation Plans for FY 2027 17 Select Board Supplemental Appropriation: Public Works Facility Improvements - Design [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026 · 17:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss scallop limits and fuel transfers

The board will discuss commercial bay scalloper limits and the safe transfer of diesel fuel from trucks to boats. Other agenda items include Chapter 91 licensing and eelgrass management priorities.

shellfishingmarine-departmentenvironmental-managementharbor-regulations
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, March 3, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting – https://us06web.zoom.us/j/87812297930?pwd=FQi1pIXMzMpZ78VhmFFY01JHXibQkG.1 Meeting ID: 878 1229 7930 Password: 623037 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, March 3, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/87812297930?pwd=FQi1pIXMzMpZ78VhmFFY01 JHXibQkG.1 Meeting ID: 878 1229 7930 Password: 623037 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of Feb. 17, 2026 CHAIRMAN’S REPORT MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOURCES REPORT General Natural Resources re [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Mar 3, 2026 · 18:00

Nantucket Public School Committee

School committee to hold public hearing on FY2027 budget

The Nantucket School Committee will convene a public hearing to discuss the Fiscal Year 2027 budget at Nantucket High School. The meeting is scheduled for Tuesday, March 3, 2026, at 6:00 PM.

budgetpublic-hearingschool-committeenantucketfinance
10 Surfside Road, NANTUCKET HIGH SCHOOL
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting - Public Hearing Day, Date, and Time Tuesday, March 3, 2026, 6:00 PM Location / Address Nantucket High School, LGI 10 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda III. Comments from the Public IV. Budget Presentation, Public Hearing FY2027 V. Adjournment 1
Mon Mar 2, 2026 · 14:00

Board of Health

Board discusses health impact of proposed synthetic field installation

The Nantucket Board of Health will hold a round‑table to examine the public‑health implications of a proposed synthetic field installation. The meeting also includes a public announcement, a period for public comment, and will adjourn after discussion.

public-healthboard-of-healthsynthetic-fieldmeetingnantucket
✓ Decided: Board of Health discussed health impacts of proposed synthetic turf field

The board held a public‑health round‑table on the proposed synthetic field, reviewing mental‑health benefits of team sports, chemical and microplastic concerns of artificial turf, PFAS testing standards, and storm‑water and groundwater monitoring plans. No formal votes or resolutions were recorded.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Monday, March 2, 2026, 2026, 2:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/rFfa8GLBGVE Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_PIpMh0EfRYuec6IJ58rS4w AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Round Table discussion of Public Health impact from Proposed Synthetic Field Installation 4. Adjournment
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH MARCH 2, 2026 Adopted May 21, 2026 BOARD OF HEALTH ~~ MINUTES ~~ Monday, March 2, 2026 Meeting PSF Community Room, 4 Fairgrounds Road, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 2:00 p.m. Staff in attendance: Jerico Mele, Deputy Director of Health and Human Service; Andre Shapero, Environmental Contamination Administrator Remote Staff: Members attending: Ann Smith (chair), Meredith Lepore, Kerry McKenna, James Cooper, Thomas Dixon Remote Members: Public Participant: Dr. Margaret Ann Price; Fairwinds, Willa Arsenal; Nantucket Land and Water Council, Dr. Beth Hallet; Superintendent of Nantucket Schools, Dr. Sarah Evans; Associate Professor of Environmental Medicine at Mount Sinai, Steve LaRosa; Senior Technical Leader with Weston & Samson Engineers, Maire Rudiman; Risk Assessor and Toxicologist with Weston & Samson, Liz Denley; Weston and Samson, Dr Kyla Bennett, John McMeeking; Senior Landscape Architect with SMRT, Charlie Effman; Engineer from Horseley Witten Group, Ann Kitchell; Principal at Horseley Witten Group I. PUBLIC ANNOUNCEMENT II. PUBLIC COMMENT Discussion: None provided III. ROUND TABLE DISCUSSION OF PUBLIC HEALTH IMPACT FROM PROPOSED SYNTHETIC FIELD INSTALLATION Discussion Mental health benefits of team sports • Dr. Margaret Ann Price presented protective mental health factors from team sports participation • Adolescent brain undergoes signifi [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Feb 27, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The meeting scheduled for February 27, 2026, has been cancelled.

washington-streetnantucket
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, February 27, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/83623538137?pwd=6bZ4aSwm2OUIJdUcOTWaExjZduNp4E.1 Meeting ID: 836 2353 8137 Passcode: 548244 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Wed Feb 25, 2026 · 13:30

Nantucket Housing Authority

3 Manta Drive, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Housing Authority Day, Date, and Time Wednesday, February 25, 2026, 1:30 PM Location / Address 3 Manta Drive, Nantucket and or via hybrid remote participation Signature of Chair or Authorized Person Nancy Friend, Executive Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://zoom.us/j/97747306770?pwd=PQRKDKxpgjyt5TiYqWy5FWEWkeKRCG.1 Meeting ID: 977 4730 6770 Passcode: 918030 AGENDA Open Session 1. Call to order/roll call 2. Approval of Agenda 3. Bill roll/Payroll Signing of Warrant January 2026 4. Bill roll/Payroll Signing of Warrant February 2026 5. Minutes of December 17, 2025 6. Amendment #13 to the Contract for Financial Assistance 5001 - $175,169.07 7. Work Plan 201051 Award Contract to the lowest responsible bidder Damazio Builders, Inc, $190,000 pending EOHLC approval 8. Work Plan 201049 Tree Work -Award Contract to Nantucket Green Tree Inc. $8,475.00 9. 2025 Contract for Audit Services, Sanders, Walsh & Eaton CPA’s 10. FYE Certificate of Wage Match Acknowledgement for State Housing Programs 11. FYE Certification of Compliance [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 24, 2026 · 10:00

Coastal Resilience Advisory Committee

Coastal Resilience Advisory Committee meeting cancelled

The Coastal Resilience Advisory Committee meeting scheduled for February 24, 2026, has been cancelled. The agenda was posted by the Town of Nantucket.

cancelledcoastal-resiliencenantucketmeeting
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, February 24, 2026 at 10:00 a.m. Location / Address Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Tue Feb 24, 2026 · 16:00

Nantucket Islands Land Bank Commission

Commission will approve FY25 financial statements and consider property use requests

The Nantucket Islands Land Bank Commission will review and vote on its FY25 financial statements. It will also discuss updates on a deer‑damage permit, a budget amendment for the Milestone Road/Bike Park, and several property‑use requests. Additional items include project timelines for various properties and a long‑range objectives update.

financepropertyagricultureland-bankpublic-use
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, February 24, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Marian Wilson, Office Administrator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/85019261510?pwd=W5FR5vu26Lg843ZA6r58BPYx5fXUO5.1 Webinar ID: 850 1926 1510 Passcode: 795345 Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. AGRICULTURAL BUSINESS a. Deer Damage Permit – Update 4. PROPERTY MANAGEMENT a. Milestone Road/Bike Park – Horsley Witten Budget Amendment b. Various Properties – Project Timelines 5. LONG RANGE OBJECTIVES a. Update on Long-Range Objectives Workgroup 2 6. TRANSFER BUSINESS 7. [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Feb 20, 2026 · 10:00

Nantucket Historical Commission

Pleasant Street improvement alternatives to be reviewed

The Nantucket Historical Commission will discuss several preservation and safety topics. Items include a review of alternatives for improvements on Pleasant Street and a request for historically appropriate safety measures at 53 Main Street. The commission will also receive updates on historic resource surveys and a grant application for a preservation plan, and consider repair of damage to the Civil War monument.

historical-commissionhistoric-preservationstreet-improvementssafety-measuresgrant-applicationmonument-repair
✓ Decided: Commission approved moving forward with Easton Architects contract for historic funding

The commission decided to proceed with Easton Architects for the FY23 Massachusetts Historical Commission funding after the Select Board approved the contract on February 18. Commissioners reached consensus to use a bike bollard at 53 Main Street for historic safety. The minutes from the October 17, 2025 and January 26, 2026 meetings were approved unanimously, and the meeting was adjourned at 10:58 AM.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, February 20, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Staff update • Pleasant Street Improvements Alternatives review and discussion • Request for historically appropriate safety measures at 53 Main Street • Historic resource surveys update o PaleoWest, LLC / Chronical Heritage survey of Town-owned historic resources o Massachusetts Hist [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Nantucket Historical Commission February 20, 2026 Meeting 10AM 131 Pleasant Street, Nantucket MA and via Zoom Attendees: Betsy Tyler (Commissioner) Barbara Halsted (Commissioner) George Butterworth (Commissioner) Rita Carr (Commissioner) Holly Backus (staff – Preservation Planner) Angus MacLeod (Commissioner) – online Sarah McLane (Commissioner) - online Mike Burns (staff – Transportation Manager) – online Absent: Abby De Molina (Commissioner) Agenda • Roll call at 10 AM Commissioners Rita, George, Barbara, and Betsy are in person. Commissioners Angus is online. Staff Holly is also in person. • Public comment None • Staff update: Holly Backus reported on a meeting she attended along with commissioners Carr and De Molina and MassDOT and other Town staff with engineering consultants Fuss & ONeill reviewing the 25% design plans for changes to Milestone Rotary o Angus asked if those 25% design plans could be shared with the full commission o Mike Burns responded that the plans reviewed were conceptual; the next version with more input from staff will be ready to be shared. • Pleasant Street Improvement Alternatives review and discussion with Mike Burns, Transportation Planner o Mike presented options for improving pedestrian access along Pleasant Street between Five Corners and Main St, weighing historic character, accessibility best practices, and traffic concerns o 3 Focus areas: Silver St to South Mill St, South Mill St to Mill St, and t [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 19, 2026 · 16:00

Board of Health

Board of Health considers short-term rental regulation amendments

The Board of Health will discuss septic system loans and nitrogen loading variances. The board is also considering opening a public hearing in March 2026 regarding short-term rental owner and operator requirements.

public-healthseptic-systemsshort-term-rentalswatershed-regulationsenvironmental-protection
✓ Decided: Board approves septic system loan and moves forward on watershed regulations

The Board approved a loan request to upgrade the septic system at 261 Madaket Road. It also approved a bedroom‑credit variance for 13 Woodland Drive with specific conditions. Public hearings on the Hummock Pond watershed and Wellhead Protection District regulations were continued to March 19, and a hearing on a short‑term rental amendment was scheduled for the March meeting. All actions were adopted with the recorded vote totals.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, February 19, 2026, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/3RMHDy940ZY Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_XJBG1NKxQGCcCYVakXr8PA AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Approval of minutes (1/8/2026, 1/15/2026) 4. Director’s Updates 5. 261 Madaket Road - Betterment Loan Request for upgrade of septic system in Madaket Harbor Watershed. 6. 13 Woodland Drive, Lot 6 (79-208) – Nitrogen Loading Credit Variance, Wellhead Protection District (Cont [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH February 19, 2026 Adopted May 21, 2026 BOARD OF HEALTH ~~ MINUTES ~~ Thursday, February 19, 2026 Meeting PSF Community Room, 4 Fairgrounds Road, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:00 p.m. Staff in attendance: Roque Miramontes, Director of Public Health; Jerico Mele, Deputy Director of Health and Human Service; Remote Staff: Tomeka Gary, Public Health Coordinator; Andrew Shaper, Environmental Contamination Administrator; Jake Visco, Public Health Inspector; Heather Hudson, Public Health Inspector, Will Droheiem, Public Health Inspector Members attending: Ann Smith (chair), Meredith Lepore, James Cooper, Thomas Dixon Remote Members: Kerry McKenna Public Participant: Meg Ruley, JohnCarl McGrady, Dan Mulloy, Dylan Metsch-Ampel (Deputy Housing Director) I. PUBLIC ANNOUNCEMENT II. PUBLIC COMMENT Discussion: None provided III. APPROVAL OF MINUTES Discussion Action: Motion to approved minutes January 8,2026 (Motion by: McKenna) (Seconded by: Lepore) Carried 5-0// Smith, Lepore, McKenna, Cooper, Dixon (Aye) Motion to approved January ,2026 minutes (Motion by: Dixon) (Seconded by: Lepore) Carried 5-0// Smith, Lepore, McKenna, Cooper, Dixon (Aye) IV. DIECTOR’S REPORT Discussion • Ann Smith states the Board scheduled special meeting on synthetic turf for March 2nd at 2PM featuring experts presenting data from both sides of the issue • Health Department [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 19, 2026 · 16:00

Finance Committee

Discussion of Real Estate Acquisition on Boynton Lane

The Finance Committee will consider several warrant articles for the Annual Town Meeting 2026, including appropriations for the Community Preservation Committee, budget transfers, the Off‑Shore Wind Stabilization Fund, a stormwater management bylaw, a lease of Baxter Road property for erosion control, the town council form of government, and a real estate acquisition on Boynton Lane. The meeting also includes routine items such as call to order, public comment, committee reports, and scheduling the next meeting.

financebudgetcommunity-preservationoffshore-windstormwaterreal-estatetown-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date February 18, 2026 Original Posting Number T 146 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, FEBRUARY 19, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82011639401?pwd=v7rbAZMDpx5ZbY7meQ7IS0alyFlVyo.1 Meeting ID: 820 1163 9401 Passcode: 325071 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026: Article Primary Sponsor Description 33 Select Board for Community Preservation Appropriation: Fiscal Year 2027 Community Preservation [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 19, 2026 · 17:00

Conservation Commission

Public hearing on multiple notices of intent and orders of conditions

The Nantucket Conservation Commission will hold a public hearing to consider several notices of intent—both with and without required waivers—for parcels such as 2 Shore Road, 1 Pawguvet Lane, and 16 Hoicks Hollow Road. The commission will also review orders of conditions, minor modification requests, and discuss enforcement actions and other business items. Minutes from the February 5 meeting and monitoring reports will be approved.

zoningdevelopmentpublic-hearingconservationland-useenforcement
✓ Decided: Commission approved 41 Jefferson Avenue land bank project and other permits

The Conservation Commission accepted its agenda and closed two waiver‑free applications (SE48‑3965 and SE48‑3963). It approved three waiver‑required projects: the 41 Jefferson Avenue land bank restoration, a residential redevelopment at 3 Sherburne Way, and an addition for the Nantucket Center for Elder Affairs. Two other applications were continued for further review.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 2026 FEB 06 PM 02:43 Original Posting Number: T112 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, February 19, 2026, at 5PM Location / Address Remote Only Signature of Chair or Authorized Person Jeff Carlson, Director of Natural Resources William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for February 19, 2026, 5:00 P.M. The meeting will be held Remote Only Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/hDDASgQn3i0 Z oom Registration: https://us06web.zoom.us/webinar/register/WN_5FSXNFlhRaqQZBOiXB_HGw *I ndicates items not previously opened/discussed I. C all To Order II. Acceptance of the Agenda III. Announcements 1. The Nantucket Conservation Commission Meeting is being audio [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes February 19, 2026, adopted March 19, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, February 19, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/hDDASgQn3i0 Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell ‘Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Schafer, Turcotte and Williams; Plandowski arrived at 5:06pm Absent Members: Braine Members Left Early: Plandowski left at 6:32pm I. Call To Order II. Acceptance of the Agenda Discussion: (00:04:19) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Williams) (Seconded by: Misurelli) Vote: Vote Carried: 6:0: Engelbourg, Misurelli, Plandowski, Schafer, Turcotte, and Williams (aye) III. Announcements Discussion: (00:06:10) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:06:27) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:06:28) none VI. Public Hearing A. Notice of Intent- No Waiver Required Discussion: (00:06:58) Engelbourg - Briefly reviews the procedure fo [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 19, 2026 · 13:00

Cannabis Advisory Committee

Committee will discuss the future of social consumption of cannabis on Nantucket

The Nantucket Cannabis Advisory Committee will meet remotely via Zoom on Thursday, February 19, 2026 at 1:00 PM. The agenda includes public comment, approval of minutes from four prior meetings, and new business items such as ACK Natural deliveries and a discussion on the future of social consumption of cannabis on Nantucket. The committee will receive updates from the Massachusetts Cannabis Control Commission, including the commission's final social consumption regulations. The next meeting is tentatively scheduled for March 19, 2026.

cannabissocial-consumptionpublic-commentmeetingminutesupdates
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Cannabis Advisory Committee (CAC) Day, Date, and Time Thursday February 19, 2026, 1:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Barry Rector WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Board Members: Barry G. Rector (Chair), Abby DeMolina (Vice-Chair), Joe Plandowski (Secretary), Dawn Hill, Jacques Zimicki Join Zoom Meeting https://us06web.zoom.us/j/84056571521?pwd=TzVQMVZXdkV6SGt6MmpmTFM5dm9rZz09 Meeting ID: 840 5657 1521 Find your local number: https://us06web.zoom.us/u/kZpvpnBWV One tap mobile +13092053325,,88677055726#,,,,*027151# US Dial by your location +1 309 205 3325 US +1 646 558 8656 US (New York) +1 301 715 8592 US (Washington DC) 2 AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. I. Call to Order II. Acceptance of Agenda III. Announcements a. The Cannabis Advisory Committ [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 18, 2026 · 17:30

Select Board

Select Board to approve $4M MassWorks grant and purchase of Parcel B on Nobadeer Ave

The Nantucket Select Board will consider several approvals, including warrants, pending contracts, and a $4,000,000 MassWorks Infrastructure Grant for the Surfside Project. The board will also vote on the purchase and sale agreement for the Town‑owned Yard Sale Parcel B on Nobadeer Avenue. Public hearings will be held on appeals related to historic district certificates for fencing at Nonantum Avenue and solar panels at 65 Polpis Road. Additional items include updates from the Capital Program Committee and a request to rename Plover Lane.

grantsreal-estatepublic-hearingsbudgethousingenvironment
✓ Decided: Select Board adopts updated Strategic Plan and approves key land and naming actions

The board unanimously adopted the updated Strategic Plan. It approved the purchase of the Town‑owned Parcel B on Nobadeer Avenue and renamed Plover Lane to Plover Way. A public hearing was scheduled for March 11 to consider year‑round use of the Head of the Harbor. The board also approved a supplemental IRS support letter for the Nantucket Land Trust, pending contracts and routine payroll/treasury warrants.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, FEBRUARY 18, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/JJ32I_jyEVM ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_SgrWF6PpQwKo37MPa-93-g I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Community Claims Fund Launches on Monday, January 26, 2026 to Accept Claims. This Fund was Created as Part of the Blade Failure Settlement with GEV. Verus, LLC, the Administrator of the Fund, has Created a Dedicated Website with More Information and Instructions for How to File a Claim: www.NantucketBladeSettlement.com. Claims Must be Filed No Later than [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of February 18, 2026 at 5:30 PM Page 1 of 6 SELECT BOARD Minutes of the meeting of February 18, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon and Brooke Mohr. Matt Fee was not present and Dr. Malcolm MacNab joined the meeting later as noted. I. CALL TO ORDER Chair Hill called the meeting to order at 5:37 PM following a meeting of the Nantucket Regional Transit Authority Advisory Board. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth reviewed the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Community Claims Fund Launched on Monday, January 26, 2026 to Accept Claims. This Fund was Created as Part of the Blade Failure Settlement with GEV. Verus, LLC, the Administrator of the Fund, has Created a Dedicated Website with More Information and Instructions for How to File a Claim: www.NantucketBladeSettlement.com. Claims Must be Filed No Later than June 26, 2026. For Questions, Please Contact the Verus Support Team at [email protected] or 508-305-7225. 3. Town of Nantucket Branding & Style Guide The Communications Office is Developing a Branding and Visual Style Guide to Create a Clear, Consistent Loo [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 18, 2026 · 17:30

Historic District Commission

Historic District Commission to consider appeals for Nonantum Ave and Polpis Rd

The Historic District Commission will discuss appeals concerning properties at 11, 13, 17 and 21 Nonantum Ave and 65 Polpis Rd, in coordination with the Select Board. The meeting will then adjourn.

historic-districtappealszoningselect-board
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – with the Select Board Day, Date, and Time Wednesday, February 18, 2026, 05:30pm Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Cathy Flynn, Land Use Specialist ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_SgrWF6PpQwKo37MPa-93-g#/registration YOU TUBE LINK FOR VIEWING ONLY: https://www.youtube.com/live/JJ32I_jyEVM Commissioners: Stephen Welch (Chair), Rau Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson AGENDA Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. Some applications on this agenda may not be heard [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 18, 2026 · 15:00

Tree Advisory Committee

Tree Advisory Committee to discuss tree removal and replacement requests

The Tree Advisory Committee will meet to discuss a request for tree removal at 159 Orange St. and a replacement request for a Pin Oak at 139 Main St. The meeting will also include an update on the 250th Anniversary Liberty Tree Project.

tree-removaltree-replacementpublic-hearingnantucketenvironment
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time WEDNESDAY, February 18, 2026, at 3pm Location / Address DPW CONFERENCE ROOM OR REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance II. COMMITTEE ACCEPTANCE OF AGENDA IV. ANNOUNCEMENTS V. PUBLIC COMMENT /DISCUSSION VI. CITIZEN/DEPARTMENTAL REQUESTS VII. OLD BUSINESS - 250th Anniversary Liberty Tree Project (Mary Longacre)- Update VIII. NEW BUSINESS - 159 Orange St.- Request for Tree Removal Hearing. 2 Town-owned Honeylocusts- Discussion - 139 Main St. - Pin Oak w/ Oak Gall Request for Replacement (Liz Hilger)
Wed Feb 18, 2026 · 17:30

NRTA Advisory Board

Board will vote on the updated Title VI program

The NRTA Advisory Board will consider several agenda items, including approving the minutes from the November 19, 2025 meeting and hearing public comments. The Administrator will present a report on a request for proposals for management services. The board will vote on an updated Title VI program and discuss industry road contractor lots. Any other business will be addressed at the end of the meeting.

title-vipublic-commentadministrationroadsmeeting-procedures
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NRTA Advisory Board Day, Date, and Time Wednesday, February 18, 2026 at 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD and REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Gary Roberts, NRTA Administrator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/JJ32I_jyEVM ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_SgrWF6PpQwKo37MPa-93-g I. Approval of Minutes of November 19, 2025, meeting II. Public Comment III. Administrator Report 1. RFP for Management Services IV. Approval of Updated Title VI program V. Industry Road Contractor Lots VI. Other Business
Tue Feb 17, 2026 · 17:00

Harbor & Shellfish Advisory Board

Board to discuss Chapter 91 licensing and commercial scalloping rules

The Harbor & Shellfish Advisory Board will approve its agenda and the draft minutes from Feb. 3, 2026. Staff reports from the Marine Department and Natural Resources Department will be presented. The board will discuss several old‑business items, including Chapter 91 licensing requirements, diesel‑fuel transfer practices, an increase to seven bushels for commercial bay scallopers, recreational scalloping days, and possible adjustments to the no‑wake zone. New business includes a discussion of the Eelgrass Management Plan priorities.

licensingdiesel-fuelscallopingno-wake-zoneeelgrassmarine
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, Feb. 17, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting – https://us06web.zoom.us/j/88988070529?pwd=dvtmKnjxqmrdgSkpZaTJIJGwPuhb6E.1 Meeting ID: 889 8807 0529 Password: 744356 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, Feb. 17, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/88988070529?pwd=dvtmKnjxqmrdgSkpZaTJIJGw Puhb6E.1 Meeting ID: 889 8807 0529 Password: 744356 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of Feb. 3, 2026 CHAIRMAN’S REPORT Moment of silence for Shirley Souza MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOURCES [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 17:00

Nantucket Planning & Economic Development Commission

NP&EDC to discuss transit grant support and Town Meeting warrant articles

The Nantucket Planning & Economic Development Commission will meet remotely to discuss a transit authority grant, a regional planning contract, and the logistics of the 2026 Annual Town Meeting warrant articles.

transitplanningbudgettown-meetingtransportationenvironment
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATED POSTING Original Posting: T 129 Posted 2/12/26 AT 10:27am MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Tuesday, February 17, 2026 at 5:00 pm Location / Address REMOTE ONLY VIA ZOOM https://us06web.zoom.us/j/84340562170?pwd=8e1dD3PDCkUjpK7V8mpivAWZky6Rmu.1 Signature of Chair or Authorized Person Leslie Snell, AICP, Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGENDA FOR PARTICIPATION IN THE MEETING USE LINK BELOW: https://us06web.zoom.us/j/84340562170?pwd=8e1dD3PDCkUjpK7V8mpivAWZky6Rmu.1 This meeting is being audio and video recorded and will be uploaded to the Town’s Government TV YouTube Channel at a later date. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Public Comment for items not included on the agenda: V. Announcements: • Public information session re: Milestone Rotary and intersection at Milestone and Nobadeer Farm Road • NP&EDC video – Link to Video [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 16:00

Historic District Commission

Historic District Commission to review numerous property alterations

The Historic District Commission will meet to review a large volume of consent applications and new business regarding residential and commercial modifications. The body is deciding on requests for additions, demolitions, hardscaping, and signage across the town.

zoninghistoric-preservationdemolitionhardscapingsignage
✓ Decided: Historic District Commission approved numerous consents and new applications

The commission unanimously approved the meeting agenda, a slate of project consents (excluding 112 Wauwinet Rd), and those consents with conditions. It also approved sign recommendations, several new‑business applications, and placed the 112 Wauwinet Rd case on the agenda for the March 10 meeting. A few items were held for further information or due to no show.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 FEB 12 PM 02:19 Original Posting Number: T 133 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, February 17, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_44ZMQ4K_Qz-V-P9MAfblAQ#/registration To watch live feed, click here: https://www.youtube.com/live/_zsCVlxFAhE Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Pa [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC Minutes February 17, 2026; adopted March 3, 2026 HISTORIC DISTRICT COMISSION Minutes February 17, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice- Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson Holly Backus left the meeting at 5:30 pm In person Welch, Pohl, Oliver, and Patten Zoom: Camp, MacLeod, and Paul Absent- Thornewill Camp arrived in person at 5: 10 pm Welch left at 8:00 pm Paul left at 8:14pm Meeting called to order at 4:07pm by Stephen Welch Board: Welch, Oliver, Pohl and Patten Oliver made the motion to approve the agenda Motion carries unanimously I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. 2 Longwood, LLC 14120 10 Tom Nevers Rd Addition-sunroom 71/13.2 Val Oliver Design CT 2. Karen Nassif 14115 38 Wauwinet Rd Barn windows 20/21 Val Oliver Design CT 3. Casey Neistat 14111 1 Ash St Move off/demo shed 42.4.2/85 EMDA CT 4. Greg Glowacki 14116 22R Evergreen Wy ADU 79/710.2 Val Oliver Design CT 5. ACK KODA, LLC 14114 42 Shimmo Pond Rd Remove fake chimney 43/126 Botticelli & Pohl CT 6. 1 N. Swift Rock R. T. 14155 1 N. Swift Rock Rev. 10283; rake detail/posts 40/2 Emeritus, LTD CT 7. Eitan/Carr 2 E. Lincoln St Solar array 42.4.1/50 R. Newman CT 8. Dean Lampe 14154 3 Manatook Wy Dr [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 16:00

Finance Committee

Finance Committee reviews 2026 Annual Town Meeting Warrant Articles

The Finance Committee will discuss and potentially vote on several warrant articles for the 2026 Annual Town Meeting. These items include appropriations for public services, bylaw amendments, and real estate transactions.

budgetreal-estatebylawsgovernmentpublic-works
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date February 12, 2026 Original Posting Number T 127 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, FEBRUARY 17, 2026 @ 4:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85950831407?pwd=AhxNWTjR3wTtxWhSHuPypQFQJiJEWC.1 Meeting ID: 859 5083 1407 Passcode: 670149 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026: Article Primary Sponsor Description 9 Select Board Appropriation: Health and Human Services 69 Select Board Bylaw Amendment: Council for Human Services Membership 14 Select Board [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 14:00

Agricultural Commission

Planning for spring chicken slaughter training discussed by Agricultural Commission

The Agricultural Commission will discuss updates on a biochar project and a brief update on the venison processing program. It will plan a spring chicken slaughter training, including coordination with the MDPH Director, Neil Talbott, and a Town Board of Health representative. The commission will also announce an upcoming Nantucket Conservation District Zoom meeting and approve minutes from the 12/3/25 meeting.

agriculturebiocharpoultry-trainingvenisonconservationmeetings
16 Broad Street; Town Building, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Organizational meeting of the Agricultural Commission Day, Date, and Time Tuesday, Feb 17, 2026 2:00-3:00 pm Location / Address Nantucket Town Administration Building, 16 Broad Street REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person Posie Constable WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/2179151123 I. CALL TO ORDER II. ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Meeting is Being Audio and Video Recorded. IV. UPDATE ON PUBLIC COMMENT QUESTIONS FROM PRIOR MEETINGS (see https://www.nantucket-ma.gov/3564/_2025) V. PUBLIC COMMENT* - 2 - VI. NEW BUSINESS** 1. Posie — Biochar • Biochar discussion (updates / next steps) 2. Posie — Spring Chicken Slaughter Training (Planning) • Meeting today with Dylan Wallace re: timeline to begin raising meat birds for a spring training • Goal: host slaughter [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 12:30

Affordable Housing Trust

Trust will consider purchase/lease at Dooley Court, Nancy Ann Lane, Madaket Road

The Affordable Housing Trust will review agenda items, public comments, and consent items such as a lease donation to locals. Housing Department requests include a maintenance agreement for 10 Parker Lane, a Closing Cost Assistance Program application for 10 Oak Hollow Lane, and adoption of Rental Preservation Program Guidelines. In executive session, the Trust will consider purchase, exchange, lease, or valuation of real property at 7 Dooley Court, 20 Nancy Ann Lane, and 158 Madaket Road.

affordable-housingexecutive-sessionproperty-purchasemaintenance-agreementrental-preservation
✓ Decided: Trust approved $540,000 budget for three‑year Rental Preservation pilot

The Affordable Housing Trust approved a $540,000 budget for a three‑year Rental Preservation Program pilot. It also accepted a $25,000 donation from ACKNow, executed a maintenance agreement for 10 Parker Lane, and approved a $15,000 closing‑cost loan for 10 Oak Hollow Lane. The Trust adopted a new meeting schedule separating open and executive sessions.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, February 17, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, FEBRUARY 17, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89243722122?pwd=q3T4GrZVBtz4GUbOxWUJu68vfEqoNK.1 Meeting ID: 892 4372 2122 Passcode: 461305 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. UPDATE ON PUBLIC COMMENT QUESTIONS FROM PRIOR MEETINGS V. PUBLIC COMMENT* VI. NEW BUSINESS** VII. APPROVAL OF MINUTES 1. Approval of Minutes of February 3, 2026, at 12:30 P [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on February 17, 2026, at 12:30 PM NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, February 17, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present: Penny Dey. Brian Sullivan, Forest Bell, Mary Mack, and Brooke Mohr joined remotely. Staff members present were Dylan Metsch- Ampel (Deputy Housing Director) and Caroline Ferguson (Administrative Specialist). Kristie Ferrantella (Housing Director), Vicki Marsh (Town Counsel), Eric Barth (Town Counsel), and Keelin Ciccariello (Town Counsel) joined remotely. Speaker(s) present was Issac Landman (Placemate), remote participation. All votes were taken by roll call. I. CALL TO ORDER Chair Sullivan called the meeting to order at 12:30 pm. II. ACCEPTANCE OF AGENDA Mary Mack made a MOTION to approve the agenda. Vice-Chair Dey seconded the motion; by roll call vote Forest Bell – Aye; Mary Mack – Aye; Brooke Mohr – Aye; Penny Dey – Aye; Brian Sullivan – Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. UPDATE ON PUBLIC COMMENT QUESTIONS FROM PRIOR MEETINGS There was no public comment at the previous meeting(s). V. PUBLIC COMMENTS There was no public comment. VI. NEW BUSINESS** There was no new business. VII. [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 10:00

Community Preservation Committee

Approval of $258,162.21 for Nantucket Platform Tennis project

The Community Preservation Committee will confirm a quorum, adopt the agenda, and consider several fund requisitions, including $258,162.21 for the Nantucket Platform Tennis project and other allocations ranging from $8,400 to $94,875. The committee will also receive an update on office relocation and staffing. No old business is scheduled.

fundingpreservationtennisoffice-movebudget
✓ Decided: Committee unanimously approves six pending requisitions

The Community Preservation Committee approved its agenda and unanimously approved six requisitions. A thank‑you letter to outgoing staff member Glenna Stokes was prepared and mailed. The meeting was adjourned by unanimous roll‑call vote.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING M TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CPC (COMMUNITY PRESERVATION COMMITTEE) Day, Date, and Time TUESDAY, FEBRUARY 17, 2026 10:00 AM Location / Address 131 PLEASANT STREET – ROOM A (HYBRID) Remote Participation via Zoom Signature of Chair or Authorized Person LINDA WILLIAMS, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Attendees: To Join Meeting: Invite Link: https://us06web.zoom.us/j/86281457723?pwd=Mk9iRS9YVEcyMmlYbXNJZWtVRENLdz09 Meeting ID: 862 8145 7723 Pass Code: 338599 Call to Order Establish Quorum Approval of Agenda Approval of Minutes On hold Correspondence: None 2 Guests: None Fund Requisitions: Nantucket Interfaith/Richen $35,742.00 FY’26 Nantucket Interfaith/Richen $40,684.00 FY’26 South Church Preservation Fund/Williams $27,000.00 FY’25 Nantucket Platform Tennis/Dutra $258,162.21 FY’23 Folger Block (ratify)/Patten $8400.00 FY’25 Landmark House $94,875.00 FY’26 Old Business: None New Business: Office move/staffing updat [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
7C Hanabea Lane, Nantucket, MA. 02554 508-325-6682 Community Preservation Committee Meeting Minutes for 2/17/2026 YouTube Link: https://www.youtube.com/watch?v=x81gV61AGq0 Meeting Opening and Preliminary Technical Issues - There are quick exchanges confirming participants’ presence and audio connection. - The meeting is identified as the Community Preservation Committee (CPC) meeting scheduled for February 17, 2026, at 10:18 AM, located at 131 Pleasant Street. Roll Call and Quorum Confirmation [00:03:32] - Roll call confirms attendance: Tom Dixon, Neville Richen, John Schafer, Tim Soverino, Joseph Topham, Eleanor Antonietti, and Madam Chair Linda Williams. - Quorum is established. - Agenda approval motioned and seconded; unanimous approval given via roll call vote. Administrative Items and Requisitions Review [00:04:12] - Minutes are on hold as they require review of the recording for accuracy. - No current correspondence or guest attendees. - Discussion of requisitions: - Some payments to South Church are pending, with conversations ongoing among committee members. - Closure block requisition is noted as a ratification item, but its status is uncertain; further review with finance is needed. - Motion to approve all six requisitions made and seconded: approved unanimously by roll call vote. Project Site Visit Report: St. Mary’s Catholic Church [00:06:21] - A site visit conducted before Christmas revealed significant preservation work funded by CPC. - The project includes restoratio [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 10:00

Capital Program Committee

Capital Program Committee to review airport stormwater and 2027 report

The Capital Program Committee will meet to approve minutes from previous meetings and review a capital request for Bunker Road stormwater improvements. The committee will also review and potentially approve the 2027 Annual Report and Recommendations.

airportstormwatercapital-programreportminutes
✓ Decided: Committee added $330,000 Bunker Road stormwater project to its final report

The Capital Program Committee approved the agenda and prior meeting minutes unanimously. It voted to include the $330,000 Bunker Road stormwater improvement request as a recommended project in the committee’s final report. The committee also approved its capital report for presentation to the Select Board and adjourned the meeting.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Capital Program Committee Day, Date, and Time Tuesday, February 17, 2026 @ 10:00 AM Location / Address IN-PERSON PARTICIPATION at 131 Pleasant Street, Room B (Trailer) REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Susan M. Carmel WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81041229248?pwd=rlWIzSBtN1R7BjbUTSJyeqSx276bYS.1 Meeting ID: 810 4122 9248 Passcode: 218743 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Approval of Minutes from November 20, 2025, December 4, 2025, December 9, 2025, December 17, 2025 , January 15, 2026 and January 30, 2026 6. Airport Capital Request – Bunker Road Stormwater Improvements 7. Review and Potential Approval of 2027 Annual Report and Recommendations 8. Co [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket Capital Program Committee February 17, 2026 Attending Members: Jill Vieth, Chair, Howard Matz, Vice Chair, Peter Kaizer, Christy Kickham, Dawn Hill, Caroline Baltzer, Liza Hatton Staff: Susan Carmel, Deputy Finance Director, Warren Smith, Airport Manager, Preston Harimon Assistant Airport Manager, Arthur Gasbarro, Airport Commission Chair Absent Christy Kickham The Capital Program Committee meeting on February 17, 2026, addressed the Bunker Road stormwater improvements for the airport, initially requesting $500,000 but corrected to $330,000 The committee clarified the need for three leachate tanks and road grading due to flooding during heavy storms. The request was approved to be included in the Committee’s final recommendations report. The meeting also reviewed the capital report, noting the importance of accurate rankings and the impact of new ranking criteria. The committee approved the report and prepared for a presentation to the Select Board, emphasizing the need for timely updates and accurate information. • Jill Vieth initiates the meeting, noting some technical issues with audio and video. • Jill Vieth calls the meeting to order at 10:03 AM and confirms the meeting is being recorded. Approval of Agenda and Minutes • Jill Vieth requests approval of the agenda • Motion to approve the agenda was made by Peter Kaizer and seconded by Howard Matz. Roll call vote: Peter aye, Howard aye, Dawn aye, Caroline aye, Liza aye, Jill a [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 17, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review four sign applications

The Sign Advisory Council will meet to discuss sign requests for four properties. The council will review proposals for freestanding and projecting signs.

signszoningland-use
✓ Decided: Council approves 29 Center Street sign, holds three other sign requests for revisions

The Sign Advisory Council voted to approve the 29 Center Street projecting sign as submitted, pending staff confirmation (3‑1). It voted unanimously to hold the Sconset Trust, Nantucket Landbank, and Luis DiazGrandados sign applications for revisions. No enforcement actions were taken.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 FEB 11 AM 11:24 Original Posting Number: T121 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, February 17, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn; Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/86128573338?pwd=ha9RFgP71lnBncVaHKyGnbju1bGECQ.1 Meeting ID: 861 2857 3338 Passcode: 379827 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 861 2857 3338 Password: 379827 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROC [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes February 17, 2026; adopted March 24, 2026 Page 1 of 2 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday February 17, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Kevin Kuester Staff in attendance: Cathy Flynn, Land Use Specialist; Rodlisha Dixon, Administrative Specialist Absent members: Ben Normand & Mark Cutone Late arrivals: Paul Wolf Early Departures: None Motion to adopt agenda made by Normand; seconded by Kuester. Vote: Carried unanimously. Approval of Minutes: Approve minutes of February 3, 2026 (motion made; seconded by Normand). Vote: Carried unanimously. II. Public Comment- none III. Commissioner Comments-none IV. New Business Property owner name Street Address Scope of work Map/Parcel Agent Minutes February 17, 2026; adopted March 24, 2026 Page 2 of 2 1. Sconset Trust- 14171 31B New Street Freestanding Sign- Public Park Rules 73.4.2 / 120 Land Bank Discussion: Council discussed placement and requested a more subtle approach than a freestanding sign (including possible mounting to an existing gate post or fence element). Applicant to revise and resubmit. Motion: Motion to hold for revisions. (Made by Normand; seconded by Wolf) Vote: Carried unanimously. 2. Nantucket Landbank-14170 9 West Sankaty Freestandin [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Feb 13, 2026 · 14:00

Real Estate Assessment Committee

Committee to review sale of Town-owned land on Nobadeer Avenue

The Real Estate Assessment Committee is meeting to review and recommend the conveyance of a Town-owned parcel to a private abutter. The committee will also discuss issuing a Request for Proposals for another Town-owned lot.

real-estateland-saletown-propertynobadeer-avenue
✓ Decided: Committee recommended selling Yard Sale Parcel B for $5,400

The Real Estate Assessment Committee voted unanimously to recommend the conveyance of the Town‑owned Yard Sale Parcel (Parcel B) to Seven Dials Nantucket LLC for a total price of $5,400. The Committee also voted unanimously to defer a decision on issuing an RFP for Lot G until a response is received from the owner of 133 Surfside Road and a cost estimate for subdividing the parcel is obtained.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s REAL ESTATE ASSESSMENT COMMITTEE Day, Date, and Time FEBRUARY 13, 2026, 2:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM (See below) Signature of Chair or Authorized Person Tracy MacDonald, Real Estate Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA FEBRUARY 13, 2026 JOIN ZOOM MEETING: https://us06web.zoom.us/j/82939757992?pwd=6yski7VQ8MbNHLczmMrpoa9DFkBTaI.1 I. CALL TO ORDER II. APPROVAL OF THE AGENDA III. PUBLIC COMMENT IV. REAL ESTATE MATTERS (a) Review and recommend conveyance of Town-owned Yard Sale Parcel known as Parcel B, unconstructed portion of Nobadeer Avenue between Myles Standish Street and Uncatena, containing 2,000± square feet on a plan of land entitled “Plan to Acquire Land for General Municipal Purposes, Nobadeer Avenue, Nantucket, Mass”., dated January 30, 2017 and recorded with Nantucket County Registry of Deeds as Plan No. 2017-12, authorized by a Vote on Article 77 of 2010 Annual Town Meeting proposed to be conveyed by the Town to the abutter at 25 Nobadeer Avenue, Lot 1 on Plan 2025-40 owned by Seven Dials [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
REAC meeting February 13, 2026 REAL ESTATE ASSESSMENT COMMITTEE (“REAC”) Meeting of February 13, 2026, at 2:00 pm PLEASANT STREET, TRAILER ROOM A MINUTES Members: John Brescher, Nathaniel (“Nat”) Lowell, Lee Saperstein, Thomas Barada, Jesse Bell Attending Members: John Brescher, Lee Saperstein, and Nat Lowell Staff in attendance: Tracy MacDonald (Real Estate Specialist); and Robert (“Bob”) Bystrowski Speakers in attendance: William Kryder, Esq. I. CALL TO ORDER John Brescher called the meeting to order at 2:25 pm, Tracy MacDonald started to record the meeting, and Mr. Brescher read the requirements of a public meeting. The meeting can be viewed at Real Estate Assessment Committee - 2/13/2026 II. APPROV AL OF AGENDA Nat Lowell made a MOTION to approve the agenda. Lee Saperstein seconded the motion. Vote by roll call of those participating. Nat Lowell - Aye Lee Saperstein - Aye John Brescher – Aye III. PUBLIC COMMENT There were no public comments IV. REAL ESTATE MATTERS (a) Review and recommend conveyance of Town-owned Yard Sale Parcel known as Parcel B, unconstructed portion of Nobadeer Avenue between Myles Standish Street and Uncatena, containing 2,000± square feet on a plan of land entitled “Plan to Acquire Land for General Municipal Purposes, Nobadeer Avenue, Nantucket, Mass”., dated January 30, 2017 and recorded with Nantucket County Registry of Deeds as Plan No. 2017-12, authorized by a Vote on Article 77 of 2010 Annual Town Meeting [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Feb 13, 2026 · 10:00

Airport Commission, Nantucket Memorial

Airport Commission will discuss and act on flat roof proposals

The Nantucket Memorial Airport Commission will meet on February 13, 2026. After routine items such as call to order and agenda approval, the commission will review flat roof proposals submitted in response to a request for proposals. The discussion may lead to a decision or further action on the proposals. The meeting will adjourn after these items are addressed.

airportconstructionprocurementfacilities
14 Airport Road, Administration Building
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport – RFP Flat Roof Proposal Review Committee Day, Date, and Time Friday, February 13, 2026 at 10:00 AM Location / Address This meeting will be held In-Person at 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Friday, February 13, 2026, at 10:00 AM 1. Call to Order 2. Approval of Agenda 3. Review and Consideration of Flat Roof Proposal(s) in Response to RFP – Discussion and Action 4. Adjourn
Fri Feb 13, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The scheduled February 13, 2026 meeting of the Washington Street Collaborative Work Group has been cancelled. No agenda items will be discussed or decided. Residents should check future notices for rescheduling.

22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, February 13, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/82209999469?pwd=7ziqFM1tcY0vIEFKMblhKOF3xcRGPp.1 Meeting ID: 822 0999 9469 Passcode: 394349 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Thu Feb 12, 2026 · 08:00

Nantucket Water Commissioners

Water Commissioners meeting to review reports and discuss contracts

The Nantucket Water Commissioners will review the minutes from the Jan 8, 2026 meeting and examine production, billing and rainfall reports. The director will provide updates on water quality, the Chatham Road system and current drought conditions. Commissioners will discuss and potentially amend any personnel or vendor contracts. The meeting also includes public comment and any unforeseen items.

waterbillingrainfallcontractsdroughtinfrastructure
1 Milestone Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, February 12, 2026, at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Nantucket Water Commission Regular Meeting – in person at the Water Company conference room 1 Milestone Road, Nantucket, MA 02554 Thursday, February 12, 2026, at 8:00 AM 1. Call Meeting to Order 2. Acceptance of Agenda 3. Public Comment 4. Review of Minutes from January 8, 2026, meeting. 5. Production, Billing and Rainfall Reports 6. Director’s review and updates: a. Water Quality b. Chatham Rd c. Drought Condition 7. Discussion, amendment and execution of any personnel or vendor contracts 8. Commissioner’s Comments and Reserved for Unforeseen Items for Discussion not anticipated by the chair. Adjournment: Next Regular Commission meeting Thursday, March 12, 2026, at 8 AM
Thu Feb 12, 2026 · 15:00

Nantucket Intermediate School Council

Review of NIS Family Survey results to guide the School Improvement Plan

The Nantucket Intermediate School Council will review the minutes from the January Joint School Council and the December NIS School Council. It will examine the results of the recent NIS Family Survey as part of the School Improvement Plan. The council will discuss the next phases of the improvement plan, the communication plan and timeline, and set action steps for the next meeting.

educationschool-improvementsurveyplanninggovernance
30 Surfside Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Committee/Board/s Day, Date, and Time Location / Address Signature of Chair or Authorized Person WARNING: NOS RECEIVED __ 2026 FEB 06 AM 10:10 MEETING POSTING NANTUCKET TOWN CLERK Posting Number:T 107 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 S All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) NIS School Council Thursday, February 12, 2026 — 3:00 PM 4 30 Surfside Road, Nantucket, MA a NIS Conference Room CEE NO RUM OF MEMBERS PRESENT, OR IF ATUTE, NO MEETING MAY BE HELD! AGENDA Review of minutes from January Joint School Council . Review of minutes from December NIS School Council 3. School Improvement Plan Focus Goal Work a. Review of results of NIS Family Survey using Data Driven Protocol i. ii. iii. iv. 4. Next Steps Phase | - Predict Phase 2 - Go Visual Phase 3 - Observe Phase 4 - Infer/Questions a. Results Summary i. ii. Communication Plan Timeline Decision 5. Plan for Next Meeting: a. Action Steps i. il. Short-term goals/action steps Long-term goals/action steps
Thu Feb 12, 2026 · 13:00

Zoning Board of Appeals

Zoning Board of Appeals to review special permits for residential alterations

The Zoning Board of Appeals will hold public hearings and vote on special permits for property alterations and a building violation appeal. The board is reviewing requests for structural changes to dwellings and garages, as well as the relocation of a structure between lots.

zoningspecial-permitsresidentialbuilding-violations
✓ Decided: Board approved special permit to relocate house at 46 West Miacomet Road

The Zoning Board approved its agenda and the January 8, 2026 minutes, each by a 5‑0 vote. It continued the 9 Hinsdale Road and 54 Cliff Road applications to the March 12 meeting, also by 5‑0 votes. The Board granted a special permit with conditions for a historic foundation at 2 Green Lane and another special permit with conditions to relocate a house at 46 West Miacomet Road, both unanimously approved.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, February 12, 2026, at 1:00 PM Location / Address 4 Fairgrounds Road, Nantucket, MA 02554 PSF COMMUNITY ROOM & REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Nicky Sheriff, Land Use Specialist WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA (Subject to Change) The meeting will be recorded and archived at www.nantucket-ma.gov. ZOOM WEBINAR REGISTRATION LINK: https://us06web.zoom.us/webinar/register/WN_z3rRqj51RaWuerGuN49Xdg To view the LIVE broadcast of the meeting, see YouTube Link at https://youtube.com/live/uH92aN0Bv7Q BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CALL TO ORDER: II. APPROVAL OF THE AGENDA: III. PUBLIC COMMENT for items not listed on the agenda: IV. APPROVAL OF MINUTES: • January 08, 2026 2 V. NEW BUSINESS (INITIAL PUBLIC HEARINGS AND VOTES MAY BE TAKEN): 2025-0023 AckReit1865 9 Hinsdale Road Alger Continued to M [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved ZBA Minutes – February 12, 2026 1 ZONING BOARD OF APPEALS 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket- ma.gov Commissioners: Susan McCarthy (Chair), John Brescher (Vice Chair), Elisa Allen (Clerk), Joe Marcklinger, Lisa Botticelli Alternates: Mark Poor, Jim Mondani, Robert Constable ~~ MINUTES ~~ Thursday, February 12, 2026 *Adopted April 09, 2026* This meeting was held via remote participation using ZOOM and YouTube. I. CALL TO ORDER Called to order at 1:04 pm and Announcements made by Chair McCarthy Attending Members: McCarthy, Brescher, Constable, Botticelli, Allen, Mondani Staff in attendance: Nicky Sheriff; Land Use Specialist, Rodlisha Dixon; Administrative Specialist Absent: Poor, Marcklinger Remote Members: Constable, Allen, Mondani Late Arrivals: - Early Departures: - II. APPROVAL OF AGENDA Motion: Motion to approve the agenda. (Made by: Brescher) (Seconded by: Botticelli) Vote: Carried 5-0// McCarthy, Brescher, Botticelli, Allen, Mondani (Aye) III. PUBLIC COMMENT IV. APPROVAL OF MINUTES • January 08, 2026 Motion: Motion to approve the minutes as drafted. (Made by: Brescher) (Seconded by: Allen) Vote: Carried 5-0// McCarthy, Brescher, Botticelli, Allen, Mondani (Aye) V. NEW BUSINESS 2025-0023 AckReit1865 9 Hinsdale Road Alger Action Deadline February 27, 2026 The Applicant is appealing the Building Commissioner’s July 14, 2025 violation order pursuant to Nantucket Zoning Bylaw [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026 · 12:00

Council for Human Services

Council for Human Services to review grant recommendations and needs assessment

The Council for Human Services will meet to approve minutes from a previous meeting and discuss grant recommendations for Fiscal Year 27, along with a presentation on a preliminary needs assessment.

human-servicesgrantsneeds-assessmentminutescouncilnantucket
✓ Decided: Council approved the agenda and scheduled the next meeting for March 26

The council unanimously accepted the meeting agenda and approved the minutes from 12/18/2025. The next meeting was set for March 26, 2026. No other substantive actions were taken.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL FOR HUMAN SERVICES Day, Date, and Time THURSDAY, FEBRUARY 12TH, 2026, AT 12:00 PM Location / Address  131 PLEASANT ST: ROOM A  REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! JOIN ZOOM MEETING: https://us06web.zoom.us/j/86524702113?pwd=hAQaVbiEQaOMFrNGiWaEcHRgyDbaRH.1 Meeting ID: 865 2470 2113 Passcode: 946064 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Approval of Minutes from 12/18/25 IV. Public Comment V. Update on Grant Recommendations FY 27 VI. Presentation on preliminary Needs Assessment VII. Human Services Director Report VIII. Community Human Services items for by CHS members IX. New Business* X. Next meeting date XI. Adjournment *FOR MATTERS NOT REASONABLY ANTICIPATED 48 HOURS PRIOR TO THE MEETING
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Council For Human Services Meeting Town of Nantucket 131 Pleasant Street Nantucket, MA, 02554 www.nantucket-ma.gov Council for Human Services Members: Veronica Bolcik (Chair), Sarah Wright (Vice- Chair), Sue Mynttinen, Suzanne Keating, Tara Restieri, Kelly Steffen, Claudia Valle, Amanda Wright, Health and Human Services Staff: Jerico Mele (Human Services Director), Alexandria Richards (Office Manager) ˜˜MINUTES˜˜ Thursday, February 12th, 2025 131 Pleasant St, Trailer A This meeting was held in hybrid fashion with remote participation using ZOOM Attendance: Veronica Bolcik, Suzanne Keating, Amanada Wright, Sue Mynttinen, Sarah Wright, Tara Restieri Staff: Jerico Mele, Alexandria Richards Public: Marcos Alcorn, Tracy Kulik (Kulik Strategic Advisors) I. Establish Quorum Quorum was established at 12:02 pm with attendance. II. Acceptance of Agenda Sarah motioned to accept the agenda, it was seconded by Suzanne and accepted by all members in attendance. III. Approval of Minutes from 12/18/25 Suzanne motioned to approve the minutes from 12/18/2025 it was seconded by Amanada and accepted by all members in attendance. IV. Public Comment No comment. V. Update on Grant Recommendations FY 27 Veronica confirmed that the report to Fincom has been submitted and her and Jerico will be meeting with Fincom next Tuesday. VI. Presentation on preliminary Needs Assessment Marcos and Tracy from Kulik Strategic gave a report on the current data gathered fr [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 12, 2026 · 10:00

Capital Program Committee

Capital Program Committee meeting cancelled

The Capital Program Committee meeting scheduled for February 12, 2026, has been cancelled.

proceduralcapital-program
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date February 9, 2026_Original Posting Number T 116 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Capital Program Committee Day, Date, and Time Thursday, February 12, 2026 @ 10:00 AM Location / Address IN-PERSON PARTICIPATION at 131 Pleasant Street (Room A) REMO TE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Susan M. Carmel THIS MEETING HAS BEEN CANCELLED
Thu Feb 12, 2026 · 16:00

Finance Committee

Finance Committee will discuss multiple zoning bylaw amendments for the 2026 Annual Town Meeting

The committee will review warrant articles for the Annual Town Meeting covering a series of zoning bylaw amendments and map changes proposed by the Select Board and Planning Board. Items include amendments on prohibited uses, demolition delays, housing definitions, and several zoning map reclassifications on streets such as Jefferson Avenue and Arrowhead Drive. The committee will consider these items before forwarding them to the town meeting for voter approval.

zoningbylaw-amendmentsmap-changeshousingplanning-board
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, FEBRUARY 12, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82478771515?pwd=CcttgJTiJ6rkD4QApsCADl7XW45BR6.1 Meeting ID: 824 7877 1515 Passcode: 083685 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026: Article Primary Sponsor Description 38 Select Board for Planning Board Zoning Bylaw Amendment: Prohibited Uses 39 Select Board for Planning Board Zoning Bylaw Amendment: Demolition Delay 40 Select Board for Planning Board Zoning Bylaw A [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 11, 2026 · 15:00

Cemetery Commission

Cemetery commission to discuss parking, restoration, and consolidation

The Nantucket Cemetery Commission will meet to approve minutes, discuss monument restoration at New North Cemetery, and review consolidation plans for Newtown Cemetery. The body will also consider a proposal for timed parking on Franklin Street.

cemeteryrestorationparkingzoningconsolidationpublic-workshistoric-preservation
✓ Decided: Commission approved sale of Polpis Cemetery Lots D‑2 and D‑3 to Owen Moynihan

The Cemetery Commission unanimously approved the sale of Lots D‑2 and D‑3 in Polpis Cemetery to Owen Moynihan. It also unanimously approved the minutes from the December 10, 2025 meeting. The $47,700 bid from LMC for restoration work at New North Cemetery was accepted, though the project is deferred due to weather. Commissioners assigned actions to request no‑parking signs on Franklin Street and to check the work order for a new entrance sign at the Quaker Cemetery.

188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cemetery Commission Day, Date, and Time Wednesday, February 11, 2026, at 3:00 p.m. Location / Address DPW Conference Area, 188 Madaket Road Signature of Chair or Authorized Person Allen B. Reinhard, Chairman AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 Nantucket Cemetery Commission Meeting Notice and Agenda Wednesday, February 11, 2026 Meeting to be held at 3:00 p.m. in the DPW Conference Area, 188 Madaket Road and via Zoom. 1. Public and Commissioners comments. 2. Approval of Minutes from December 10, 2025. 3. Polpis Cemetery: Lot sale: Lot #D-2 and D-3 to Owen Moynihan. Split rail fence along south Installed. 4. Monument Restoration Project update: New North Cemetery, begin monument restoration. 5. Proposal to Town to provide 4, 1 hour timed parking spaces on Franklin St. for New North Cemetery access. 6. Newtown Cemetery: Plan for Consolidation update and Future projects to improve the 2 cemetery such as parking, layout of lots, brush removal, etc. once Title has been established. Progress [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 NANTUCKET CEMETERY COMMISSION Posted Meeting of February 11, 2026, at 3:00 pm DPW Conference Room, 188 Madaket Road, with Zoom Connectivity FINAL AND APPROVED MINUTES Attendance, by Roll Call: Commissioners: Jascin Finger, Frances Karttunen, Scott McIver, Allen Reinhard, and Lee Saperstein; Carrie Drayton, DPW, for the Cemetery Administrator, Robert Bystrowski, Real Estate Specialist, Debora Goudemond, Committee Operations Coordinator. It was determined by roll call that there was a quorum at all times; for reference, the correct Zoom link is Join Zoom Meeting https://us06web.zoom.us/j/86337037514?pwd=cUTROpCbZz4jjEqvO1G73IvsqWgQxE.1 Meeting ID: 863 3703 7514 Passcode: 983505 1. Call to Order. Allen Reinhard called the meeting to order at 3:03 pm; a roll call established the listed attendance. There was a problem in starting the video recording; hence there is not one for this meeting. 2. Public and Commissioners Comments. Frances Karttunen spoke, as a Commissioner’s Comment, about her conversations with Chris Glowacki of the Nantucket Cottage Hospital and, more specifically, about an effort to make the Historic Coloured Cemetery video available within the hospital by download to patients’ notebooks or laptops. Unfortunately, the Infusion Center, where the video could be of greatest use, is off limits to personal devices because of the fear of infection. Mary Novissimo, who helped to create the video, has reported that it has had “th [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 11, 2026 · 17:30

Select Board

Select Board will approve February 11 treasury warrants and review flood project

The Select Board will accept the agenda, announce community recognitions, and open a public comment period. They will approve the minutes from the February 4 meeting and Treasury Warrants for February 11. The Town Manager will provide an update on the Easy Street Flood Mitigation Project, and the Board will discuss the investigation of African Meeting House vandalism and receive committee reports.

budgetflood-mitigationpublic-commentminutescommunity-survey
✓ Decided: Select Board approved February 4 minutes and February 11 treasury warrants

The board voted to approve the minutes from the February 4, 2026 meeting and the Treasury warrants for February 11, 2026. Both motions passed unanimously by roll‑call vote. The meeting was then adjourned at 6:18 PM.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, FEBRUARY 11, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/fGi2VQEb1Lc ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_wWjLCpo8QYqZNyGz60VhJg I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Recognition of Retired Call Fire Fighter Kenneth Gullicksen with 23 Years of Service with the Nantucket Fire Department. 3. Town Clerk Nancy Holmes Awarded Certified Massachusetts Municipal Clerk (CMMC) Designation by Massachusetts Town Clerks Association. Only 127 of the Commonwealth’s 301 Town Clerks Hold this Designation. 4. Community Survey to Launch [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of February 11, 2026 at 5:30 PM Page 1 of 3 SELECT BOARD Minutes of the meeting of February 11, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill and Matt Fee. Thomas Dixon and Brooke Mohr participated remotely. Dr. Malcolm MacNab was absent. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA Chair Hill said there are two additional announcements. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Deputy Town Manager Gregg Tivnan reviewed some of the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Recognition of Retired Call Fire Fighter Kenneth Gullicksen with 23 Years of Service with the Nantucket Fire Department. Fire Chief Michael Cranson recognized Mr. Gullicksen and spoke in appreciation for his years of service and presented him with a years of service plaque. Board members and Mr. Tivnan congratulated Mr. Gullicksen. There was a round of applause from the audience for him. 3. Town Clerk Nancy Holmes Awarded Certified Massachusetts Municipal Clerk (CMMC) Designation by Massachusetts Town Clerks Association. Only 127 of the Commonwealth’s 301 Town Clerks Hold this Designation. 4. Community Survey [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 10, 2026 · 18:00

Nantucket Public School Committee

Committee will vote on donations, including a $37,350 grant to early childhood.

The Nantucket Public School Committee will consider several items, including donations to school programs, mini‑grants for teachers, and two overnight field trips for high school students. The agenda also includes a superintendent’s update on enrollment and transportation, and presentations on curriculum and budget development. Votes will be taken on the listed donations, grants, and trips.

donationsgrantsfield-tripseducationschools
10 Surfside Road, Nantucket High School
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, February 10, 2026, 6:00 PM Location / Address Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. February Student Enrollment b. Transportation Update c. Additional Updates VI. Presentations and discussions of issues to the Committee a. YONDR Initiative - Mandy Hilemn, NHS Principal and Michael Horton, CPS Principal b. Nantucket High School Program of Study Highlights c. Budget Development - Martin Anguelov, CFO of Nantucket Public Schools 1. Nantucket Community School - Alicia Graziadei, Executive Director of NCS 2. Schools & Departments - Dr. Elizabeth Hallett, Superintendent; Mellisa Devitt and Dr. Amanda Bardsley, Assistant Superintendents VII. Committee discussions and votes to be taken a. Vote to approve the donation [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 10, 2026 · 16:00

Nantucket Islands Land Bank Commission

Land Bank to award Cisco Beach parking lot contract

The Nantucket Islands Land Bank Commission will meet to award a contract for the Cisco Beach Parking Lot Improvement and discuss building relocation and raingardens. The agenda also includes approval of financial statements and minutes from the previous meeting.

land-bankparkingbeach-improvementfinanceminutesrelocation
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, February 10, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C. Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/83854340225?pwd=aLgctd8vaMG3jFpkVJcrgOvG3gvtQO.1 Webinar ID: 838 5434 0225 Passcode: 180440   Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. PROPERTY MANAGEMENT a. Cisco Beach Parking Lot Improvement – Contract Award b. 159 Hummock Pond Road – Building Relocation Update c. Francis Street Beach Improvement – Raingarden Discussion 4. LONG RANGE OBJECTIVES a. Update on Long-Range Objectives Workgroup 5. TRANSF [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 10, 2026 · 16:00

Historic District Commission

Historic District Commission to review new dwelling and hotel applications

The Historic District Commission is reviewing various property alterations, including roof changes and shed installations. The body will also discuss several applications for new dwellings and a new hotel building.

zoninghistoric-preservationhousingconstruction
✓ Decided: Historic District Commission approved 6 Lily St addition/fenestration

The commission unanimously approved routine consents and consents with conditions. It also approved several development projects, including the 6 Lily St addition/fenestration (4‑1 vote) and the 4 N. Water St hardscape/fence (4‑1 vote). The 7 Orange St application was postponed due to quorum issues, and the meeting minutes were approved.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, February 10, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN_As1XgyL8SQyw4P-6WEpCtw#/registration To watch live feed, click here: https://www.youtube.com/live/XlM3j12-4Zg Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket -ma.gov. **Comments are due by 8:00am the Monday prior to the meeting. AGENDA Listed below are [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC Minutes February 10, 2026; adopted March 03, 2026 HISTORIC DISTRICT COMISSION Minutes February 10, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 Old Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice- Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson Holly Backus left the meeting at 5:06 pm In person Camp, Pohl , Patten and Welch Zoom: Thornewill and Oliver, Paul and MacLeod Meeting called to order at 4:03pm by Stephen Welch Board: Welch, Camp, Paul, Pohl and Patten Pohl made the motion to approve the agenda Motion carries unanimously I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. John Warner 14096 12 Derrymore Rd Add pent roof 41/241 Daily Construction VO 2. Alex Glasier 14098 57 Madaket Rd Temporary structure 41/201.2 Steve Hollister VO 3. Somersack, LLC 14109 5 High Brush Path Rev. 10786; remv pergola 56/388 Topham Design VO 4. 12 N Pasture R. T. 14107 12 N. Pasture Ln Shed 44/89 Alex Boyce VO 5. Arthur Hogan 14003 61 Tom Nevers Re-site shed 76/55 Structures Unltd VO 6. Amelia Properties, LTD 14100 8 Amelia Dr Roof change 67/445 Val Oliver Design CP 7. Klaudius & Leipa 14117 5 Chestnut St Roof change 42.3.1/5 T & T Roofing CP 8. Cappo Real Estate 14106 46 Milestone Rd Shed 54/113.1 EMDA CP • Board: Welch, Camp, Pohl and Patten • Abby made motion [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 10, 2026 · 16:00

Nantucket Public School Committee

School Committee to hold collective bargaining session

The Nantucket School Committee Negotiation Subcommittee will meet in executive session. The purpose of the meeting is to conduct a collective bargaining session with the Nantucket Teachers Association.

schoolslabor-negotiationsteachers-union
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Tuesday, February 10, 2026, 4:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://zoom.us/j/91897189333 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session and not return to open session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Tue Feb 10, 2026 · 10:00

Coastal Resilience Advisory Committee

Committee receives update on the Easy Street Flood Mitigation Project

The Coastal Resilience Advisory Committee will hear an update on the Easy Street Flood Mitigation Project, review a draft video narrative for a new coastal resiliency series, and discuss upcoming public meetings and events. The committee will also consider its coastal resilience recommendations to the Select Board and receive reports from related boards and commissions. Meeting dates and future topics will be set, with the next meeting scheduled for March 10, 2026.

coastal-resilienceflood-mitigationpublic-outreachplanningmeetings
✓ Decided: Committee unanimously voted to adjourn the meeting

The Coastal Resilience Advisory Committee met via Zoom, reviewed updates on the Easy Street Flood Migration Project, discussed a draft video narrative, and noted upcoming conferences and meeting dates. No public comments were received. The next meeting is scheduled for March 10, 2026, and the committee voted unanimously to adjourn.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, February 10, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, February 10, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes 5. Reminder to send in community outreach social media content asap- see packet for schedule 6. Update on the Easy Stree [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Nantucket Coastal Resilience Advisory Commi6ee (CRAC) Tuesday, February 10, 2026 Via Zoom *Mee$ngs are audio- and video-recorded Members present: Gary Beller, Liz Phelps, Peter Brace, Doug Rose, Tim Braine, Emily Junkins, Joanna Roche, MaD Fee, Hillary Hedges Rayport (joined at 10:30am), Christy Kickham (joined at 11:06am) Members Absent: Sarah Bois Staff present: Leah Hill Scheduled Speakers: Members of the public: RJ TurcoDe Recording available here: https://www.youtube.com/watch?v=bKEtpOOVE-Y Packet available here: hDps://nantucketma.portal.civicclerk.com/event/22141/files/agenda/ 32280 1. Call to order • The mee$ng was called to order by Chair Peter Brace 2. Mee$ng announcements • Script for remotely conduc$ng Open Mee$ngs, read by Chair • The mee$ng is being audio/visually recorded 3. Public comment on topics not on the agenda • No public comments 4. Approval of minutes • No minutes 5. Reminder to send in community outreach social media content • Peter reminded members to submit content to Leah Hill 6. Update on Easy Street Flood Mi$ga$on Project by Leah Hill, TON Coastal Resilience Coordinator • Leah g ave a Powerpoint presenta$on on the current status of the Easy Street Flood Mi$ga$onProject. (See packet) • Various t opics and ques$ons discussed: - Ques$on about integra$on of storm water, flood water and ground water modeling - Ques$on about including preserva$on commiDee in process - Will the $metable be quick enough for adequate protec$on, [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 10, 2026 · 10:00

Airport Commission, Nantucket Memorial

Airport Commission Subcommittee to discuss aviation fuel strategy and expansion

The Aviation Fuel Subcommittee is meeting to discuss strategies for fuel supply and pricing. The body will review logistics for increasing fuel sales and the potential expansion of the tank farm.

aviation-fuelairport-infrastructurepricing-policylogistics
✓ Decided: Subcommittee discussed fuel supply options but made no decisions

The Aviation Fuel Subcommittee reviewed strategies for increasing fuel sales, including truck rotations, barge rentals, and temporary storage leases. It examined potential modular tank expansion and staffing needs for the summer season. No formal approvals, denials, or votes were recorded.

14 Airport Road, Administration Building
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission – Aviation Fuel Subcommittee Day, Date, and Time Tuesday, February 10, 2026 at 10:00 AM Location / Address This meeting will be held In-Person at 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 14 Airport Road, Unit 1, Administration Building, 2nd Floor Conference Room, Nantucket, MA 02554 Tuesday, February 10, 2026, at 10:00 AM 1. Call to Order 2. Approval of Agenda 3. 021026-01 – Discussions Regarding Aviation Fuel: a. Committee Strategy b. Additional Summer 2026 Supply Options c. Logistics Required to Sell More Fuel d. Tank Farm Expansion e. Fuel Supplier Requirements f. Retail Fuel Pricing Policy 4. Public Comment 5. Adjourn
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AVIATION FUEL SUBCOMMITTEE MEETING February 10, 2026 The meeting was called to order at 10:00 AM by Commissioner Phil Marks with the following Commissioners present: Michael Leavitt. This meeting was conducted in person at 14 Airport Road, Nantucket, MA. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; and Elizabeth Reuss, Administrative Assistant. Mr. Marks read the Town’s virtual meeting statement. Mr. Marks announced the meeting was being audio recorded. Mr. Mark asked for comments on the Agenda; hearing none, the Agenda was adopted. 021026-01 – Discussion Regarding Aviation Fuel:  Committee Strategy Mr. Leavitt explained that the Fuel Subcommittee’s strategy should focus on increasing fuel sales because those sales support the Airport’s operating and capital needs. To do this, the Airport must first secure additional fuel supply. Once adequate suppl y is in place, the Subcommittee can then consider approaches for increasing fuel sales.  Additional Summer 2026 Supply Options Mr. Marks reported that renting a barge f [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026 · 16:00

Planning Board

Board will consider several zoning bylaw amendments and map changes

The Nantucket Planning Board will discuss applications for second dwellings, approve several non‑required (ANR) plans, and hold public hearings on multiple zoning bylaw amendments and map changes. Items include updates to the Flood Hazard Overlay District, the definition of secondary dwellings, and re‑zoning of parcels from RC‑2 to R‑5, CN, or CMI districts. The meeting also includes public hearings on specific development projects with action deadlines ranging from March to May 2026.

zoningsecond-dwellingsmap-changespublic-hearingsplanning-board
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATE MEETING POSTING: Original Posting: 02-04-2026 Original Time: 10:01 AM Original Posting Number: T097 MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 02-09-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: Zoom registration link - February 9, 2026 Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, February 9, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Zoom registration link - February 9, 2026 Meetin [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026 · 11:00

Select Board

Public hearing on new and changed alcohol licenses for several Nantucket venues

The Select Board will adopt an updated liquor‑license public hearing policy and review the Alcoholic Beverages Control Commission annual reports. It will hold public hearings on multiple alcohol‑license applications, including a new on‑premises license for the Nantucket Performing Arts Center, a class change for The Theatre Workshop, and a license transfer for Fusaro’s. The board will also consider several utility petitions submitted by Nantucket Electric Company/National Grid.

liquor-licensingalcohol-licensesutility-petitionspublic-hearingstown-government
✓ Decided: Board approved new liquor licenses for three venues and several utility conduit projects

The Select Board unanimously approved annual on‑premises liquor licenses for the Nantucket Performing Arts Center, Theatre Workshop, and a transfer and new entertainment license for Fusaro’s. The Board also approved eight utility petitions to install conduits, handholes, and a pull box for National Grid across various town streets. All motions passed with roll‑call votes of Yes from each member present.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, FEBRUARY 9, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/W8TK5Xi9YyI ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_vZ6i4Ia8TiiBtEg0kvxYFw I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING AND PETITIONS – DEPARTMENTAL REQUESTS 1. Licensing: Request for Adoption of Updated Liquor License Public Hearing Policy and Procedure. 2. Licensing Reports: Alcoholic Beverages Control Commission (ABCC) Annual Report and Annual Closure Report. IV. LICENSING AND PETITIONS - PUBLIC HEARINGS 1. Public Hearing to Consider Application for New Annual All-Alcoholic Beverages General On-Premises License for Nantucket Performing Arts [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of February 9, 2026 Page 1 of 5 SELECT BOARD Minutes of the meeting of February 9, 2026. The meeting took place by remote participation via Zoom Webinar. Select Board Members present were Dawn E. Hill, Tom Dixon, Matt Fee and Brooke Mohr. Dr. Malcolm MacNab was absent. Also present were Operations Administrator Erika Mooney and Licensing Administrator Amy Baxter. I. CALL TO ORDER Chair Hill called the meeting to order at 11:02 AM. II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. LICENSING AND PETITIONS – DEPARTMENTAL REQUESTS 1. Licensing: Request for Adoption of Updated Liquor License Public Hearing Policy and Procedure. Ms. Baxter reviewed the request, noting it is not a new policy per se, but an update and reemphasis on the need for applicants to attend and speak up. She said it still needs review by the Town Manager and will be brought back to a future meeting. 2. Licensing Reports: Alcoholic Beverages Control Commission (ABCC) Annual Report and Annual Closure Report. Ms. Baxter reviewed the reports as contained in the Board’s agenda packet. Some discussion followed between Ms. Baxter and Board members on license holders who are closed but have not responded to inquiries, and fees. IV. LICENSING AND PETITIONS - PUBLIC HEARINGS 1. Public Hearing to Consider Application for New Annual All-Alcoholic Beverages General On-Premises License for Nantucket Performing Arts Cente [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 9, 2026 · 12:00

Nantucket Public School Committee

School Committee will review and update multiple district policies

The Nantucket Public School Committee will consider revisions to a series of school policies, including academic grading, student transportation, vehicle idling, school‑owned vehicle use, food service funding, copyright compliance, facilities planning, and naming of new facilities. The committee will also review recommended policy updates from the Massachusetts Association of School Committees and vote to approve the minutes from the December 15, 2025 policy meeting.

policyeducationschoolstransportationfacilities
32 First Way
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Policy Subcommittee Meeting Day, Date, and Time Monday, February 9, 2026 - 12:00PM Location / Address Nantucket Public Schools, Central Office 32 First Way Nantucket, MA 02544 Signature of Chair or Authorized Person WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda III. Review and update Policy a. Review Nantucket High School (NHS) Program of study grade point average, NHS Students - Hunter Bistany, Jake Clarke, Russell Simpson b. EEAG, Student Transportation in Private Vehicles c. EEAJ, Motor Vehicle Idling on School Grounds d. EEBA, School-Owned Vehicles e. EEBA-R, School-Owned Vehicles - Rules & Procedures f. EFC. Free and Reduced Price Food Services g. EFDA, Collection of Money for Food Services h. EFDA-R, Collection of Money for Food Services - Rules & Procedures i. EGAD, Copyright Compliance j. EGAD-R, Copyright Compliance - Rules & Procedures k. FA, Facilities Development Goals l. FAB, Determining Needs m. FB, Facilities Planning n. FCB, Retirement of Facilities o. FF, Naming New Facilities p. FFA, Memo [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Feb 6, 2026 · 09:00

Contract Review Committee, Human Services

Contract Review Committee to review grant reports and funding requests

The Contract Review Committee will discuss needs assessment updates and review grant reports for the Select Board and Finance Committee. The body will also evaluate the FY 26 grant process and discuss funding requests for FY 28.

grantsbudgethuman-servicescontracts
✓ Decided: Committee approves FY27 grant report and Q2 quarterly invoices

The Contract Review Committee unanimously accepted the agenda and approved prior meeting minutes. It accepted Fairwinds' explanation of a reporting discrepancy. The FY27 grant report was approved, and all Q2 quarterly invoices were approved. The next meeting was set for April 24 at 9 a.m.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CONTRACT REVIEW COMMITTEE Day, Date, and Time FRIDAY, FEBRUARY 6TH, 2026, AT 9:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM 131 PLEASNT STREET: ROOM B The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person VERONICA BOLCIK AT-LARGE/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/82353421286?pwd=YACsiN1wxOmW2eVLD5YsHOeCD4wVtk.1 Meeting ID: 823 5342 1286 Passcode: 363539 AGENDA I. Establish Quorum II. Acceptance of Agenda III. Public Comment IV. Approval of Minutes from 10/24/2025, 10/31/2025 & 11/7/2025 V. Discussion with Fairwinds VI. Needs Assessment Updates with Kulik Strategic Advisers VII. Review and Approve FY 27 Grant Report for Select Board and Finance Committee VIII. Review FY 26 Grant Process and recommendations for changes. IX. Discussion on funding request for FY 28. X. Review of Quarterly Reports XI. New Business* XII. Adjournment *FOR MATTERS NOT REASONABLY ANTICIPATED 48 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Contract Review Committee Meeting Town of Nantucket 131 Pleasant Street Nantucket, MA, 02554 www.nantucket-ma.gov Contract Review Committee: Veronica Bolcik (Chair), Joanna Roche (Vice Chair & FinCom Rep), Linda Williams (At-Large), John W. Belash (At-Large), Lee Tesser (At- Large) Suzanne Keating (CHS Rep) Staff: Jerico Mele (Human Services Director), Alexandria Richards (Office Manager) ˜˜MINUTES˜˜ Friday, February 6th, 2026 131 Pleasant St, Trailer Room B This meeting was held in person with remote participation using ZOOM and YouTube. Attendance: Veronica Bolcik, John Belash, Linda Williams, Suzanne Keating, Lee Tesser, Joana Roche Staff: Jerico Mele, Alexandria Richards, Deborah Goudemond Members of the Public: Kristie Wilson & Roberto Santamaria (Fairwinds), Marcos Alcorn & Tracy Kulik (Kulik Strategic Advisors) I. Establish Quorum Quorum was established with attendance at 9:05am II. Acceptance of Agenda John made a motion to accept the agenda. It was seconded by Suzanne and accepted by all members in attendance. III. Public Comment No comment. IV. Approval of Minutes from 10/24/2025, 10/31/2025 & 11/7/2025 Linda motioned to approve the minutes it was seconded by John and accepted by all members in attendance. V. Discussion with Fairwinds The committee opened the discussion surrounding Fairwinds’ change in frequency of use that was different than outlined in their Opioid Grant Proposal. Roberto explained the quarterly reporting [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 5, 2026 · 17:00

Conservation Commission

Public hearing on multiple development notices and orders of conditions

The Nantucket Conservation Commission will hold a public hearing on several Notice of Intent applications and orders of conditions for properties such as 113 Eel Point Road, 1 Allens Lane, and 2 Shore Road. Items include both waiver‑required and non‑waiver requests, as well as minor modifications and extension requests. The meeting also includes routine agenda items, monitoring reports, and updates to review procedures.

conservationpublic-hearingdevelopmentorders-of-conditionsland-use
✓ Decided: Commission closed two SE48 parcels and approved one development application

The Conservation Commission accepted its agenda (5‑0) and voted to close SE48‑3961 and SE48‑3960 (6‑0 and 5‑0 respectively). It then approved the WMASKCS, LLC application for 113 Eel Point Road (SE48‑3960) with a 5‑0 vote. All other pending items were continued to the February 19 meeting.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date: 2026 JAN 27 AM 10:03 Original Posting Number: T 071 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, February 5, 2026, at 5PM Location / Address The meeting will be held in hybrid format. In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/m6I9kcuPnOY Zoom Registration: https://us06web.zoom.us/webinar/register/WN_eXNNCUeiQQuCvuLqM1Scvw Signature of Chair or Authorized Person Jeff Carlson, Natural Resources Director William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for February 5, 2026, 5:00 P.M. The meeting will be held in hybrid format. In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Info [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes February 5, 2026, adopted February 19, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, February 5, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: : https://youtube.com/live/m6I9kcuPnOY Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell’Erba, Conservation Agent Attending Members: Engelbourg, Misurelli, Plandowski, Schafer, and Turcotte; Williams arrives at 5:08pm Absent Members: Braine Members Left Early: I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:46) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Plandowski) Vote: Vote Carried: 5:0: Engelbourg, Misurelli, Plandowski, Schafer, and Turcotte (aye) III. Announcements Discussion: (00:03:04) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:03:34) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:03:44) Burton Balkind, Nantucket Coastal Conservancy - Reports that the dwelling at the end of Mothball Way with a Hummock Pond Road address has some debris which I had submi [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 5, 2026 · 16:00

Finance Committee

Finance Committee to discuss warrant articles for 2026 Town Meeting

The Finance Committee will meet to discuss and deliberate on warrant articles for the 2026 Annual Town Meeting, including home rule petitions, bylaw amendments, and appropriations for municipal waste, reserves, and the FY2027 County Budget.

financebudgettown-meetingwarrant-articlescounty-budgetplanningbylawssenior-programs
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date February 3, 2026 Original Posting Number T 093 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, FEBRUARY 5, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/88945458099?pwd=MqLt44mw8aaDJUwSJcEebSB8uaKqnw.1 Meeting ID: 889 4545 8099 Passcode: 132169 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026: Article Primary Sponsor Description 74 Select Board for NPEDC Home Rule Petition: An Act to Amend the Nantucket Planning and Economic Dev [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Feb 5, 2026 · 16:00

Nantucket Planning & Economic Development Commission

Public hearing on Article 74 to amend the Planning & Economic Development Commission

The Nantucket Planning & Economic Development Commission will hold a Finance Committee public hearing on Article 74 of the 2026 Nantucket Annual Town Meeting. The article proposes amendments to the Commission itself, and votes may be taken on the matter. The meeting will also cover standard procedural items such as call to order, quorum establishment, and adjournment.

planningfinancepublic-hearingordinancetown-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Thursday, February 5, 2026 at 4:00 pm Location / Address HYBRID - 131 PLEASANT STREET, ROOM A AND REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/88945458099?pwd=MqLt44mw8aaDJUwSJcEebSB8uaKqnw.1 Signature of Chair or Authorized Person Megan Trudel, AICP, Deputy Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC Join Zoom Meeting https://us06web.zoom.us/j/88945458099?pwd=MqLt44mw8aaDJUwSJcEebSB8uaKqnw.1 Meeting ID: 889 4545 8099 Passcode: 132169 This meeting with be audio and video recorded and will be uploaded to the Nantucket Government TV YouTube page at a later time. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order II. Establishment of Quorum III. Finance Committee Public Hearing on Article 74 of the 2026 Nantucket Annual Town Meeting, “An Act to Amend the Nantucket Planning and Economic Development Commission”, votes may be taken IV. Adjournment
Thu Feb 5, 2026 · 15:00

Nantucket Elementary School Council

Nantucket Elementary School Council to review budget updates and school plans

The Nantucket Elementary School Council will review the 2025-26 DIP Year 3 Action Plan and the NES SIP. The body will also discuss budget updates related to enrollment, literacy, and special education demands.

educationbudgetschool-councilliteracyspecial-education
30 Surfside Road, NES Library
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Elementary (NES) School Council Meeting Day, Date, and Time Thursday, February 5, 2026, 3:00 PM Location / Address NES Library 30 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Jane Melville WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to order II. Welcome and approval of agenda and Minutes from 1/15/26 III. DIP review - 2025-26 DIP Year 3 Action Plan IV. SIP review - NES V. Budget Updates 1. Changes in enrollment patterns 2. Focus on literacy in primary grades 3. Increase in SpEd service demands at primary grade levels 4. Transition to EL co-teaching model at primary grade levels 5. Prioritization of quality over quantity VI. For the Good of the Order VII. Next Meeting 3/5/26 NES Library 3:00 pm VIII. Adjournment 1 OUR MISSION: Nantucket Public Schools, in partnership with a caring community, will create a dynamic and equitable learning environment which engages each of us to be inspired learners and responsible citizens, prepared to meet local and global challenges.
Wed Feb 4, 2026 · 17:30

Select Board

Select Board to approve contracts totaling $278,706

The Nantucket Select Board will consider and vote on several agenda items, including approval of minutes, payroll and treasury warrants, and a series of pending contracts with total dollar values of $278,706. The board will also discuss the Affordable Housing Trust’s year‑round deed‑restriction pilot program and a town branding survey. Additional items include a gift acceptance report, a police department update, and an investigation update on the African Meeting House vandalism.

contractsaffordable-housingbrandingpolicepublic-commentfinance
✓ Decided: Select Board approved pending contracts for February 4, 2026

The board approved the minutes from the January meetings, payroll and treasury warrants for February, and the pending contracts listed in Exhibit 1. All approvals were passed by unanimous roll‑call vote, with Chair Hill recusing herself from the contracts item. The board also accepted several gifts and donations for designated purposes. The meeting was adjourned at 6:32 PM by unanimous vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, FEBRUARY 4, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/uyQXf1B8X0I ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_P9O2sYTeQUa0-uAHfY8NWA I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Executive Office of Housing and Livable Communities (EOHLC) Approved the Certification of the Town’s Housing Production Plan Amendment, Giving the Town an Additional Year of Safe Harbor through December 10, 2027. 3. The Affordable Housing Trust (AHT) is Seeking Proposals for its Year-Round Deed Restriction Pilot Program: - Designed to Provide Housing Stabil [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of February 4, 2026 at 5:30 PM Page 1 of 4 SELECT BOARD Minutes of the meeting of February 4, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon, Matt Fee and Brooke Mohr. Dr. Malcolm MacNab participated remotely. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. She noted that Dr. MacNab is participating remotely and all votes will be taken by roll call. Dr. MacNab confirmed his remote presence. II. SELECT BOARD ACCEPTANCE OF AGENDA Chair Hill said there is one additional announcement. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Deputy Town Manager Gregg Tivnan reviewed some of the announcements as noted: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Executive Office of Housing and Livable Communities (EOHLC) Approved the Certification of the Town’s Housing Production Plan Amendment, Giving the Town an Additional Year of Safe Harbor through December 10, 2027. Housing Director Kristie Ferrantella reviewed the announcement. 3. The Affordable Housing Trust (AHT) is Seeking Proposals for its Year-Round Deed Restriction Pilot Program: - Designed to Provide Housing Stability, Security and Affordability for Those Living and Working on Nantucket - [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Feb 4, 2026 · 15:00

Council on Aging

Council on Aging to hear from Residences at Sherburne Commons director

The Council on Aging will meet to review reports from the Saltmarsh Senior Center and the Deputy Director of Nantucket Health and Human Services. The meeting includes a guest presentation from Rachel Mandle, Executive Director of The Residences at Sherburne Commons.

seniorshealth-and-human-servicessenior-housing
✓ Decided: Council on Aging unanimously approved agenda, minutes and report

The council approved the meeting agenda by unanimous roll‑call vote. The minutes from the December 3, 2025 and January 7, 2026 meetings were also approved unanimously. The Saltmarsh monthly report was accepted unanimously and the meeting was adjourned with all members in agreement.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, February 4, 2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person ROBERT M KUCHARAVY, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Approval of minutes of December 3, 2025 and January 7, 2026 V. Official business 1. Guest speaker: Rachel Mandle, Executive Director, The Residences at Sherburne Commons 2 VI. Report - Coordinator, Saltmarsh Senior Center VII. Report - Deputy Director, Nantucket H [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Nantucket Council on Aging Meeting Minutes Wednesday, February 4, 2026 (Corrected at March 4, 2026 meeting) Members present: Chair Robert Kucharavy, Vice Chair Erin Lynch, Mary Anne Easley, Diane Flaherty, Kelsea Gray (arrived 3:07) Arlene O’Reilly, Lisa Sherburne, Linda Wil- liams Members absent: Rocky Fox Staff present: Jerico Mele, Laura Stewart Guests: Guest Speaker Rachel Mandle, Executive Director, The Residences at Sher- burne Commons; NCEA President John Copenhaver As a quorum was present, Chair Robert Kucharavy called the meeting to order at 3:03 p.m. The agenda was unanimously approved by roll call vote. The minutes of the December 3, 2025 meeting and the January 7, 2026 meeting: ap- proval moved by Linda Williams, second by Mary Anne Easley, unanimously approved by roll call vote. Chair Kucharavy introduced the guest speaker, Rachel Mandle, Executive Director, The Residences at Sherburne Commons. Ms. Mandle assumed her position in January 2022 after many years in management po- sitions with the Town of Nantucket. Sherburne Commons became a non-profit in 2014 and currently has a 10-member board with broad community representation. Sherburne Commons is an independent living community for residents age 55 and older. It consists of 52 residences, including cottages and apartments. There are 20 cot- tages (2 are 2-bedroom/first floor only and 18 are 3-bedroom/2 floors) and 32 apart- ments. Fourteen of the apartments are efficienc [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 3, 2026 · 17:00

Airport Commission, Nantucket Memorial

Commission will review and approve pending airport leases and contracts

The Nantucket Memorial Airport Commission will first adopt the agenda, draft minutes, and recent warrants. It will then consider and approve a series of pending leases and contracts detailed in Exhibit 1, including license agreements, subleases, and service contracts. The board will also authorize design services for the Airport Terminal Optimization Project and receive updates on PFAS investigations and the FY26 second‑quarter finance report.

leasescontractsfinanceterminal-optimizationPFASairport-operations
✓ Decided: Commission ratified two warrants and approved two airport contracts

The commission unanimously ratified the January 7 and January 21 warrants. It also approved the Stowe Enterprises license amendment for an additional parking space and the GMSTEK‑X1 contract amendment for $8,505.67 in credit‑card processing services. The World Fuel Services fuel supply contract was postponed for further discussion.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, February 3, 2026 at 5:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/4705644537?omn=88554523808 The meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Zoom Link to Virtually Attend Meeting: https://us06web.zoom.us/j/4705644537?omn=88554523808 Meeting ID: 470 564 4537 The meeting will be posted at a later date on YouTube. 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 01/13/26 Draft Minutes c. Ratify 01/07/26 and 01/21/26 Warrants 3. Public Comment 4. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Herein Incorporated by Reference 5. 020326-01 Letter of Authorization to Proc [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING February 3, 2026 The meeting was called to order at 5:0 0 PM by Chairman Arthur Gasbarro with the following Commissioners present: Andrea Planzer and Michael Leavitt. Anthony Bouscaren arrived at 5:38 PM. This meeting was conducted remotely by video conference via Zoom and will be aired at a later date on the Town of Nantucket YouTube Channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Rich Lasdin, McFarland -Johnson; Johnathan Mc Credie, Fennic k McCredie Architecture; and Priyanka Menon, Fennick McCredie Architecture. Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Gasbarro asked for comments and concerns on the 01/13/26 Draft minutes; hearing none, the Draft Minutes were adopted by unanimous consent. Ms. Planzer made a M [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 3, 2026 · 17:00

Harbor & Shellfish Advisory Board

Discussion on General Chapter 91 licensing requirements and compliance

The Harbor & Shellfish Advisory Board will discuss several regulatory and operational topics, including Chapter 91 licensing requirements, diesel fuel transfer safety, and the recent increase to six bushels for commercial scallopers. New business items include recreational scalloping schedules and possible adjustments to the no‑wake zone by moving buoys farther out in the main harbor channel. The meeting also includes public comment periods and reports from the Marine and Natural Resources departments.

marinenatural-resourceslicensingscallopingno-wake-zoneharbor-health
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, Feb. 3, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting - https://us06web.zoom.us/j/83574085446?pwd=3J19bdYMb7sEh1lzKRmvbIOhqsDPzR.1 Meeting ID: 835 7408 5446 Password: 109371 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, Feb. 3, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/83574085446?pwd=3J19bdYMb7sEh1lzKRmvbIO hqsDPzR.1 Meeting ID: 835 7408 5446 Password: 1093711 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of Jan. 20, 2026 CHAIRMAN’S REPORT MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOURCES REPORT General Natural Resources r [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 3, 2026 · 16:00

Historic District Commission

Historic District Commission to hold public hearing on sign regulations

The Historic District Commission will conduct a public hearing regarding technical and clarifying updates to Chapter 340 Sign Regulations. The body will also review numerous applications for residential additions, demolitions, and hardscaping across the district.

zoninghistoric-preservationsignshousingconstruction
✓ Decided: Historic District Commission unanimously approved sign regulation codification

The commission held a public hearing on Chapter 340 sign regulations and unanimously approved the codification of the Construction and Site sign regulations. It also approved several individual permits, including a projecting sign for NIR Retail, a temporary hoop tent at 85 Pleasant St, a shed at 57 Somerset Rd, demolition and new construction at 9 Pine Grove Ln, and a shed at 57 Somerset Rd with a siting condition. The board held for revisions the projecting sign at 25B Washington St, the rooftop solar proposal at 12 Pine Tree, and the addition at 11 Vesper Ln.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JAN 30 PM 02:09 Original Posting Number: T 089 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, February 03, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_M3JmmirQS8ql903H7eCN0Q#/registration To watch live feed, click here: https://www.youtube.com/live/mDDZP6jzyOw Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC Meeting View Pa [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Approved HDC Minutes February 3, 2026; adopted February 10, 2026 HISTORIC DISTRICT COMISSION Minutes February 3, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Land Use Specialist; Holly Backus, Preservation Planner and Fiona Johnson, Administrative Specialist Holly Backus left the meeting at 5:06 pm In person Camp, Oliver, and Patten Zoom: MacLeod, Thornewill and Paul Absent: Welch Pohl arrived at 4:10pm Meeting called to order at 4:00pm by Abby Camp Board: Camp, Oliver, MacLeod, Paul and Patten Oliver made the motion to approve the agenda Motion carries unanimously I. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Stacey Farlie 14057 6 Gingy Ln Windows, outdr kitchen 41/234 Sanne Payne VO 2. Nant. Land Bank 14077 19 Boynton Ln Addition 67/14.6 & 14.7 Emeritus, LTD VO 3. 51 WW LLC 14067 53 Wanoma Wy Replace staircase 92.4/320 Shelter 7 VO 4. John Schaeffer 14089 54 Lovers Ln Cabana 77/80 Thornewill Design VO 5. Dean Lampe 14029 5A Gray Ave- Lot 5A Shed 67/320.2 Self VO 6. 57 Somerset Rd, LLC 14032 57 Somerset Rd Cabana 66/91 Atlantic Landscaping RP 7. Randolph Ringer 14026 3 Chuck Hollow Rd Addition 72/36 Chuck Lenhart RP 8. 198 HP, LLC 14041 198 Hummock Pond Rd Move off/demo MH 65/29 H [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 3, 2026 · 12:30

Affordable Housing Trust

Executive session to consider purchase or lease of multiple town properties

The Affordable Housing Trust will discuss the re‑released RFP for the Year‑Round Deed Restriction Pilot Program and review recent state certification of the Housing Production Plan after 64 affordable homes were added at Ticcoma Green. The board will adopt new Rental Preservation Program guidelines and approve the release of a Request for Qualifications for a program administrator. An executive session will consider purchase, exchange, lease, or valuation of properties at 135 & 137 Orange Street, 158 Madaket Road, 8A Thirty Acres Lane, and 71 Surfside Road.

affordable-housinghousingrental-preservationdeed-restrictionproperty-purchaseexecutive-sessiontown-meeting
✓ Decided: Trust approves Rental Preservation and Lease-to-Locals program guidelines

The Affordable Housing Trust approved updated guidelines for the Rental Preservation Program, making it income‑restricted, and adopted revised Lease‑to‑Locals guidelines with the same restriction. It also approved the release of a Request for Qualifications for a program administrator and authorized a CCAP mortgage modification subordination request. The board approved minutes from prior meetings and postponed further budget discussion to the next meeting. All actions were passed by roll‑call vote.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, February 3, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, FEBRUARY 3, 2026 THE MEETING WILL BE AIRED AT A LATER TIME ON THE TOWN GOVERNMENT’S YOUTUBE CHANNEL AT https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CALL TO ORDER II. ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Affordable Housing Trust has re- released the Request for Proposals (RFP) for the Year-Round Deed Restriction Pilot Program. Through the Program, the AHT will offer a financial incentive to Nantucket property owners who place a permanent deed res [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on February 3, 2026, at 12:30 PM NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, February 3, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Member(s) of the Board present : Penny Dey. Brian Sullivan, Shantaw -Bloise Murphy, Forest Bell, Abby De Molina, Mary Mack, and Brooke Mohr joined remotely. Staff members present were Dylan Metsch- Ampel (Deputy Housing Director) and Caroline Ferguson (Administrative Specialist) . Kristie Ferrantella (Housing Director), Brian Turbitt (Municipal Finance Director), Tracy MacDonald (Real Estate Manager), Vicki Marsh (Town Counsel), Eric Barth (Town Counsel), and Keelin Ciccariello (Town Counsel) joined remotely. Speaker(s) present were Colin Frolich (Placemate) and Issac Landman (Placemate). Both remote. Vice-Chair Dey served as acting chair with Chair Sullivan participating remotely. All votes were taken by roll call. I. CALL TO ORDER Vice-Chair Dey called the meeting to order at 12:33 pm. II. ACCEPTANCE OF AGENDA Abby De Molina made a MOTION to approve the agenda. Brooke Mohr seconded the motion; by roll call vote Brooke Mohr - Aye; Forest Bell – Aye; Abby De Molina – Aye; Shantaw Bloise-Murphy – Aye; Brian Sullivan – Aye; Penny Dey – Aye; so voted. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housin [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 3, 2026 · 09:00

Sign Advisory Council (HDC)

Council will review two sign projects on Center and Washington Streets

The Sign Advisory Council will discuss two sign applications: one from Nir Retail LLC for a projecting sign at 25 Center Street, and another from Luis DiazGrandados for a projecting sign at 25B Washington Street. The meeting also includes routine procedural business such as adopting the agenda and approving the minutes from 1/20/2026. A future SAC meeting is scheduled for February 17, 2026.

signagepermitszoningpublic-comment
✓ Decided: Council approved sign project for Nir Retail LLC at 14048 25 Center St

The council adopted the agenda and approved the minutes from the January 20 meeting, both unanimously. It approved the sign project submitted by Nir Retail LLC for 14048 25 Center Street without concerns, also unanimously. The council voted to hold the sign application from Luis DiazGrandados for 14052 25B Washington Street pending design revisions to meet the five‑square‑foot maximum.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, February 3, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn; Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 139867 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 883 5400 5057 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes February 3, 2026; adopted 2/17/26 Page 1 of 2 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday February 3, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Paul Wolf, Kevin Kuester Staff in attendance: Leslie Snell, Planning Director; Cathy Flynn, Land Use Specialist; Rodlisha Dixon, Administrative Specialist Absent members: Ben Normand & Mark Cutone Late arrivals: None Early Departures: None Motion to Adopt Agenda made by made by Wolf; seconded by Kuester. Vote: carried unanimously. Approval of Minutes: Approve minutes of January 20, 2026 (motion by Wolf; seconded by Kuester). Vote: carried unanimously. II. Public Comment- none III. Commissioner Comments-none IV. New Business Minutes February 3, 2026; adopted 2/17/26 Page 2 of 2 Property owner name Street Address Scope of work Map/Parcel Agent 1.Nir Retail LLC-14048 25 Center Street Marissa Collections- Projecting Sign 42.3.1/ 166 The Sign Lady Discussion: No concerns. Motion: Motion to approve as submitted. (Made by Wolf; seconded by Kuester) Vote: Carried unanimously. 2. Luis DiazGrandados-14052 25B Washington Street HART- Projecting Sign 42.3.2/21.2 Sign Here Nantucket Council discussed size compliance and design revisions. Applicant agreed to revise the sign to comply with the [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Feb 3, 2026 · 16:00

Finance Committee

Public hearing on 2026 Annual Town Meeting warrant articles

The Nantucket Finance Committee will hold a public hearing on the 2026 Annual Town Meeting Warrant Articles and consider adopting related motions. The meeting will also include routine items such as approval of the agenda, public comment, committee reports, and other business. The session is scheduled for February 3, 2026 at 4:00 PM in the trailer room at 131 Pleasant Street and via Zoom.

financetown-meetingpublic-hearingbudgetmunicipal
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, FEBRUARY 3, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/88248887628?pwd=rUOobcOagVpRDMK3hPnWFbClbey2gF.1 Meeting ID: 882 4888 7628 Passcode: 658029 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Public Hearing on 2026 Annual Town Meeting Warrant Articles; Potential Adoption of Motions 6. Committee Reports 7. Other Business 8. Date of Next Meeting – Thursday, February 5, 2026 @ 4:00 PM (hybrid) 9. Adjournment
Mon Feb 2, 2026 · 16:00

Planning Board

Board to consider zoning changes for 3 Toombs Court and nonconforming lot rules

The Planning Board will hold public hearings on two citizen‑submitted zoning proposals. One proposes moving a portion of 3 Toombs Court from the R‑20 residential district to the Commercial Neighborhood (CN) district. The other seeks to amend the zoning bylaw to remove automatic non‑conforming status for lots created under MGL 41‑81L and to require a Special Permit for any expansion or new structure on those lots. The board will also set the date for its next regular meeting.

zoningland-useplanningmap-amendmentbylaw
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATE MEETING POSTING #1: Date: January 29, 2026 Time: 10:45AM Posting Number: T082 MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 02-02-2026 (Subject to change) The complete text and map (if applicable) for each article is available at Planning & Land Use Services, 2 Fairgrounds Road, Nantucket, MA Monday- Friday 7:30am -4:00pm, or may be reviewed digitally by emailing a request to [email protected]. This meeting is being audio and video recorded and will be posted to the Town of Nantucket’s YouTube page at a later date. Please list below the topics the chair anticipates will be discussed at the meeting. Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, February 2, 2026, at 4:00PM Location / Address REMOTE ONLY VIA ZOOM https://us06web.zoom.us/j/82123190719?pwd=YuNbrdYzFz [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Feb 2, 2026 · 14:00

Finance Committee

Finance Committee to review FY2027 operating budgets

The Finance Committee will meet to review and discuss the FY2027 operating budgets. This includes the General Fund, Enterprise Funds, and Special Revenue Fund.

budgetfinancefy2027
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time MONDAY, FEBRUARY 2, 2026 @ 2:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/87991474005?pwd=iCIhV8AUmbY8uAxDQguhka1pItNYMH.1 Meeting ID: 879 9147 4005 Passcode: 138774 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review and Discussion of FY2027 General Fund, Enterprise Funds and Special Revenue Fund Operating Budgets 6. Committee Reports 7. Other Business 8. Date of Next Meeting – Tuesday, February 3, 2026 @ 4:00 PM (hybrid) 9. Adjournment
Fri Jan 30, 2026 · 10:00

Capital Program Committee

Capital Program Committee to discuss RORI completion and annual report

The Capital Program Committee will meet to discuss the completion and development of RORI. The committee will also receive an update from the Annual Report and Recommendations Workgroup.

capital-programreportingtown-administration
✓ Decided: Committee moves Nevens debris removal request above the standard deviation

The Capital Program Committee approved its agenda and the minutes from the previous meeting, both unanimously. Members voted to move the Nevens debris removal request above the standard deviation. The committee assigned staff to draft the final report and then adjourned unanimously.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Capital Program Committee Day, Date, and Time Friday January 30, 2026 @ 10:00 AM Location / Address IN-PERSON PARTICIPATION at 131 Pleasant Street, Room A (Trailer) REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Susan M. Carmel WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/86764706057?pwd=oLPAi8XIp2HyBroN0O86GZGATSHdJr.1 Meeting ID: 867 6470 6057 Passcode: 883967 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Approval of Minutes from: July 31, 2025, September 16, 2025, September 18, 2025, September 25, 2025, October 16, 2025, October 23, 2025, November 6, 2025, November 13, 2025 and November 18, 2025. 6. RORI Completion and Development 7. Annual Report and Recommendations Workgroup Update [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket Capital Program Committee January 30, 2026 Attending Members: Jill Vieth, Chair, Howard Matz, Vice Chair, Peter Kaizer, Dawn Hill, Caroline Baltzer, Liza Hatton Staff: Susan Carmel, Deputy Finance Director Absent The Capital Program Committee meeting on January 30, 2026, discussed the ranking system for capital projects, noting a higher percentage of binary categories. Key points included the need for a clearer definition of categories and the potential for a March meeting to refine criteria. The committee reviewed a spreadsheet showing $56 million above the mean and $9 million within one standard deviation. Specific projects like the $500,000 fertilizer request and the $1 million coastal resiliency funding were debated. The committee also discussed the town's employee housing project, emphasizing the need for affordable housing to retain town employees. The meeting discussed the feasibility of town employee housing, noting that municipal preference is possible but challenging. Christy Kickham emphasized the need for housing to attract local talent. The committee debated the Island Home project, highlighting its necessity but financial strain. Dawn Hill argued it's the only viable local solution for skilled nursing care. The group also considered debt exclusions for Somerset sewer and sidewalk improvements, with a focus on betterment assessments to alleviate tax burdens. The final report will include these discussions and recommenda [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 29, 2026 · 12:00

Council for Human Services

Council for Human Services meeting cancelled

The scheduled Council for Human Services meeting on January 29, 2026 at 131 Pleasant Street, Room B, was cancelled. No agenda items will be discussed or decided at this time.

administration
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __JAN 27, 2026 Original Posting Number __ T 027 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL FOR HUMAN SERVICES Day, Date, and Time THURSDAY, JANUARY 29TH, 2026, AT 12:00 PM Location / Address 131 PLEASANT STREET: ROOM B REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person VERONICA BOLCIK, CHAIR THIS MEETING HAS BEEN CANCELLED
Thu Jan 29, 2026 · 14:00

Finance Committee

Finance Committee to review FY2027 operating budgets

The Finance Committee will meet to review and discuss the FY2027 operating budgets. This includes the General Fund, Enterprise Funds, and Special Revenue Fund.

budgetfinancefy2027
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, JANUARY 29, 2026 @ 2:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/87550162479?pwd=AvzXa1AK3h1Gq5ZvMgaLOsaFwItSWv.1 Meeting ID: 875 5016 2479 Passcode: 384775 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review and Discussion of FY2027 General Fund, Enterprise Funds and Special Revenue Fund Operating Budgets 6. Committee Reports 7. Other Business 8. Date of Next Meeting – Monday, February 2, 2026 @ 2:00 PM (hybrid) 9. Adjournment
Thu Jan 29, 2026 · 16:00

Planning Board

Planning Board to vote on zoning bylaw amendments and map changes

The Nantucket Planning Board will hold a hybrid meeting to vote on multiple zoning bylaw amendments and map changes. The agenda includes proposed updates to accessory dwelling units, definitions, and demolition delays, as well as zoning map amendments for specific roads and addresses.

zoninghousingplanning-boardbylaw-amendmentmap-amendmentnantucketaccessory-dwelling-unitpublic-hearing
✓ Decided: Board unanimously continued Articles 60‑61 to Feb 9 and closed Article 47 hearing

The Planning Board voted unanimously to postpone consideration of Articles 60 and 61 to the February 9 meeting. The agenda was approved unanimously. The public hearing for Articles 47‑54 was opened, and the Board unanimously voted to close the hearing on Article 47. No other articles received a recorded vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 01-29-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_Y56wI39bTj6eojRF8nd-GQ#/registration To view the meeting only, see link below: https://www.youtube.com/watch?v=7D5yeN2o--Y I. Call to order: II. Approval of the agenda: Committee/Board/s PLANNING BOARD Day, Date, and Time Thursday, January 29, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY – COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
PLANNING BOARD APPROVED MINUTES OF 01-29-2026 *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair) (remote participation), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener (Remote participation), and Hillary Hedges Rayport Alternates: Stephen Welch (Absent) (remote participation), Abby De Molina (Absent), and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (PLUS Administrative Specialist) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ I. Call to order: Acting Chairman Mr. Lowell called the meeting to order at 4:05pm. Attendance taken by roll call: Board Members: Dave Iverson, Aye (remote participation) John Kitchener, Aye (remote participation) Joseph Topham, Aye Hillary Hedges Rayport, Aye Acting-Chair Nat Lowell, Aye Alternates: Stephen Welch, Aye (remote participation) Howard Matz, Aye Staff: Leslie Snell, Aye Megan Trudel, Aye William Saad, Aye Catherine Ancero, Aye Acting Chair Lowell read a prepared statement in accordance with Governor Baker’s March 21, 2020, order regarding open meeting law, which outlines how the meeting is conducted via remote participation and states the ground rules for any discussion. II. Approval of the agenda: DISCUSSION: A request had been made by the property owners to continue Articles 60 and 61 and by continuing the items woul [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 28, 2026 · 17:30

Nantucket Planning & Economic Development Commission

NP&EDC and Select Board to discuss Cape Cod bridges and ferry terminal grant

The Nantucket Planning & Economic Development Commission will hold a joint meeting with the Select Board. The session includes a MassDOT presentation on the Sagamore and Bourne bridges and a request to authorize letters of support for a ferry terminal feasibility study grant.

transportationinfrastructuregrantsferry-terminalbridges
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Wednesday, January 28, 2026 at 5:30 pm Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_tq3Uj39RRXqgYCWIeX1gvg Signature of Chair or Authorized Person Megan Trudel, AICP, Deputy Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGEN DA FOR PARTICIPATION IN THE MEETING USE LINK BELOW: https://us06web.zoom.us/webinar/register/WN_tq3Uj39RRXqgYCWIeX1gvg To view the meeting only: https://youtube.com/live/10uYHnZPb9A PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Joint Meeting with the Nantucket Select Board: A. Cape Cod Bridges Project: Presentation by Massachusetts Department of Transportation (MassDOT) on Addressing the Aging Sagamore and Bourne Bridges and the Surrounding Roadway Networks. B. NP&EDC: Request for Sel [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 28, 2026 · 17:30

Select Board

Select Board to hold public hearing on eminent domain of 114 Orange Street

The Select Board will consider the taking by eminent domain of 114 Orange Street for drainage and municipal purposes. The board will also hold a joint meeting with the NP&EDC regarding bridge projects and ferry terminal grants.

eminent-domaininfrastructuretransportationfishinghistoric-preservation
✓ Decided: Board approved historic preservation restriction for 4 Old North Wharf

The Select Board unanimously approved the minutes of the Jan. 21 meeting and the Treasury warrants for Jan. 28. It increased the commercial scallop bushel limit to six, with authority to raise to seven if needed. The board also approved a historic preservation restriction for 4 Old North Wharf and authorized a letter of support for the Steamship Authority’s BUILD grant application. Additional actions included approving the Douglas Way land subdivision, closing a public hearing on 114 Orange Street, and approving a $64,563.20 damages award.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JANUARY 28, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/10uYHnZPb9A ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_tq3Uj39RRXqgYCWIeX1gvg I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Community Claims Fund Launches on Monday, January 26, 2026 to Accept Claims. This Fund was Created as Part of the Blade Failure Settlement with GEV. Verus, LLC, the Administrator of the Fund, has Created a Dedicated Website with More Information and Instructions for How to File a Claim: www.NantucketBladeSettlement.com. Claims Must be Filed No Later than J [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 28, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of January 28, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon, Matt Fee and Dr. Malcolm MacNab. Brooke Mohr participated remotely. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. She noted that Ms. Mohr is participating remotely and all votes will be taken by roll call. II. SELECT BOARD ACCEPTANCE OF AGENDA Chair Hill noted that there will be two additional announcements; that item IX – 2 (Affordable Housing Trust Quarterly Update) has been tabled to the Board’s February 4th meeting; and there will be no Monthly Town Management Report (item XII - 1) due to the Town Manager attending the Massachusetts Municipal Association’s Annual Meeting last week and dealing with Winter Storm Fern. The agenda was otherwise accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the following announcements: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. The Community Claims Fund Launches on Monday, January 26, 2026 to Accept Claims. This Fund was Created as Part of the Blade Failure Settlement with GEV. Verus, LLC, the Administrator of the Fund, has Created a Dedicated Webs [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 27, 2026 · 10:00

Coastal Resilience Advisory Committee

Committee reviews 2 Shore Road design for coastal resiliency and supports Steamship Authority grant

The Coastal Resilience Advisory Committee will meet via Zoom to approve the December 9, 2025 minutes and hear public comments. It will review the design for 2 Shore Road as requested by the Conservation Commission and discuss any needed changes to align with the Town’s Coastal Resilience Plan. The committee will consider a recommendation to support the Steamship Authority’s BUILD grant application for terminal resiliency. Additional reports from various town boards and future meeting dates will also be discussed.

coastal-resiliencegrantplanningpublic-commentmeeting
✓ Decided: CRAC voted to support Steamship Authority’s grant application letter

The committee unanimously approved the minutes from the December 9, 2025 meeting. Members voted to support a letter for the Steamship Authority’s BUILD grant application. The meeting was then adjourned unanimously.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, January 27, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, January 27, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes December 9, 2025 5. Per the Conservation Commission’s request, review the design for 2 Shore Road, review answers from CRAC [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Nantucket Coastal Resilience Advisory Commi6ee (CRAC) Tuesday, January 27, 2026 Via Zoom *Mee$ngs are audio- and video-recorded Members present: Gary Beller, Ma7 Fee, Liz Phelps, Peter Brace, Doug Rose, Tim Braine, Emily Junkins, Hillary Hedges Rayport, Joanna Roche Members Absent: Christy Kickham, Sarah Bois Staff present: Leah Hill Scheduled Speakers: Paul Santos & Chloe Coggins, Nantucket Surveyors; Caroline Muldoon, Steamship Authority Members of the public: Recording available here: https://www.youtube.com/watch?v=pT5-7uapxak Packet available here: h7ps://nantucketma.portal.civicclerk.com/event/22108/files/agenda/ 32171 1. Call to order • The mee$ng was called to order by Chair Peter Brace 2. Mee$ng announcements • Script for remotely conduc$ng Open Mee$ngs, read by Chair • The mee$ng is being audio/visually recorded 3. Public comment on topics not on the agenda • No public comments 4. Approval of minutes • Minutes for mee$ng on December 9, 2025 were approved unanimously 5. Per the Conserva$on Commission’s request, review the design for 2 Shore Road, review answers from CRAC response template, and discuss any changes that may be warranted to be7er promote coastal resiliency and consistency with the Town’s Coastal Resilience Plan • Paul Santos and Chloe Coggins, Nantucket Surveyors, gave an overview of the proposed plan. • Several ques$ons and issues were discussed: - Ownership of the proper$es involved - Impact on impervious ground square footage [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 27, 2026 · 16:00

Historic District Commission

Historic District Commission to review hotel and dwelling applications

The Historic District Commission will meet to discuss and vote on applications for new hotel construction and various dwelling additions. The meeting will also include a Commissioner Q&A session and the approval of previous meeting minutes.

historic-districtzoningbuildinghousingplanningnantucket
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JAN 23 AM 10:18 Original Posting Number: T 066 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, January 27, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair https://us06web.zoom.us/webinar/register/WN__DZwnBOqTIOgMdhQOvvadA#/registration To watch live feed, click here: https://www.youtube.com/live/VwdSq6rZGnw Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 27, 2026 · 16:00

Finance Committee

Finance Committee to discuss Town Council government change and land acquisition

The Finance Committee will deliberate on several Citizen Warrant Articles for the 2026 Annual Town Meeting. These items include a home rule petition regarding the town's form of government and a real estate acquisition.

government-structurereal-estatewaste-managementbylawstown-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, JANUARY 27, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81079353496?pwd=abm6VDVUUXq3bgTRzedKwWwvsmiEji.1 Meeting ID: 810 7935 3496 Passcode: 373977 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion and deliberation on Citizen Warrant Article B – Home Rule Petition – Change to Town Council Form of Government 6. Discussion and deliberation on Citizen Warrant Article C – Real Estate Acquisition - Boynton Ln 7. Discussion and deliberation on for Citizen Warrant Article G – Appropriation - Municipal Waste Incinerator 8. [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 27, 2026 · 16:00

Finance Committee

Nantucket County Review Committee to discuss and potentially adopt FY2027 budget

The committee will review and discuss the FY2027 County Budget. The body may decide to adopt the budget during this meeting.

budgetcounty-governmentfinance
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NANTUCKET COUNTY REVIEW COMMITTEE Day, Date, and Time TUESDAY, JANUARY 27, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81079353496?pwd=abm6VDVUUXq3bgTRzedKwWwvsmiEji.1 Meeting ID: 810 7935 3496 Passcode: 373977 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Review and Discussion of FY2027 County Budget 5. Potential Adoption of FY2027 County Budget 6. Other Business 7. Adjournment
Tue Jan 27, 2026 · 16:00

Nantucket Islands Land Bank Commission

Commission reviews farm update, deer permit, golf range expansion, and finances

The Nantucket Islands Land Bank Commission will discuss updates on the Sustainable Nantucket Farm at 168 Hummock Pond Road, a deer‑damage permit, the Miacomet Golf Driving Range expansion, and an easement at 8 Wesco Place. It will also receive a report on long‑range objectives, approve the January 13 meeting minutes, and consider financial items including the December financial report and warrant authorizations for cash disbursements and a 2012 Series A bond payment.

land-bankproperty-managementagriculturefinancelong-range-objectivespermits
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, January 27, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C. Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/89365429460?pwd=FnoGHpLd0am4IL8tDOWaucbBldctKU.1 Webinar ID: 893 6542 9460 Passcode: 940307   Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. AGRICULTURAL BUSINESS a. 168 Hummock Pond Road/Mt. Vernon Farm - Sustainable Nantucket Farm Update 4. PROPERTY MANAGEMENT a. Deer Damage Permit – Update b. Miacomet Golf Driving Range Expansion – Update c. 8 Wesco Place – Easement Update 5. LONG RANGE OBJECTIVES a. Upd [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026 · 12:00

Nantucket Public School Committee

Nantucket School Committee Policy Subcommittee meeting cancelled

The scheduled meeting for the Nantucket School Committee Policy Subcommittee on January 26, 2026, has been cancelled. The agenda had included reviews of school policies and a vote on December 15, 2025 meeting minutes.

school-policyeducationfacilitiesstudent-transportation
32 First Way
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CANCELLED MEETING POSTING Original Posting Date __ January 22, 2023 Original Posting Number __T062 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Policy Subcommittee Meeting Day, Date, and Time Monday, January 26, 2026 - 12:00PM Location / Address Nantucket Public Schools, Central Office 32 First Way Nantucket, MA 02544 Signature of Chair or Authorized Person WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! THIS MEETING HAS BEEN CANCELLED I. Call to Order II. Welcome and approval of agenda III. Review and update Policy a. Review Nantucket High School (NHS) Program of study grade point average, NHS Students - Hunter Bistany, Jake Clarke, Russell Simpson b. EEAG, Student Transportation in Private Vehicles c. EEAJ, Motor Vehicle Idling on School Grounds d. EEBA, School-Owned Vehicles e. EEBA-R, School-Owned Vehicles - Rules & Procedures f. EFC. Free and Reduced Price Food Services g. EFDA, Collection of Money for Food Services h. EFDA-R, Collection of Money for Food Services - Rules & Procedures i. EGAD, Copyright Compliance j. EGAD-R, Copyright Compliance - Rules & Procedures k. FA, Facilities Development Goals l. FAB, Determinin [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026 · 11:00

Select Board

Select Board to hold public hearings on two utility petitions

The Select Board will conduct public hearings regarding two utility petitions from Nantucket Electric Company/National Grid. These proposals involve installing conduits and relocating equipment on Monohansett Road and West Dover Street.

utilitiesinfrastructurepublic-hearingselectric
✓ Decided: Select Board postpones two utility hearings to Feb 9 2026

The board voted to continue the public hearing on Nantucket Electric Company/National Grid petition #31106078 for Monohansett Road to Feb 9 2026. It also voted to continue the hearing on petition #31110755 for West Dover Street to the same date. The meeting was then adjourned.

REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, JANUARY 26, 2026 at 11:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/EDDqzfHFFLM ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_LU6FXHjEQhesodQPQgPLQg I. CALL TO ORDER II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. PETITIONS – PUBLIC HEARINGS 1. Public Hearing to Consider Utility Petition from Nantucket Electric Company/ National Grid, Plan # 31106078, to Install 1,300’ of 2-3” PVC Conduits from Existing Transformer P11-32 on Monohansett Road to Pad 11-35X and Relocate Pad 11-33 3’ to the North and Relocate Pad 11-35X 3’ to the West. 2. Public Hearing to Consider Utility Petition from Nantucket Electric Company/ National Grid, Plan # 31110755, to In [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 26, 2026 Page 1 of 2 SELECT BOARD Minutes of the meeting of January 26, 2026. The meeting took place by remote participation via Zoom Webinar. Select Board Members present were Dawn E. Hill, Tom Dixon and Brooke Mohr. Matt Fee arrived as noted below. Dr. Malcolm MacNab was absent. Also present was Operations Administrator Erika Mooney. I. CALL TO ORDER Chair Hill called the meeting to order at 11:00 AM. II. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. III. PETITIONS – PUBLIC HEARINGS 1. Public Hearing to Consider Utility Petition from Nantucket Electric Company/ National Grid, Plan # 31106078, to Install 1,300’ of 2-3” PVC Conduits from Existing Transformer P11-32 on Monohansett Road to Pad 11-35X and Relocate Pad 11-33 3’ to the North and Relocate Pad 11-35X 3’ to the West. Chair Hill opened the public hearing. Ms. Mooney requested that due to Winter Storm Fern, the hearing be continued to February 9, 2026. So moved by Ms. Mohr; seconded by Mr. Dixon; by roll call vote: Chair Hill – Yes; Mr. Dixon – Yes; Ms. Mohr – Yes; so voted. Mr. Fee arrived at 11:01 AM. 2. Public Hearing to Consider Utility Petition from Nantucket Electric Company/ National Grid, Plan # 31110755, to Install Two Handholes (HH7-2 and HH 7-3) and 50’ of 2-3” Conduit from Pole 7 on West Dover Street for New Service at 10A West Dover Street. Chair Hill opened the public hearing. Ms. Mooney requested [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 26, 2026 · 17:00

Nantucket Planning & Economic Development Commission

NP&EDC to review land use strategy and transportation safety targets

The Nantucket Planning & Economic Development Commission will receive a presentation on the Massachusetts Integrated Land Use Strategy. The body will also discuss transportation safety targets and the 2026 Annual Town Meeting warrant articles.

land-usetransportationregional-planningpublic-safetytown-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Monday, January 26, 2026 at 5:00 pm Location / Address HYBRID - 131 PLEASANT STREET, ROOM A AND REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_zEHiEWFyRaCnARPu63h_vg#/registration Signature of Chair or Authorized Person Leslie Snell, AICP, Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGEN DA FOR PARTICIPATION IN THE MEETING USE LINK BELOW: https://us06web.zoom.us/webinar/register/WN_zEHiEWFyRaCnARPu63h_vg#/registration To view the meeting only: https://www.youtube.com/watch?v=xZycsl4DNYE PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Public Comment for items not included on the agenda: V. Announcements: • No February NP&EDC meeting • Joint meeting with the Select Board RE: Cape Cod Bridges, Wednesday, January 28, 2026, at 5:30pm • Public information session re: Milestone Rotary and intersecti [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Jan 23, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The scheduled meeting for the Washington Street Collaborative Work Group on January 23, 2026 has been cancelled. No agenda items will be discussed or decided. Residents should await a future notice for a rescheduled meeting.

22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, January 23, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/83623538137?pwd=6bZ4aSwm2OUIJdUcOTWaExjZduNp4E.1 Meeting ID: 836 2353 8137 Passcode: 548244 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Thu Jan 22, 2026 · 16:00

Finance Committee

Finance Committee to review Citizen Warrant Articles and 2026 Town Meeting items

The Finance Committee will discuss and potentially vote on several warrant articles. These include changes to the NPEDC and the Offshore Wind Stabilization Fund, as well as articles for the 2026 Annual Town Meeting.

financewarrant-articlestown-meetingoffshore-wind
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time THURSDAY, JANUARY 22, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85944929791?pwd=PNm141wZi7uVa6dp8s9QFgKHeJ7xGF.1 Meeting ID: 859 4492 9791 Passcode: 350008 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Discussion, deliberation and potential motions for Citizen Warrant Article D - Changes to NPEDC 6. Discussion, deliberation and potential motions for Citizen Warrant Article F - Offshore Wind Stabilization Fund 7. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026 8. Committee Report [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 22, 2026 · 14:30

Affordable Housing Trust

Affordable Housing Trust to consider purchase agreement for 158 Madaket Road

The Affordable Housing Trust will meet to discuss requests and reports from the Housing Department. The primary item for consideration is the approval and execution of a purchase and sale agreement for a specific property.

affordable-housingreal-estatehousing-department
✓ Decided: Trust approved $2 M purchase of 158 Madaket Road for affordable housing

The Affordable Housing Trust approved its meeting agenda. It then approved and authorized the execution of a Purchase and Sale Agreement to buy 158 Madaket Road for $2,000,000, with closing set for March 9, 2026. The meeting was adjourned after the motions were unanimously approved.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Thursday, January 22, 2026, at 2:30 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR THURSDAY, JANUARY 22, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/86319064994?pwd=jzn7F0RRUdh7sBAHzlXGo5BNZ0bWay.1 Meeting ID: 863 1906 4994 Passcode: 654812 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. PUBLIC COMMENT* V. HOUSING DEPARTMENT REQUESTS/REPORTS 1. Request for Approval and Execution of Purchase and Sale Agreement for 158 Madaket Road VI. BOARD COMMENTS VII. OTHER BUSINESS - 2 - 1. Next Meeting(s): i. T uesday, February 3, 2026, at 12:30 PM – Hy [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on January 22, 2026, at 2:30 PM NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Thursday, January 22, 2026 Remote Meeting via Zoom – 2:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Attending Members remotely: Brian Sullivan (Chair ), Shantaw Bloise-Murphy, Forest Bell, Abby De Molina, Mary Mack Staff in Attendance remote: Kristie Ferrantella (Housing Director) , Caroline Ferguson (Administrative Specialist), Vicki Marsh (Town Counsel), Eric Barth (Town Counsel) Speakers in Attendance: None I. CALL TO ORDER Chair Sullivan called the meeting to order at 2:33 pm. II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA Abby De Molina made a MOTION to approve the agenda. Mary Mack seconded the motion. Forest Bell – Aye; Abby De Molina – Aye; Mary Mack – Aye; Shantaw Bloise-Murphy – Aye; Brian Sullivan – Aye. III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. IV. PUBLIC COMMENTS There was no public comment. V. HOUSING DEPARTMENT REQUESTS/REPORTS 1. Request for Approval and Execution of Purchase and Sale Agreement for 158 Madaket Road Ms. Ferrantella explained that this is a request for the execution of the Purchase and Sale Agreement for 158 Madaket Road. Chair Sullivan asked whether the closing date of March 9, 2026, is realistic. Ms. Marsh said that the seller is motivated to close on the sal [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 22, 2026 · 17:00

Conservation Commission

Public hearing on multiple development permit applications

The Nantucket Conservation Commission will hold a public hearing to consider several Notice of Intent applications, both with and without required waivers. It will also review orders of conditions, an extension request, and approve the minutes from the January 8, 2026 meeting. Additional agenda items include monitoring reports, committee updates, and enforcement actions.

zoningpermitsdevelopmentpublic-hearingconservationenforcement
✓ Decided: Commission approved closure of three pending coastal applications

The Conservation Commission accepted its agenda and approved the withdrawal of the Maloney‑15 Old North Wharf application. It then voted to close three pending SE48 applications: 86 & 88 Pocomo Road (SE48‑3952), Del Balzo 6 & 8 Grove Lane (SE48‑3955), and the 13 Commercial Wharf shed project. Several other applications were continued for further review.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date: 2026 JAN 12 PM 02:16 Original Posting Number: T 038 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, January 22, 2026, at 5PM Location / Address The meeting will be held in hybrid format. In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/NR4b9nR8Na4 Zoom Registration: https://us06web.zoom.us/webinar/register/WN_v5HEBRLFQP-UpPxl89ypww Signature of Chair or Authorized Person Jeff Carlson, Natural Resources Director William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for January 22, 2026, 5:00 P.M. The meeting will be held in hybrid format. In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Info [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes January 22, 2026, adopted February 5, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, January 22, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/NR4b9nR8Na4 Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell’Erba, Conservation Agent Attending Members: Engelbourg, Braine, Misurelli, Plandowski, Schafer, and Turcotte. Williams arrived at 5:02pm Absent Members: Members Left Early: I. Call To Order II. Acceptance of the Agenda Discussion: (00:01:40) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Misurelli) (Seconded by: Plandowski) Vote: Vote Carried: 6:0 Engelbourg, Misurelli, Braine, Plandowski, Schafer, and Turcotte (aye) III. Announcements Discussion: (00:03:33) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:04:00) none V. Public Comment Chair Engelbourg called for public comment Discussion: (00:04:02) Burton Balkind, Nantucket Coastal Conservancy - D Anne Atherton and I sent a letter to the Select Board and Commissioners that outlined that the geotube project h [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 21, 2026 · 17:30

Select Board

Select Board to adopt May 4, 2026 Annual Town Meeting and Election Warrant

The Select Board will review and adopt the warrant for the May 4, 2026 Annual Town Meeting and Election. The board will also consider several contracts and discuss the use of town-owned property for a Nantucket Regional Transit Authority (NRTA) garage.

town-meetingcontractstransportationhousingpublic-works
✓ Decided: Select Board adopts 2026 town meeting warrant and authorizes NRTA site

The board approved the minutes from the January 12 and 14 meetings, payroll and treasury warrants, and pending contracts. It authorized the Town Manager to execute municipal employee housing leases without prior board approval. The board also approved proceeding with the Industry Road site for the NRTA and directing staff to draft an intermunicipal agreement. Finally, the board adopted the 2026 annual town meeting and election warrant.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JANUARY 21, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/FqYmbFWSGho ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_U7AzQDjTTayWirZgiL1-Gg I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town to Host Public Information Session on PFAS The Town Will Host its Third Public Information Session to Share Science-Based Education on PFAS. The Session, “Findings from the Surface Water and Foam Sampling Project,” Will be Held on Thursday, January 22, 2026 at 5:30 PM, Featuring Dr. Rebecca DeVries from Eastern Research Group, by Remote Participation Only [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 21, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of January 21, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Dawn E. Hill participated remotely. I. CALL TO ORDER Vice Chair Fee called the meeting to order at 5:30 PM following the Pledge of Allegiance. He noted that while Chair Hill is participating remotely, he will be acting chair, and all votes will be taken by roll call. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the following announcements: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town to Host Public Information Session on PFAS The Town Will Host its Third Public Information Session to Share Science-Based Education on PFAS. The Session, “Findings from the Surface Water and Foam Sampling Project,” Will be Held on Thursday, January 22, 2026 at 5:30 PM, Featuring Dr. Rebecca DeVries from Eastern Research Group, by Remote Participation Only Via Zoom and YouTube. 3. Affordable Housing Trust (AHT) is Seeking Proposals for its Year-Round Deed Restriction Pilot Program: - Designed to Provide Housing Stability, Security and Affordability for Those Living and [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 21, 2026 · 15:00

Tree Advisory Committee

Tree Advisory Committee reviews multiple tree project updates

The Nantucket Tree Advisory Committee will discuss updates on several tree-related projects, including work on Union St., Pleasant St., W. Creek Rd., Atlantic Ave., and the 250th Anniversary Liberty Tree Project. The meeting also includes public comment, citizen/departmental requests, and announcements. No formal decisions are listed on the agenda.

treeenvironmentpublic-commentupdatesplanning
188 Madaket Road; DPW Conference Area, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s TREE ADVISORY COMMITTEE Day, Date, and Time WEDNESDAY, January 21, 2026, AT 3:00PM Location / Address DPW CONFERENCE ROOM OR REMOTE PARTICIPATION VIA ZOOM The meeting will be aired later, on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person DAVID CHAMPOUX, TREE WARDEN/CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Join Zoom Meeting https://us06web.zoom.us/j/89913570001?pwd=UEVTaVhOb3QzeDlRRUZseXdNUGlvQT09 Meeting ID: 899 1357 0001 Passcode: 237451 AGENDA I. CALL TO ORDER 1. Committee Attendance II. COMMITTEE ACCEPTANCE OF AGENDA IV. ANNOUNCEMENTS V. PUBLIC COMMENT /DISCUSSION VI. CITIZEN/DEPARTMENTAL REQUESTS VII. OLD BUSINESS - 43 Union St. Building Dept Update - 7 Pleasant St.- Sugar Maples - Elms @ W. Creek Rd/ Update - Atlantic Ave. Elms/ Future Development Impacts/ Update - Tree Planting/ Replacements/ Stump Grinding - 250th Anniversary Liberty Tree Project (Mary Longacre) 2 - Main St. Nantucket Project - 13 Back St. Elm/ Update XI. ADJOU [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026 · 18:00

Nantucket Public School Committee

School Committee will vote on the FY 2027 academic calendar

The Nantucket Public School Committee will discuss budget updates, present the Town of Nantucket FY 27 budget, and consider several donation approvals. It will vote on the FY 2027 school calendar and on a High School overnight field trip to the Southeast District Music Festival (Jan 8‑10, 2026). Additional votes cover multiple community donations for school programs and activities.

school-calendarbudgetfield-tripsdonationseducation
✓ Decided: Agenda approved unanimously; no substantive decisions recorded

The committee approved the meeting agenda by unanimous vote. The session included updates on student enrollment, transportation, budget presentations, community school funding requests, and bullying investigations, but no formal votes or approvals on those items were recorded.

10 Surfside Road, NANTUCKET HIGH SCHOOL
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, January 20, 2026, 6:00 PM Location / Address Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. January Student Enrollment b. Transportation Update c. 2026 ACCESS Testing d. Additional Updates VI. Presentations and discussions of issues to the Committee a. Town of Nantucket FY27 Budget Presentation - Libby Gibson, Town Manager, Brian Turbitt, TON Chief Financial Officer b. Bullying Update - School Principals/Assistant Principals c. Budget Development - Martin Anguelov, CFO of Nantucket Public Schools 1. Facilities & Grounds - Charles Clunie, Director of Facilities, 2. IT/Technology - Stephanie Hoban, Director of Technology 3. Athletics - Travis Lombardi, Athletic Director d. FY27 Budget Forecast and FY26 2nd Quarter Budget [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Nantucket School Committee Meeting Minutes January 20, 2026 Present Members: Chair Laura Gallagher Byrne, Vice-Chair Shantaw Bloise-Murphy, Timothy Lepore, Esmeralda Martinez, Vincent Murphy, Student Representative Danielle Lewis, and Superintendent Elizabeth Hallett The January 20, School Committee meeting was called to order at 6:00 PM in the Nantucket High School LGI by Chair Laura Gallagher Byrne. A motion was made by Shantaw Bloise-Murphy, seconded by Vincent Murphy. The agenda was approved unanimously. Announcement: this meeting is being audio and video recorded There was no Public Comment. Superintendent’s Update Dr. Hallett reported that student enrollment has increased slightly from December to January, rising from 1,655 to 1,659 students. NES and NHS each gained four students, while NIS and CPS each lost two. In transportation, she highlighted the addition of a 7D van to the Cape Cod Collaborative fleet, which requires less training than a standard school bus and is currently used for morning pickups in Madaket and afternoon drop-offs for special education students. Plans are underway to add another 7D vehicle to help with overcrowded routes. She also reminded parents that drop-offs and pickups must follow designated areas to avoid traff [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council to review projecting sign for Café 22

The Sign Advisory Council will meet to discuss new business and review a sign application. The primary item for consideration is a projecting sign for a business at 22 Federal Street.

signszoningbusiness-permits
✓ Decided: Council approved new projecting sign for 22 Federal Street

The Sign Advisory Council adopted its agenda and approved the minutes from the January 20 meeting, both unanimously. The council also approved the design for a projecting sign at 22 Federal Street, noting it complies with the master sign plan and has historic approval. The meeting was adjourned at 9:13 am.

REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, January 20, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn; Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 139867 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 883 5400 5057 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of Agenda 5. Approval [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes January 20, 2026; adopted February 3, 2026 Page 1 of 2 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday January 20, 2026 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Staff in attendance: Cathy Flynn, Land Use Specialist; Rodlisha Dixon, Administrative Specialist. Absent members: Kevin Kuester & Mark Cutone Late arrivals: None Early Departures: None Motion to Adopt Agenda made by made by Wolf; seconded by Normand. Vote: carried unanimously. Approval of Minutes: Approve minutes of January 20, 2026 (motion by Wolf; seconded by Normand). Vote: carried unanimously. II. Public Comment- none III. Commissioner Comments-none IV. New Business Minutes January 20, 2026; adopted February 3, 2026 Page 2 of 2 Property owner name Street Address Scope of work Map/Parcel Agent (OB) 22 Federal St LLC-13953 22 Federal Street Café’ 22- Projecting Sign 42.4.2/3 Jonas Baker Discussion: Council reviewed the projecting sign design, which is compliant with the approved master sign plan. Staff confirmed the prior projecting sign had historic approval. Motion: Motion to approve as submitted. (Made by Wolf; seconded by Normand) Vote: Carried unanimously. V. Enforcement: A general discussion was held regarding unpermitted freestanding direct [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026 · 17:00

Harbor & Shellfish Advisory Board

Harbor & Shellfish Advisory Board to discuss mooring permits and fuel transfer

The Harbor & Shellfish Advisory Board will meet to discuss marine and natural resources reports. The board will hold discussions on Chapter 91 licensing, diesel fuel transfer for commercial fishermen, and priority mooring permits for residents.

harbor-managementshellfishingmooring-permitsmarine-departmentcommercial-fishing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, Jan. 20, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting - https://us06web.zoom.us/j/81444304317?pwd=jTZjdIDbeKyi0ca0wxZXISqu5Drba9.1 Meeting ID: 814 4430 4317 Password: 475577 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, Jan. 20, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/81444304317?pwd=jTZjdIDbeKyi0ca0wxZXISqu5 Drba9.1 Meeting ID: 814 4430 4317 Password: 475577 CALL TO ORDER 2 APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of Jan. 6, 2026 CHAIRMAN’S REPORT Moment of silence for Lionel Starr and Howie Whelden 2026 dates for Town Election candidacy papers MARINE DEPARTMENT REPORT Gener [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026 · 12:30

Affordable Housing Trust

Affordable Housing Trust to discuss property purchases and deed restriction program

The Nantucket Affordable Housing Trust will meet to approve a purchase and sale agreement for 158 Madaket Road and review a housing production plan. The agenda also includes a public comment session and an executive session to discuss real estate negotiations.

housingaffordable-housingreal-estatepublic-commentexecutive-session
✓ Decided: Board voted to enter executive session to discuss real‑property deals

The Trust amended the agenda to remove item VIII.1 and approved the minutes from the January 6 meeting. A motion to close the open session and move to executive session was passed to consider the purchase, exchange, lease, or value of real property at 14 Somerset Road and 8C Thirty Acres Lane. All votes were recorded as Ayes.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - UPDATED MEETING POSTING Original Posting Date January 15, 2026 Original Posting Number T 049 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, January 20, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Caroline Ferguson Administrative Specialist WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA FOR TUESDAY, JANUARY 20, 2026 Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/89243722122?pwd=q3T4GrZVBtz4GUbOxWUJu68vfEqoNK.1 Meeting ID: 892 4372 2122 Passcode: 461305 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Afford [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on January 20, 2026, at 12:30 PM NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, January 20, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM Trust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Attending Members in person: Brooke Mohr Attending Members remotely: Brian Sullivan (Chair), Forest Bell, Mary Mack , Shantaw Bloise - Murphy Staff in Attendance in person: Kristie Ferrantella (Housing Director), Dylan Metsch-Ampel (Deputy Housing Director), Caroline Ferguson (Administrative Specialist) Staff in Attendance remote: Vicki Marsh (Town Counsel) , Eric Barth (Town Counsel) , Keelin Ciccariello (Town Counsel), Tracy MacDonald (Real Estate Manager) Speakers in Attendance: Judi Barrett (Barrett Planning LLC), Tony Duong (Barrett Planning LLC) I. Call to Order Chair Sullivan called the meeting to order at 12:32 pm. II. Approval of Agenda Brooke Mohr made a MOTION to amend the agenda to remove agenda item VIII.1 and to approve the agenda as amended . Mary Mack seconded the motion. Mary Mack – Aye; Forest Bell – Aye; Brooke Mohr – Aye; Brian Sullivan – Aye. Shantaw Bloise-Murphy joined at 12:34 pm. III. Announcements Dylan Metsch-Ampel shared the following announcements: 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Affordable Housing Trust has re-released th [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 20, 2026 · 16:00

Historic District Commission

Historic District Commission to review property renovations and new construction

The Historic District Commission will review various applications for exterior modifications, new dwellings, and solar installations. The body is also considering a change to Old Business meeting hours to 4pm–7pm effective January 27, 2026.

historic-districtzoningsolarconstructionnantucket
✓ Decided: Commission approved historic brick renovation for Nantucket Electric Co.

The Historic District Commission changed its Old Business meeting hours to 4 pm–7 pm effective Jan 27, 2026. It unanimously approved the historic brick and mortar renovation for Nantucket Electric Company at 5 Candle Street with conditions. The board also unanimously approved a large set of consents, a new café sign at 22 Federal St., and several new‑business projects including a new dwelling on Monomoy Road and window work at 14 Lyon Street. Minutes from the Jan 6, 2026 meeting were adopted by a 4‑1 vote.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time 2026 JAN 15 PM 01:50 Original Posting Number T 050 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, January 20, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_QMcX1eclSGKMtPUEVZAt_g#/registration To watch live feed, click here: Nantucket Historic District Commission - January 20, 2026 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view HDC M [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC Minutes January 20, 2026; adopted February 3, 2026 HISTORIC DISTRICT COMISSION Minutes, January 20, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Abby Camp, Val Oliver, Angus MacLeod, Ray Pohl Associate Commissioners: Constance Patten Staff: Cathy Flynn, Holly Backus and Fiona Johnson In person: Welch, Camp, Oliver, Macleod, Pohl and Patten Absent: Thornewill, Paul Meeting called to order at 4:02pm by Welch Pohl made the motion to approve the agenda. Board: Welch, Pohl, Camp, Oliver, MacLeod; Alternates: Patten Holly Backus left the meeting at 4:30pm I. COMMISSIONER DISCUSSION AND/OR VOTE • Change to Old Business meeting hours- 4pm – 7pm; effective next Old Business meeting- January 27, 2026. • Incomplete applications – the Chair reminded the commissioners to please check for incomplete applications that create problems (fences, grates, etc.) to follow up with staff on consent review day to articulate what maybe missing. He thanked the commissioners for a job well done. • Nantucket Electric Company (HDC2025-06-12812) 5 Candle Street (42.3.1/91) Historical Renovation- review and approval of brick and mortar per the request of the Commission. Commissioners: Welch, Pohl, Camp, Oliver, MacLeod; Alternates: Thornewill, Patten, Paul- Approved with Conditions July 01, 2025 MacLeod made motion to approve the sample shown on the most-right section facing the brick panel and that the mor [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Jan 16, 2026 · 09:00

Contract Review Committee, Human Services

Contract Review Committee meeting cancelled

The Contract Review Committee meeting scheduled for January 16, 2026, was cancelled.

cancelledcommittee
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __JAN 12,2026 Original Posting Number __T 035 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s CONTRACT REVIEW COMMITTEE Day, Date, and Time FRIDAY, JANUARY 16TH 2026, AT 9:00 AM Location / Address REMOTE PARTICIPATION VIA ZOOM 131 PLEASNT STREET: ROOM B Signature of Chair or Authorized Person VERONICA BOLCIK AT-LARGE/CHAIR THIS MEETING HAS BEEN CANCELLED
Fri Jan 16, 2026 · 10:00

Nantucket Historical Commission

Review of Tom Nevers Bike Path design for historic resource impact

The Nantucket Historical Commission will meet in a hybrid format on January 16, 2026. The agenda includes public comment, staff updates, and a design review of the Tom Nevers Bike Path to assess potential impacts on historic resources. Commissioners will also receive updates on historic resource surveys, discuss a distressed‑properties list with possible demolition‑by‑neglect citations, and consider civil‑war monument repairs and upcoming training opportunities. Minutes from the October 17, November 21, and December 19, 2025 meetings will be approved.

historic-resourcesbike-pathsurveysgrantsdemolition-by-neglectmonument-repair
✓ Decided: Commission approved prior meeting minutes and adjourned the session

The Nantucket Historical Commission unanimously approved the minutes from the November 21 and December 19, 2025 meetings. The commission then unanimously moved to adjourn the meeting at 11:17 AM.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date 26 Jan 12 Original Posting Number T 036 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Historical Commission Day, Date, and Time Friday, January 16, 2026 10:00 AM – 12:00 PM Location / Address HYBRID MEETING REMOTE PARTICIPATION AND IN PERSON at 131 Pleasant Street, Nantucket Signature of Chair or Authorized Person Rita Carr (Chair) WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Rita Carr (Chair), Angus MacLeod (Vice Chair), Abby De Molina (Secretary), George Butterworth, Barbara Halsted, Sarah McLane, Betsy Tyler Staff Liaison: Holly Backus Join Zoom Meeting https://us06web.zoom.us/j/94332358504?pwd=N25KSGR2QldOeWFuc2tKUXcvaERGdz09 Meeting ID: 943 3235 8504 Passcode: 770019 One tap mobile +16465588656,,94332358504#,,,,*770019# US (New York) AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting • Public comment • Staff update • Tom Nevers Bike Path design review for potential impact to historic resourc [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Nantucket Historical Commission January 16, 2026 Meeting 10AM 131 Pleasant Street, Nantucket MA and via Zoom Attendees: Betsy Tyler (Commissioner) Barbara Halstead (Commissioner) George Butterworth (Commissioner) Rita Carr (Commissioner) Holly Backus (staff – Preservation Planner) Abby De Molina (Commissioner) – online Angus MacLeod (Commissioner) – online Mike Burns (staff – Transportation Manager) – online Drew Patnode (staff – Head of Department of Public Works) – online Antone Almeida (Project Manager with landscape architecture with Weston & Sampson) – online Devin Herrick (Wetland scientist with Weston & Sampson) – online Mary Bergman (Nantucket Preservation Trust) – online Absent: Sarah McLane (Commissioner) Agenda • Roll call at 10 AM Commissioners Rita, George, Barbara, and Betsy are in person. Commissioners Abby and Angus are online. Staff Holly is also in person. Staff Mike and Drew are also online, as are Weston & Sampson consultants Devin and Antone and Mary. • Public comment None • Staff update None • Tom Nevers Multiuse Path design review for potential impact to historic resources Path will be 2.1 miles and will connect Milestone Road with the Tom Nevers field. The Weston and Sampson consultants presented the detailed slides. No wetland impact – an assessment was done. Land Bank supports. They showed how there is a boardwalk on some of the path. Question from Abby if there will be crosswalks to the streets on the other [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026 · 14:00

Capital Program Committee

Capital Committee reviews FY27 requests for Our Island Home and DPW transport

The Capital Program Committee will discuss FY27 capital project requests for the Our Island Home program and Department of Public Works transportation projects, and will hold a discussion on the RORI initiative. The meeting also includes standard agenda items such as approvals, public comment, and committee reports.

capital-programfy27infrastructuretransportationhousingrori
✓ Decided: Capital Program Committee approves moving Our Island Home project to warrant

The committee approved its agenda and later decided to proceed with the Our Island Home skilled‑nursing facility project, placing it on the warrant with the condition that it be closed if it does not pass in 2026. The board will review a pro forma financial analysis before finalizing the decision at the January 30 meeting. The meeting was adjourned after a unanimous vote.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Capital Program Committee Day, Date, and Time Thursday January 15, 2026 @ 2:00 PM Location / Address IN-PERSON PARTICIPATION at 131 Pleasant Street, Room A (Trailer) REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Susan M. Carmel WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/88025745204?pwd=FocbSdw3eTYnbMCrd7Aqbiie5SseaC.1 Meeting ID: 880 2574 5204 Passcode: 882039 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. FY27 Capital Requests: Our Island Home 6. FY27 Capital Requests: DPW Transportation 7. RORI Discussion 8. Committee Reports 9. Other Business 10. Date of Next Meeting: TBD 11. Adjournment
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket Capital Program Committee January 15, 2026 Attending Members: Jill Vieth, Chair, Howard Matz, Vice Chair, Peter Kaizer, Dawn Hill, Caroline Baltzer, Liza Hatton Staff: Susan Carmel, Deputy Finance Director, Libby Gibson, Town Manager, Rick Sears, Deputy Town Manager, Brian Turbitt, Finance Director, Bob Eisenstein, OIH Administrator, Andrew Patnode, DPW Director Absent The 1/15/26 Capital Program Committee discussed the long-term history and current status of the our island home project at Sherburne Commons. The project, initially proposed in 2017, faced voter rejection in 2025 but was reintroduced with a smaller footprint and cost. The estimated closure cost is $3.2 million, and the project is expected to be completed by 2026. The board decided to proceed, considering the project's long-term benefits and potential cost savings. The meeting also covered other capital projects, including road improvements, sidewalk repairs, and the Surfside project, with a focus on efficient resource allocation and potential reappropriation of funds. Introduction and Meeting Setup • Motion to approve the agenda made by Peter Kaizer and seconded by Liza Hatton\ • Roll call vote: Peter aye, Liza aye, Howard aye, Caroline aye, Jill aye • Motion passed unanimously. • Jill opens the meeting for public comment. • The meeting includes the town manager, Select Board member Tom Dixon, and Peter Schaefer for the minutes. Project Background and History • [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026 · 15:00

Nantucket Planning & Economic Development Commission

Commission will discuss updates to its enabling legislation and related warrant articles

The Nantucket Planning & Economic Development Commission will review and vote on updates to its enabling legislation and the related warrant articles for the 2026 Annual Town Meeting. The meeting is remote via Zoom and will be recorded. No other specific projects or contracts are listed on the agenda.

legislationtown-meetingplanninggovernance
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Thursday, January 15, 2026 at 3:00 pm Location / Address REMOTE PARTICIPATION VIA ZOOM ONLY https://us06web.zoom.us/j/87691816425?pwd=Wh7y6jYzx1dMrHY6mLaLZI74 HgD7CU.1 Signature of Chair or Authorized Person Megan Trudel, AICP, Deputy Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGEN DA This meeting is being audio and video recorded and will be uploaded to the Town of Nantucket’s Government TV YouTube page at a later date. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Discussion of the NP&EDC Enabling Legislation Update and Related Warrant Articles for the 2026 Annual Town Meeting, votes will be taken V. Adjournment
Thu Jan 15, 2026 · 13:00

Cannabis Advisory Committee

Discuss new Massachusetts social consumption regulations for cannabis

The Cannabis Advisory Committee will review updates from the Massachusetts Cannabis Control Commission, including the commission's unanimous approval of final social consumption regulations. The committee will also consider a new business item regarding ACK Natural deliveries and approve minutes from three prior meetings. Public comment will be accepted, and the next meeting is tentatively scheduled for February 19, 2026.

cannabisregulationpublic-commentmeetingupdates
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Cannabis Advisory Committee (CAC) Day, Date, and Time Thursday January 15, 2026 1:00PM Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Barry Rector WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Board Members: Barry G. Rector (Chair), Abby DeMolina (Vice-Chair), Joe Plandowski (Secretary), Dawn Hill, Jacques Zimicki Join Zoom Meeting https://us06web.zoom.us/j/84056571521?pwd=TzVQMVZXdkV6SGt6MmpmTFM5dm9rZz09 Meeting ID: 840 5657 1521 Find your local number: https://us06web.zoom.us/u/kZpvpnBWV One tap mobile +13092053325,,88677055726#,,,,*027151# US Dial by your location +1 309 205 3325 US +1 646 558 8656 US (New York) +1 301 715 8592 US (Washington DC) 2 AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. I. Call to Order II. Acceptance of Agenda III. Announcements a. The Cannabis Advisory Committee [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026 · 14:00

Select Board

Select Board to discuss Capital Program Committee report

The Nantucket Select Board will hold a regular meeting to receive a report from the Capital Program Committee about the Island Home project. No specific actions or votes are listed on the agenda. The meeting will be held in the town meeting trailer and via Zoom.

governmentcapital-programhousingmeeting
✓ Decided: No decisions made because quorum was not met

The Select Board met on January 15, 2026, but only two members were present, so a quorum was not achieved. With no quorum, the board could not conduct business and the meeting was adjourned. No documents were considered and no actions were approved, denied, or tabled.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time THURSDAY, JANUARY 15, 2026, 2:00 PM Location / Address MEETING TRAILER, ROOM A, 131 PLEASANT STREET AND REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/88025745204?pwd=FocbSdw3eTYnbMCrd7Aqbiie5SseaC.1 Meeting ID: 880 2574 5204 Passcode: 882039 I. CALL TO ORDER II. ATTEND CAPITAL PROGRAM COMMITTEE REGARDING OUR ISLAND HOME III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 15, 2026 at 2:00 PM Page 1 of 2 SELECT BOARD Minutes of the Meeting of January 15, 2026. The hybrid meeting took place in person at the Meeting Trailer, Room A at 131 Pleasant Street; and, via remote participation using Zoom. Members of the Board present were Dawn E. Hill and Thomas Dixon. Matt Fee, Dr. Malcolm MacNab and Ms. Mohr were absent. A quorum was not met. I. CALL TO ORDER II. ATTEND CAPITAL PROGRAM COMMITTEE REGARDING OUR ISLAND HOME III. ADJOURNMENT Select Board Minutes of the Meeting of January 15, 2026 at 2:00 PM Page 2 of 2 SELECT BOARD JANUARY 15, 2026 – 2:00 PM MEETING TRAILER, ROOM A, 131 PLEASANT STREET AND REMOTE PARTICIPATION VIA ZOOM NANTUCKET, MASSACHUSETTS List of documents used at the meeting: None.
Thu Jan 15, 2026 · 15:00

Quad-Council

Board will review FY27 school budget updates

The NPS Joint School Council will hear updates from each school council on handbooks, improvement plans, and recent events. The council will receive an update on the FY27 budget and discuss the budgeting process. A parent question-and-answer session will follow.

educationbudgetparent-engagementschool-council
10 Surfside Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Committee/Board/s Day, Date, and Time Location / Address Signature of Chair or Authorized Person WARNING: RECEIVED 2026 JAN 13 AM 11:16 MEETING POSTING NANTUCKET TOWN CLERK TOWN OF NANTUCKET Posting Number:T 042 Pursuant to MGL Chapter 30A, § 18-25 ~ y, All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) NPS Joint School Council Meeting 3:00pm Thursday, January 15, 2026 c/o Nantucket Public Schools Nantucket High School 10 Surfside Road NANTUCKET, MA 02554 CPS Cafeteria IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA 1) Updates from each school council since Sept 2025 Meeting: Handbooks. School Improvement Plans, & Events 2) FY27 Budget Updates and process 3) Parent Q&A
Thu Jan 15, 2026 · 16:30

Planning Board

Zoning map amendment to rezone 3 Toombs Court from residential to commercial

The Planning Board will consider several zoning changes, including a citizen‑proposed amendment to move a portion of 3 Toombs Court from the R‑20 residential district to the Commercial Neighborhood (CN) district. The Board will also review multiple board‑proposed map changes affecting properties on Surfside Road, Miacomet Avenue, Sun Island Road, Arrowhead Drive, and Hinsdale Road, as well as amendments to zoning bylaws related to non‑conforming uses, restaurant classifications, and definitions for apartment buildings and community land trusts.

zoningland-useplanning-boardmap-amendmentbylaw-amendment
✓ Decided: Board unanimously approved agenda, minor modifications and several zoning actions

The Planning Board approved its agenda and two minor‑modification requests for Mid Island Service and Island Gas. It continued two citizen‑submitted zoning map articles until February 2 and gave unanimous positive recommendations (50% quantum vote) for multiple zoning map amendments, closing the public hearings on each. All votes were unanimous.

131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATED MEETING POSTING Original Posting: T024 Posted: 1/9/26 at 10:06am MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 01-15-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_A2LEzxfaR7e9g1y9Kp2VFA#/registration To view the meeting only, see link below: https://www.youtube.com/watch?v=yiSbSQRKpS8 Committee/Board/s PLANNING BOARD Day, Date, and Time Thursday, January 15, 2026, at 4:30PM Location / Address HYBRID – 131 PLEASANT STREET, MEETING TRAILER, R [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
*The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Remote Participation), Nat Lowell (Acting-Chair), Joseph Topham, John Kitchener (Remote participation), and Hillary Hedges Rayport (remote participation) Alternates: Stephen Welch (Absent), Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning) (Remote Participation), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (PLUS Administrative Specialist) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_A2LEzxfaR7e9g1y9Kp2VFA#/registration To view the meeting only, see link below: https://www.youtube.com/watch?v=yiSbSQRKpS8 ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ PLANNING BOARD MINUTES - APPROVED THURSDAY, JANUARY 15, 2026 I. Call to order: Acting Chair Lowell called the meeting to order at 4:32pm. Attendance taken by roll call: Board Members: Dave Iverson, Aye (Remote Participation) John Kitchener, Aye (Remote Participation) Hillary Hedges Rayport, Aye (remote participation) Joseph Topham, Aye Acting-Chair Nat Lowell, Aye Alternates: Howard Matz, Aye Abby De Molina, Aye Staff: Leslie Snell, Aye Megan Trudel, Aye William Saad, Aye (Remote Participation) Catherine Ancero, Aye (Remote Participation) II. Approval of the agenda: MOTION/VOTE: Mr. Topham made a motion to approve the agenda. The mo [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026 · 17:00

Parks and Recreation Commission

Commission will discuss a possible Board of Health ban on turf playing fields

The Nantucket Parks and Recreation Commission will approve the agenda, review minutes from the October 16, 2025 meeting, and consider a potential Board of Health ban on turf playing fields. The chair will also give updates on the Nobadeer Project, Tom Nevers debris removal, capital projects, and CPC projects. The commission will discuss the tentative February 26, 2026 meeting date before adjourning.

parksrecreationhealthprojectsmeeting
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Parks and Recreation Commission Day, Date, and Time Thursday, January 15, at 5:00 p.m. Location / Address REMOTE PARTICIPATION ONLY The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW. Signature of Chair or Authorized Person Charlie Polachi, Parks and Recreation Manager AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/81748152269?pwd=C3H128ooMEKPBOotbLGbppDE89pTHW.1 Meeting ID: 817 4815 2269 Passcode: 983395 Nantucket Parks and Recreation Commission Meeting Notice and Agenda Thursday, January 15 2026 Meeting to be held at 5:00 p.m. Remotely Via Zoom. 1. Call to Order 2. Reminder this meeting is being audio and video recorded 4. Approval of Agenda for January 15, 2026 5. Public Comment 6. Approval of Minutes from October 16 2025 2 7. Discussion on Potential Board of Health ban on Turf playing fields 8 Charlie Polachi- Parks and Recreation Manager Report: • Nobadeer Project Update • Tom Nevers Debris Remov [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 15, 2026 · 16:00

Board of Health

Board of Health to review sewer appeals and regulation amendments

The Board of Health will discuss betterment loan requests and a sewer connection appeal. The meeting includes requests for temporary housing and variances for nitrogen loading and health restraints. Two public hearings regarding watershed and wellhead protection regulations will continue.

sewerpublic-healthzoningenvironmental-regulationshousing
✓ Decided: Board approved circus permit at Tom Nevers Field for July 20‑27, 2026

The Board of Health approved a variance allowing the Maria Mitchell Association to host a circus at Tom Nevers Field from July 20 to July 27, 2026, with health inspections and waste‑management conditions. It also released the lien on 12 Shimmo Pond Rd, approved a betterment loan for 18 Washington Ave, and extended the bakery hair‑restraint variance until October. The Board continued discussion of a sewer‑connection variance for 49 Polpis Road and postponed the Woodland Drive nitrogen‑loading credit variance to the February meeting.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, January 15, 2026, 4:00PM Location / Address PSF Community Room, 4 Fairgrounds Road, Nantucket MA,02554 and Remote Participation Via Zoom Webinar. Signature of Chair or Authorized Person ANN SMITH WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! YouTube Link for Viewing Only: https://youtube.com/live/5lzOajcn2gk Zoom Webinar Registration Link to Virtually Attend Meeting: https://us06web.zoom.us/webinar/register/WN_4p6Nv4IGRYG187b4TX10Ew AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon 1. Public announcement – This meeting is being audio and visual recorded 2. Public comment 3. Approval of minutes (November 20, 2025) 4. Director’s Report 5. 12 Shimmo Pond Rd. Betterment Loan Release request 6. 18 Washington Ave 55/553.8- Betterment Loan Request Septic 7. 49 Polpis Road - Appeal of Order to connect to town sewer.(Cont. from October 2025 to allow property [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH January 15, 2026 Adopted February 19,2026 BOARD OF HEALTH ~~ MINUTES ~~ Thursday, January 15, 2025 Meeting PSF Community Room, 4 Fairgrounds Road, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:00 p.m. Staff in attendance: Roque Miramontes, Director of Public Health; Jerico Mele, Deputy Director of Health and Human Service; Andrew Shaper, Environmental Contamination Administrator Remote Staff: Tomeka Gary, Public Health Coordinator; Jake Visco, Public Health Inspector; Sean Reid, Public Health Inspector; Heather Hudson, Public Health Inspector Will Droheiem, Public Health Inspector, Shantaw Bloise-Murphy, Culture and Tourism Members attending: Ann Smith (chair), Meredith Lepore, James Cooper, Thomas Dixon Remote Members: Kerry McKenna Public Participant: Christian Coffin, Joanna Roach, Charity Benz, Dan Mulloy I. PUBLIC ANNOUNCEMENT II. PUBLIC COMMENT Discussion: None provided III. APPROVAL OF MINUTES Discussion Action: Motion to approved December 18, 2025, minutes (Motion by: Lepore) (Seconded by: Cooper) Carried 5-0// Smith, Lepore, McKenna, Cooper, Dixon (Aye) IV. DIECTOR’S REPORT Discussion • Roque Miramontes reported flu cases rose statewide and nationwide starting around December 11 and continued climbing • Hospital sent guidance at end of month about rise in cases and implemented masking and other precautions • Posts on wastewater dashboard s [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 14, 2026 · 17:30

Select Board

Public hearing on the proposed FY 2027 General Fund Budget

The Select Board will hold a public hearing on the proposed FY 2027 General Fund Budget. They will also discuss a PFAS public information session, the Affordable Housing Trust deed‑restriction pilot program, and review requests concerning the Saltmarsh Senior Center expansion and a health department letter on septic regulation impacts to affordable housing.

budgethousingsenior-centerpfaspublic-hearinghealth
✓ Decided: Select Board unanimously endorsed FY 2027 General Fund Budget

The board approved the minutes of the Jan 7 and Jan 8 meetings and the Treasury warrants for Jan 14. It approved the Saltmarsh Senior Center expansion and a revised letter to the Board of Health on septic‑system regulation impacts. The board also unanimously endorsed the FY 2027 General Fund Budget recommendations, including the Somerset Sewer extension article on the warrant.

PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JANUARY 14, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/seMYN6zpJKw ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_ARi4lZ4zTbmUMHnXe7oznw I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town to Host Public Information Session on PFAS The Town Will Host its Third Public Information Session to Share Science-Based Education on PFAS. The Session, “Findings from the Surface Water and Foam Sampling Project,” Will be Held on Thursday, January 22, 2026 at 5:30 PM in the PSF Community Room, 4 Fairgrounds Road, Featuring Dr. Rebecca DeVries from Easter [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 14, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of January 14, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented, with one reordering: Item IX–1 will be taken up after Item X-1. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson reviewed the following announcements: 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Town to Host Public Information Session on PFAS The Town Will Host its Third Public Information Session to Share Science-Based Education on PFAS. The Session, “Findings from the Surface Water and Foam Sampling Project,” Will be Held on Thursday, January 22, 2026 at 5:30 PM in the PSF Community Room, 4 Fairgrounds Road, Featuring Dr. Rebecca DeVries from Eastern Research Group, with Virtual Participation Available Via Zoom and YouTube. Ms. Gibson noted a correction that the information session will be remote only via Zoom. 3. Affordable Housing Trust (AHT) is Seeking Proposals for its Year-Round Deed Restriction Pilot Program: Designed to Provide Housing Stab [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 16:00

Finance Committee

Finance Committee will review and consider adopting the FY2027 county budget

The Nantucket County Finance Committee will meet on Tuesday, Jan 13, 2026 at 4:00 PM to review the FY2027 county budget. Members will discuss the budget and may adopt it during the meeting. The session will be held at 131 Pleasant Street, Trailer Room B, with Zoom participation available.

budgetfinancecounty
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s NANTUCKET COUNTY REVIEW COMMITTEE Day, Date, and Time TUESDAY, JANUARY 13, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM B AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82187920635?pwd=bxN7QcMR4hSWii5xDAWBCnhCTnMNzi.1 Meeting ID: 821 8792 0635 Passcode: 801275 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Review and Discussion of FY2027 County Budget 5. Potential Adoption of FY2027 County Budget 6. Other Business 7. Adjournment
Tue Jan 13, 2026 · 16:00

Finance Committee

Finance Committee to discuss airport fuel fund increase and town warrant articles

The Nantucket Finance Committee will meet on Jan 13, 2026 to review several financial items. The agenda includes a review of an increase to the airport fuel revolver, discussion of a citizen warrant article for an appropriation related to the Surfside Rd four‑way stop, and consideration of warrant articles for the 2026 Annual Town Meeting. The committee will also handle routine items such as agenda approval, public comment, and committee reports.

financeairport-fuelwarrantsannual-town-meeting
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s FINANCE COMMITTEE Day, Date, and Time TUESDAY, JANUARY 13, 2026 @ 4:00 PM Location / Address 131 PLEASANT STREET, TRAILER ROOM B AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/82187920635?pwd=bxN7QcMR4hSWii5xDAWBCnhCTnMNzi.1 Meeting ID: 821 8792 0635 Passcode: 801275 1. Call to Order 2. Audio/Video Announcement 3. Approval of Agenda 4. Public Comment 5. Review and Discussion of Airport Fuel Revolver Increase 6. Discussion, deliberation and potential motions for Citizen Warrant Article E – Appropriation – Surfside Rd 4-Way Stop 7. Discussion, deliberation and potential motions for Warrant Articles for Annual Town Meeting 2026 8. Committee Reports 9. Other Business 10. Date [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 10:00

Coastal Resilience Advisory Committee

Review design for 54 Washington Street to improve coastal resilience

The Coastal Resilience Advisory Committee will meet via Zoom to approve the November 18, 2025 minutes and adopt a template for the Conservation Commission’s application review requests. The committee will then review the design for 54 Washington Street and discuss any changes needed to better promote coastal resiliency and align with the Town’s Coastal Resilience Plan. Additional items include a summary of the Great Harbor Yacht Club’s resiliency plan, updates on several town projects, and discussion of future meeting dates.

coastal-resilienceplanninginfrastructurewaterfrontzoningmeetings
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Coastal Resilience Advisory Committee Day, Date, and Time Tuesday, January 13, 2026, at 10 am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting recording will be available at a later time on the Nantucket Government TV YouTube Channel at https://www.youtube.com/playlist?list=PL49sKqpy7VAiUk-g5h2jIuAn_2jqocI2L Signature of Chair or Authorized Person Peter Brace, Chair Leah Hill, Coastal Resilience Coordinator WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Coastal Resilience Advisory Committee Agenda for Tuesday, January 13, 2026, at 10 am A. Convene in Open Session via Zoom Join Zoom Meeting https://us06web.zoom.us/j/86863383148?pwd=YkE0YUVNMlU1NnpwYTJ6clg4U241QT09 Meeting ID: 868 6338 3148 Passcode: 917271 1. Call to Order 2. Meeting announcements • Script for remotely conducting Open Meetings, read by the Chair • The meeting is being audio / visually recorded 2 3. Public Comment 4. Approval of Minutes November 18, 2025 5. Approve the CRAC template for the Conservation Commission’s Application Review Request- see packet • Exp [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Nantucket Coastal Resilience Advisory Commi6ee (CRAC) Tuesday, January 13, 202 Via Zoom *Mee$ngs are audio- and video-recorded Members present: Gary Beller, Ma7 Fee, Liz Phelps, Peter Brace, Doug Rose, Tim Braine, Sarah Bois, Emily Junkins, Hillary Hedges Rayport Members Absent: Christy Kickham, Joanna Roche Staff present: Leah Hill Scheduled Speakers: Stephen Creese, Art Gasparo Members of the public: RJ Turco7e Recording available here: https://www.youtube.com/watch?v=TZlh8UZ8Zt4&t=584s Packet available here: h7ps://nantucketma.portal.civicclerk.com/event/21902/files/agenda/ 31910 1. Call to order • The mee$ng was called to order by Chair Peter Brace 2. Mee$ng announcements • Script for remotely conduc$ng Open Mee$ngs, read by Chair • The mee$ng is being audio/visually recorded 3. Public comment on topics not on the agenda • No public comments 4. Approval of minutes • Minutes for mee$ng on November 18, 2025 were approved unanimously 5. Approve the CRAC template for the Conserva$on Commission’s Applica$on Review Requests • Peter Brace pointed out the suggested protocol and asked for ques$ons and comments • Discussion included various topics and ques$ons: - Hoping to have a future protocol which would have the ini$al work done by staff to be approved by CRAC - Possibly include a reminder to coordinate with neighbors regarding bulkheads etc. • Approved by vote with an edit including the last comment 6. Per the Conserva$on Commission’s request , review th [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 08:00

Visitor Services Advisory Committee

Visitor Services Advisory Committee to meet remotely

The Visitor Services Advisory Committee will convene remotely on January 13th to approve minutes and receive reports from the Director and Coordinators. The meeting will include a conversation with the Nantucket Island Chamber of Commerce Executive Director.

visitor-servicescommitteezoomminutesreport
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Visitor Services Advisory Committee Day, Date, and Time Tuesday, January 13th at 8:00am Location / Address REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person David Sharpe WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/85275837374?pwd=ZmlCOWNCUmZhZXVQYitGTStjWEJIdz09 Meeting ID: 852 7583 7374 Passcode: 056433 1. Welcome VSAC Members 2. Public Comment 3. Approval of December 9th Minutes 4. Conversation with Peter Burke, Executive Director, Nantucket Island Chamber of Commerce 5. Director’s Report 6. Visitor Services Coordinator’s Report 7. Cultural Affairs and Event Coordinator’s Report
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 MINUTES TEMPLATE COMMITTEE: Visitor Services Advisory Committee Time Meeting called to Order: 8:02am MEETING DATE: January 13, 2026 Time Meeting Adjourned: 8:54am MEMBERS PRESENT via ZOOM: Mary Malavase, Chair, Matt Peel, Vice Chair, Garison Beale, Liz Holland, Peter Morrison and Niles Parker MEMBERS ABSENT: None STAFF PRESENT via ZOOM: Shantaw Bloise-Murphy, Director of Culture & Tourism and David Sharpe, Visitor Services Coordinator, Deana Weatherly, Cultural Affairs and Special Events Coordinator GUESTS PRESENT: Peter Burke, Executive Director, Nantucket Island Chamber of Commerce AGENDA ITEM DISCUSSION VOTES / ROLL CALL 1 Welcome VSAC Members David welcomed the committee members to the meeting and took the roll call of members and staff. 2 Approval of Minutes The December 9 meeting minutes were approved 5-0. Chair Malavase abstained citing her absence from that meeting. 3 Conversation with Peter Burke, Executive Director, Nantucket Island Chamber of Commerce Peter recapped Christmas Stroll Weekend, December 7-9. Visitor numbers were approximately the same as last year, measured by Placer AI and other indicators. Thursday saw an unexpected uptick in attendance, possibly due to weather forecasts or pent-up demand from the previous year’s blackout. Regarding National Grid, he noted improved coordination following last year’s power outage, increased visibility and preparedness despite actual issue last year being an underground cable. The [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 12:00

Affordable Housing Trust

Committee to evaluate Year-Round Deed Restriction Pilot Program proposals

The Evaluation Committee for the Year-Round Deed Restriction Pilot Program will review specific proposals. The committee will then make recommendations to the Affordable Housing Trust.

affordable-housingdeed-restrictionhousing-pilot-program
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Evaluation Committee for the Year-Round Deed Restriction Pilot Program Day, Date, and Time Tuesday, January 13, 2026, at 12:00 PM Location / Address REMOTE PARTICIPATION via ZOOM (See Below) The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Kristie Ferrantella Municipal Housing Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, JANUARY 13, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://zoom.us/j/95061808495?pwd=h6oJSyTw96kT21Lj396Y4JAJa45HKv.1 Meeting ID: 950 6180 8495 Passcode: 5MeZ78 I. CALL TO ORDER, ROLL CALL II. ANNOUNCEMENTS 1. This meeting of the Evaluation Committee for the Year-Round Deed Restriction Pilot Program is Being Audio and Video Recorded. III. APPROVAL OF AGENDA IV. PUBLIC COMMENT* V. EVALUATION O F DEED RESTRI [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
NANTUCKET AFFORDABLE HOUSING TRUST YEAR-ROUND DEED RESTRICTION PILOT PROGRAM EVALUATION COMMITTEE MEETING MINUTES Tuesday, January 13, 2026 Remote Meeting via Zoom – 12:00 PM Attending Members remotely: Kristie Ferrantella, Penny Dey, Tracy MacDonald Staff in Attendance remotely: Dylan Metsch -Ampel (Deputy Housing Director), Ci ndy Hsu (Procurement), Caroline Ferguson (Administrative Specialist) Speakers in Attendance: I. CALL TO ORDER, ROLL CALL The meeting was called to order at 12:02 PM. Roll call of those participating: Penny Dey – Aye 1. Tracy MacDonald – Aye 2. Kristie Ferrantella – Aye 3. Cindy Hsu – Aye II. ANNOUNCMENTS Kristie Ferrantella made the following announcement: 1. This meeting of the Evaluation Committ ee for the Year -Round Deed Restriction Pilot Program is being Audio and Video Recorded. III. APPROVAL OF AGENDA Penny Dey made a MOTION to approve the agenda. Tracy MacDonald seconded the motion. Roll call of those participating: 1. Penny Dey – Aye 2. Tracy MacDonald – Aye 3. Kristie Ferrantella – Aye IV. PUBLIC COMMENT There was no public comment. V. EVALUTATION OF DEED RESTRICTION PILOT PROGRAM PROPOSALS FOR THE FOLLOWING: a) James Ranney 2 Year-Round Deed Restriction Pilot Program Evaluation Committee January 13, 2026, at 12:00 PM Kristie Ferrantella asked the committee for their evaluations on the following: 1. Existing structures • Tracy MacDonald – Highly Advantageous • Penny Dey – Highly Advantageous • Kristie [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 16:00

Historic District Commission

Historic District Commission to review property alterations and new construction

The Historic District Commission will discuss and vote on various property modifications, including roof changes and solar installations. The body will also consider changing Old Business meeting hours and the appointing authority for a member of the Nantucket Planning & Economic Development Commission.

historic-preservationzoningconstructionsolargovernment-administration
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
Updated Meeting Posting MEETING POSTING Original Posting Time: 2026 JAN 09 AM 10:17 Original Posting Number: T 025 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – Old Business Day, Date, and Time Tuesday, January 13, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair Webinar Registration - Zoom To watch live feed, click here: Nantucket Historic District Commission - January 13, 2026 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnso, Sara Johnson To view HDC Meeting View Packs, click here. ***HDC related comments and/or concerns can be sent to: hdcpubliccomment@nantucket -ma.gov. **Comments are due by 8:0 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC Minutes January 13, 2026; adopted February 3, 2026 HISTORIC DISTRICT COMISSION Minutes January 13, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice- Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Fiona Johnson Holly Backus left the meeting at 4:38 pm In person Welch, Pohl, Oliver, Camp, MacLeod and Patten Remote: Thornewill and Paul Early departures: Oliver left at 5:30pm; attended remotely at 5:40pm Meeting called to order at 4:03pm by Stephen Welch Board: Welch, Pohl, Oliver, MacLeod, Camp Pohl made the motion to approve the agenda Motion carries unanimously I. COMMISSIONER DISCUSSION AND/OR VOTE • Change to Old Business Meeting hours; 4pm – 7pm effective next Old Business meeting- January 27, 2026. • Proposal of the Certified Local Government (CLG) being the appointing authority of an Historic Preservation sector member to the Nantucket Planning & Economic Development Commission (NP&EDC), votes may be taken. Leslie Snell, Planning Director presented an initiative to add a historic preservation seat to the Nantucket Planning and Economic Development Commission (NPDEC). Motion: The Nantucket Historic District Commission supports the Nantucket Planning & Economic Development Commission’s initiative to have the Certified Local Government (CLG) appoint a [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 17:00

Airport Commission, Nantucket Memorial

Public hearing on proposed revisions to airport rates and charges

The Nantucket Memorial Airport Commission will review and approve the agenda, the December 9, 2025 draft minutes, and the December 17, 2025 and January 7, 2026 warrants. A public hearing will consider proposed changes to the airport’s rates and charges. The commission will also discuss pending leases and contracts listed in Exhibit 1, and receive updates on the PFAS investigation, the crew quarters project, and the terminal optimization project.

airportratesleasescontractspfasprojectspublic-hearing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Memorial Airport Commission Day, Date, and Time Tuesday, January 13, 2026 at 5:00 PM Location / Address HYBRID 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM WEBINAR https://us06web.zoom.us/webinar/register/WN_4Gk0Hn-ZT6eOF4IKes8Czw Signature of Chair or Authorized Person Warren Smith, Airport Manager WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_4Gk0Hn-ZT6eOF4IKes8Czw To view the meeting only, see link below: https://youtube.com/live/bo2cVXljSV8 1. Announcements: a. Chair Reviews Virtual Meeting Statement b. This Meeting is Being Both Audio & Video Recorded 2. Review and Approve: a. Agenda b. 12/09/25 Draft Minutes c. Ratify 12/17/25 and 01/07/26 Warrants 3. Public Comment 4. 011326-01 Public Hearing to Consider Proposed Revisions to Airport’s Rates and Charges 5. Pending Leases/Contracts as Set Forth on Exhibit 1, which Exhibit is Here [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Town of Nantucket NANTUCKET MEMORIAL AIRPORT 14 Airport Road Nantucket Island, Massachusetts 02554 Warren Smith, Airport Manager Commissioners Phone: (508) 325-5300 Arthur D. Gasbarro, Chairman Fax: (508) 325-5306 Andrea N. Planzer, Vice Chair Anthony G. Bouscaren Philip Marks III Michael Leavitt AIRPORT COMMISSION MEETING January 13, 2026 The meeting was called to order at 5:0 0 PM by Chairman Arthur Gasbarro with the following Commissioners present: Andrea Planzer, Anthony Bouscaren, and Michael Leavitt. This meeting took place at 131 Pleasant Street, Nantucket , MA, and was conducted via Zoom Webinar and broadcast live on the Town of Nantucket YouTube channel. Airport employees present were: Warren Smith, Airport Manager; Preston Harimon, Airport Assistant Manager; Mariya Basheva, Finance Manager; Vilina R. Ilieva, Office Manager; Elizabeth Reuss, Administrative Assistant; and Madison Collins, Environmental Coordinator. Also present: Rich Lasdin, McFarland-Johnson Mr. Gasbarro read the Town’s virtual meeting statement. Mr. Gasbarro announced the meeting was being audio and video recorded. Mr. Gasbarro asked for comments on the Agenda; hearing none, the Agenda was adopted. Mr. Gasbarro asked for comments and concerns on the 12/09/25 Draft minutes; hearing none, the Draft Minutes were adopted by unanimous consent. Mr. Bouscaren made a Motion to ratify the 12/17/25 and 01/07/26 Warrants. Second by Mr. Leavitt and Passed by the following ro [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 13, 2026 · 16:00

Nantucket Islands Land Bank Commission

Commission discusses policy on corporate ownership transfers

The Nantucket Islands Land Bank Commission will review a policy discussion regarding transfers of corporate ownership, consider cash disbursement warrants, and evaluate several property management items such as the Field of Dreams collaboration and a draft parking plan for 41 Jefferson Avenue. The meeting also includes updates on agricultural management, long‑range objectives, and monthly transfer statistics.

land-bankproperty-managementcorporate-ownershipfinanceagricultural-management
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Islands Land Bank Commission Day, Date, and Time Tuesday, January 13, 2026, at 4:00 p.m. Location / Address Land Bank Conference Room, 22 Broad St, Nantucket, MA 02554 Plus, Remote Participation via ZOOM*; the meeting will be aired at a later time on the Town’s Government TV YouTube Channel Signature of Chair or Authorized Person Susan C. Campese, Director of Finance & Administration WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA https://us06web.zoom.us/j/81960267177?pwd=MsZ9uXdW2zOkSe6bbIq4V0Gj7ebfAc.1 Webinar ID: 819 6026 7177 Passcode: 198559   Meeting Packets will be posted online: https://www.nantucketlandbank.org/about/agendas/ CALL TO ORDER: 4:00 P.M. A. CONVENE IN OPEN SESSION 1. COMMISSION ACCEPTANCE OF AGENDA 2. PUBLIC COMMENT / STAFF ANNOUNCEMENTS 3. AGRICULTURAL MANAGEMENT a. 19 Boynton Lane/Venison Processing Unit – Deer Donation Update 4. PROPERTY MANAGEMENT a. Field of Dreams/7 & 9 W. Sankaty Road and 31C & 31B New Street – Collaboration Discussion b. 1 Hallowell Lane – Discussion c. 41 Jefferson Avenue – Dune Sys [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026 · 16:00

Planning Board

Planning Board to review dwelling permits and zoning amendments

The Planning Board will discuss dwelling permits, plan approvals, and various zoning map and bylaw amendments. Several public hearings on zoning articles have been continued to future dates.

zoninghousingland-usepublic-hearings
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
UPDATE MEETING POSTING #1: Date: January 8, 2026 Time: 10:12AM Posting Number: T019 MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 01-12-2026 (Subject to change) Please list below the topics the chair anticipates will be discussed at the meeting. *The complete text, plans, application, or other material relative to each agenda item are available for inspection digitally. Email requests may be sent to [email protected] and/or [email protected]* Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_rtLjq4LbTriej7mL1PU5Jw#/registration To view the meeting only, see link below: https://www.youtube.com/watch?v=iEgYjomyih4 Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, January 12, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
PLANNING BOARD UPDATED APPROVED MINUTES OF 01-12-2026 *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair) (remote participation), Nat Lowell (Acting Chair), Joseph Topham (ABSENT), John Kitchener (ABSENT), and Hillary Hedges Rayport Alternates: Stephen Welch (remote participation), Abby De Molina (remote participation), and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (PLUS Administrative Specialist) ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ Link to YouTube: https://www.youtube.com/watch?v=iEgYjomyih4 Link to packet: https://portal.laserfiche.com/Portal/Browse.aspx?id=346177&repo=r-ec7bdbfe I. Call to order: Acting Chair Lowell called the meeting to order at 4:00pm. Attendance taken by roll call: Board Members: Dave Iverson, Aye (remote participation) Hillary Hedges Rayport, Aye Acting-Chair Nat Lowell, Aye Alternates: Stephen Welch, Aye (remote participation) Abby De Molina, Aye (remote participation) Howard Matz, Aye Staff: Megan Trudel, Aye Catherine Ancero, Aye William Saad, Aye Leslie Snell, Aye A quorum was present. Acting Chair Lowell read a prepared statement in accordance with Governor Baker’s March 21, 2020, order regarding open meeting law, which outlines how the meeting is conducted via remote participation and states the ground rules for any di [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026 · 16:30

Select Board

Select Board to hold Sewer Master Plan workshop

The Select Board is meeting to conduct a workshop regarding the Sewer Master Plan. No other substantive items are listed on the agenda.

sewerinfrastructureplanning
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time MONDAY, JANUARY 12, 2026, 4:30 PM Location / Address MEETING TRAILER, ROOM A, 131 PLEASANT STREET AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/mzKNkN0SSpU ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_Yn0VXTF8QFiYoa9nt5VjBA I. CALL TO ORDER II. SEWER MASTER PLAN WORKSHOP III. ADJOURNMENT
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 12, 2026 at 4:30 PM Page 1 of 2 SELECT BOARD Minutes of the Meeting of January 12, 2026. The meeting took place in person at the Meeting Trailer at 131 Pleasant Street. Members present were Dawn E. Hill, Tom Dixon, Brooke Mohr and Matt Fee. Dr. Malcolm MacNab was present remotely. Also present were Town Manager C. Elizabeth Gibson; Deputy Town Manager Gregg Tivnan; Operations Administrator Erika Mooney; Sewer Director David Gray, Finance Director Brian Turbitt; Dan Sheahan, Kent Nichols, Ryan Henley and Anna Wojcik from Weston & Sampson. Present remotely was Mark Willett, Water Director; Andrew Patnode, Public Works Director; Kevin Manuel, Town Project Manager. I. CALL TO ORDER Chair Hill called the meeting to order at 4:30 PM. II. SEWER MASTER PLAN WORKSHOP Ms. Gibson introduced the item. Mr. Sheahan introduced the Weston & Sampson (W&S) team members. He and Ms. Wojcik reviewed the presentation in the Board’s agenda packet. Discussion occurred regarding capacity of the Surfside Wastewater Treatment Facility (WWTF) with respect to Needs Areas and other areas; funding and financing, including the Cape & Islands Water Protection Fund (CCIWPF). Mr. Nichols reviewed analysis as to whether or not it would be beneficial for the Town to join the CCIWPF and explained the information seems to indicate it would not be recommended, currently. Discussion followed as to sewering Madaket and what changes have occurred [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 12, 2026 · 10:00

General

Ad Hoc Budget Workgroup to discuss FY2027 school budgets

The Ad Hoc Budget Workgroup is meeting to discuss the FY2027 School and Community School budgets. The group will review a request for a one-time expense increase and the Special Education Reserve Fund.

budgetschoolsspecial-education
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s AD HOC BUDGET WORKGROUP Day, Date, and Time MONDAY, JANUARY 12, 2025 @ 10:00 AM Location / Address 131 PLEASANT STREET, TRAILER ROOM A AND REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person STEVEN HUNTER WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Join Zoom Meeting https://us06web.zoom.us/j/88127755202?pwd=bccWKNYaVTZUMnh780Kjn2QibhjTIK.1 Meeting ID: 881 2775 5202 Passcode: 398501 1. Call to Order, Roll Call 2. Audio/Video Announcement 3. Approval of Agenda 4. FY2027 School and Community School Budget Discussion a. FY2027 School One Time Expense Increase Request Discussion b. Special Education Reserve Fund Discussion 5. Other Business 6. Adjournment
Mon Jan 12, 2026 · 16:00

Nantucket Cultural Council

Nantucket Cultural Council to discuss grant cycle business

The Nantucket Cultural Council will meet to approve previous meeting minutes and conduct business regarding the grant cycle. The meeting includes a period for public comment.

artsculturegrants
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
JOIN ZOOM MEETING https://us06web.zoom.us/j/81736441523?pwd=MhAnhdIFjPx2QQSBkoJwRmeRG1dhZV.1 Meeting ID: 817 3644 1523 Passcode: 216717 AGENDA 1. Welcome Nantucket Cultural Council Members 2. Agenda Protocol 3. Approval of November 10, 2025 Minutes 4. Public Comment 5. Grant Cycle Business 6. Other Business 7. Next Meeting February 9, 2026 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Cultural Council Day, Date, and Time Monday, January 12, 2026 at 4:00pm Location / Address OR REMOTE PARTICIPATION VIA ZOOM Signature of Chair or Authorized Person Deana Weatherly WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD!
Fri Jan 9, 2026 · 11:00

Washington Street Collaborative Work Group

Washington Street Collaborative Work Group meeting cancelled

The meeting scheduled for January 9, 2026, has been cancelled.

washington-street-collaborativenantucket
22 Broad Street, Land Bank Conference Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date __ Original Posting Number __ TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Washington Street Collaborative Workgroup Day, Date, and Time Friday, January 9, 2026 at 11:00 a.m. Location / Address Land Bank Conference Room, 22 Broad Street, Nantucket, MA Or Zoom https://us06web.zoom.us/j/82209999469?pwd=7ziqFM1tcY0vIEFKMblhKOF3xcRGPp.1 Meeting ID: 822 0999 9469 Passcode: 394349 Signature of Chair or Authorized Person Leah Hill, Coastal Resilience Coordinator THIS MEETING HAS BEEN CANCELLED
Thu Jan 8, 2026 · 14:00

Capital Program Committee

Capital Program Committee meeting cancelled

The Capital Program Committee meeting scheduled for January 8, 2026, has been cancelled.

proceduralcapital-program
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 CANCELLED MEETING POSTING Original Posting Date January 6, 2026_Original Posting Number T 012 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Capital Program Committee Day, Date, and Time Thursday January 8, 2026 @ 2:00 PM Location / Address IN-PERSON PARTICIPATION at 131 Pleasant Street (Room A) REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC- sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Susan M. Carmel THIS MEETING HAS BEEN CANCELLED
Thu Jan 8, 2026 · 09:00

Select Board

Select Board to discuss real estate and litigation strategy

The Select Board and County Commissioners will meet to consider the purchase, exchange, lease, or value of several properties. The board will also discuss legal strategy regarding a challenge to Article 1 from the November 4, 2025 Special Town Meeting.

real-estatelitigationtown-meetingexecutive-session
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD/COUNTY COMMISSIONERS Day, Date, and Time THURSDAY, JANUARY 8, 2026 AT 9:00 AM Location / Address MEETING TRAILER, ROOM A 131 PLEASANT STREET Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting I. CONVENE IN OPEN SESSION II. EXECUTIVE SESSION, PURSUANT TO MGL C. 30A § 21(A) 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of December 4, 2025. 2. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property Regarding 131/135 Pleasant Street, 47 Sparks Avenue, 51 Sparks Avenue and 109 Pleasant Street, where an Open Meeting May have a Detrimental Effect on the Negotiating Position of the Select Board/County Commissioners and the Chair so Declares; Votes May Be Taken. 3. Purpose 3: To Discuss Strategy with Respect to Litigation – Challenge to Article 1 Voted at the November 4, 2 [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 8, 2026 Page 1 of 2 SELECT BOARD/COUNTY COMMISSIONERS Minutes of the meeting of January 8, 2026. The meeting was scheduled to be held in Room A of the Meeting Trailer, 131 Pleasant Street, Nantucket but due to a facilities issue, all Select Board members participated remotely. Select Board Members present remotely were Dawn E. Hill, Tom Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. Deputy Town Manager Gregg Tivnan and Operations Administrator Erika Mooney were present in person. Deputy Town Manager Rick Sears and Attorney John Giorgio of Town Counsel’s office were present remotely. I. CONVENE IN OPEN SESSION Chair Hill called the meeting to order at 9:02 AM. Mr. Dixon moved to adjourn to executive session pursuant to MGL C. 30A § 21(A), not to return to open session for the purposes of: 1. Purpose 7: To Comply with, or Act Under the Authority of, Any General or Special Law (Open Meeting Law, G.L. c. 30A, §§ 18-23) to Approve Executive Session Minutes of December 4, 2025. 2. Purpose 6: To Consider the Purchase, Exchange, Lease, or Value of Real Property Regarding 131/135 Pleasant Street, 47 Sparks Avenue, 51 Sparks Avenue and 109 Pleasant Street, where an Open Meeting May have a Detrimental Effect on the Negotiating Position of the Select Board/County Commissioners and the Chair so Declares; Votes May Be Taken. 3. Purpose 3: To Discuss Strategy with Respect to Litigation – Challenge to Artic [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026 · 15:00

Nantucket Public School Committee

School Committee subcommittee holds collective bargaining with teachers

The Nantucket School Committee Negotiation Subcommittee met in executive session on Jan. 8, 2026. The session was called to conduct a collective bargaining discussion with the Nantucket Teachers Association. No other agenda items were listed.

educationlaborcollective-bargainingschool-committee
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee, Negotiation Subcommittee Meeting - Executive Session Day, Date, and Time Thursday, January 8, 2026, 3:00 PM Location / Address REMOTE PARTICIPATION VIA ZOOM https://us06web.zoom.us/j/89207768873 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA I. Call to Order II. Welcome and approval of agenda The Committee will adjourn to Executive Session III. Meeting in executive session pursuant to Massachusetts General Laws chapter 30A, section 21(a) for the following purpose: a. Purpose (2) to conduct a collective bargaining session with the Nantucket Teachers Association IX. Adjournment 1
Thu Jan 8, 2026 · 08:00

Nantucket Water Commissioners

Nantucket Water Commissioners to review reports and contracts

The Nantucket Water Commissioners will hold a regular meeting to review water quality reports, personnel and vendor contracts, and calendar year totals. The meeting is scheduled for January 8, 2026, at 8:00 AM at 1 Milestone Road.

watercommissionreportcontractminutes
1 Milestone Road
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Water Commissioners Day, Date, and Time Thursday, January 8, 2026 at 8:00 AM Location / Address 1 Milestone Road, Nantucket, MA Signature of Chair or Authorized Person Linda M. Roberts WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! Nantucket Water Commission Regular Meeting – in person at the Water Company conference room 1 Milestone Road, Nantucket, MA 02554 Thursday, January 8, 2026, at 8:00 AM 1. Call Meeting to Order 2. Acceptance of Agenda 3. Public Comment 4. Review of Minutes from the December 11, 2025 meeting. 5. Production, Billing and Rainfall Reports 6. Director’s review and updates: a. Water Quality b. Oak Hollow c. Calendar Year End Totals 7. Discussion, amendment and execution of any personnel or vendor contracts 8. Commissioner’s Comments and Reserved for Unforeseen Items for Discussion not anticipated by the chair. Adjournment: Next Regular Commission meeting Thursday, February 12, 2026 at 8 AM
Thu Jan 8, 2026 · 16:00

Board of Health

Board will discuss health board educational training and make a public announcement

The Nantucket Board of Health will announce that the meeting is being audio and visual recorded, receive an educational training presentation from the Massachusetts Association of Health Boards, and then adjourn.

healtheducationboardmeeting
REMOTE PARTICIPATION VIA ZOOM WEBINAR
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
APDATED MEETING POSTING Original Posting Date 2026 JAN 05 PM 02:21 Original Posting Number T 0 l0 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, $ 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk's Office and posted at least 48 hours prior to the meeting Committee/Board/s Nantucket Board of Health Day, Date, and Time Thursday, January 8,2026,4:00 PM Location / Address l3l Pleasant St, Nantucket, MA 02554 Trailer Room B o Remote YiaZoom Webinar Signature of Chair or Authorized Person ANN SMITH UPDATED AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Zoom Webinar Registration Link to Virtually Affend Meeting: AGENDA: Please list below the topics the chair reasonably anticipates will be discussed at the meeting Commissioners: Ann Smith (Chair), Meredith Lepore (Vice-Chair), James Cooper, Kerry McKenna, Thomas M. Dixon l. 2. J. Public announcement - This meeting is being audio and visual recorded Massachusetts Association of Health Boards Educational Training for Board of Health Adjournment 1
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes – BOH January 8, 2026 Adopted February 19,2026 BOARD OF HEALTH ~~ MINUTES ~~ Thursday, January 8, 2025 Meeting 131 Pleasant St Trailer Room B, Nantucket MA, 02554 This meeting was held via remote participation using ZOOM and YouTube. Called to order at 4:00 p.m. Staff in attendance: Jerico Mele, Deputy Director of Health and Human Service; Remote Staff: John Hedden, Chief Environmental Health Officer; Tomeka Gary, Public Health Coordinator; Heather Hudson, Public Health Inspector, Will Droheiem, Public Health Inspector Members attending: Ann Smith (chair), Meredith Lepore, James Cooper, Thomas Dixon Remote Members: Kerry McKenna Public Participant: Cheryl Sbarra, Esq., Executive Director and Senior Staff Attorney for MHAB; Michael R. Hugo, J.D, Director of Strategies and Government Relations for MHAB I. PUBLIC ANNOUNCEMENT II. MASSACHUSETTS ASSOCIATION OF HEALTH BOARDS EDUCATIONAL TRAINING FOR BOARD OF HEALTH Discussion: Legal authority of boards of health • Massachusetts Supreme Judicial Court held that board of health regulations stand on the same footing as state statutes, local ordinances, and bylaws • Courts make all rational presumptions in favor of validity of board regulations and only strike them down when someone proves absence of any conceivable ground for upholding them • Courts won't substitute their judgment for the board's judgment or weigh evidence —only overturn decisions if clearly arbitrary or capricious • Cheryl e [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026 · 13:00

Zoning Board of Appeals

ZBA to consider a stay request for a July 2025 violation at 9 Hinsdale Road

The Zoning Board of Appeals will hold its regular meeting to approve the agenda, minutes, and receive public comments. New business includes an appeal for a stay of a July 2025 violation order at 9 Hinsdale Road and several special permit requests for property alterations. Old business includes a variance request to remove a shed and relocate a cottage at 18 Madequecham Valley Road. The board will also schedule its next meeting for February 12, 2026.

zoningpermitsvarianceappealshearings
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING ORIGINAL POSTING T 002 JANUARY 02, 2026 PM 1:26 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Zoning Board of Appeals Day, Date, and Time Thursday, January 08, 2026, at 1:00 PM Location / Address 4 Fairgrounds Road, Nantucket, MA 02554 PSF COMMUNITY ROOM & REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person Nicky Sheriff, Land Use Specialist WARNING: IF THERE IS NOT A QUORUM OF MEMBERS OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW, NO DELIBERATIONS MAY TAKE PLACE-BUT THE MEMBERS MAY APPEAR AND ANNOUNCE A NEW SCHEDULE. AGENDA (Subject to Change) The meeting will be recorded and archived at www.nantucket-ma.gov. ZOOM WEBINAR REGISTRATION LINK: https://us06web.zoom.us/webinar/register/WN_CfRoiroLST-b8eEB0bS0VA To view the LIVE broadcast of the meeting, see YouTube Link at https://youtube.com/live/NZ-WevBhoUE BELOW ARE THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. CALL TO ORDER: II. APPROVAL OF THE AGENDA: III. PUBLIC COMMENT for items not listed on the agenda: IV. APPROVAL OF MINUTES: 2 • December 11, 2025 V. NEW BUSINESS (INITIAL PUBLIC HEARINGS AND VOTES MA [Excerpt truncated on this listing page; use the official record for the full text.]
Thu Jan 8, 2026 · 17:00

Conservation Commission

Conservation Commission to hold public hearings on 11 project intents

The Nantucket Conservation Commission will conduct public hearings for Notices of Intent regarding projects that do or do not require waivers. The body will also review Orders of Conditions and a Request for Determination of Applicability for the Town of Nantucket.

conservationpublic-hearingland-useenvironmental-permits
PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 UPDATED MEETING POSTING Original Posting Date: 2025 DEC 22 PM 02:41 Original Posting Number: T 1039 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Conservation Commission Day, Date, and Time Thursday, January 8, 2026, at 5PM Location / Address The meeting will be held in hybrid format. In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees YouTube Link: https://youtube.com/live/i1EG5Xr1Ong Zoom Registration: https://us06web.zoom.us/webinar/register/WN_m93JJv7kQGODeA1HX4Dtug Signature of Chair or Authorized Person Jeff Carlson, Natural Resources Director William Dell’Erba, Conservation Agent WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NANTUCKET CONSERVATION COMMISSION Meeting Notice/Agenda for January 8, 2026, 5:00 P.M. The meeting will be held in hybrid format. In-person participation located in the PSF Community Room, 4 Fairgrounds Road Remote participation via Zoom Webinar (Register at link below) Informa [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Conservation Commission Minutes January 8, 2026, adopted January 22, 2026 CONSERVATION COMMISSION MINUTES 131 Pleasant Street Nantucket, Massachusetts 02554 www.nantucket-ma.gov Thursday, January 8, 2026 – 5:00 p.m. This meeting was held via remote participation using ZOOM and YouTube: https://youtube.com/live/i1EG5Xr1Ong Commissioners: Seth Engelbourg (Chair), Linda Williams (Vice Chair), Tim Braine, Mike Misurelli, Joe Plandowski, John Schafer, and RJ Turcotte Called to order at 5:00 p.m. by Chair Engelbourg Staff in attendance: Will Dell’Erba, Conservation Agent Attending Members: Engelbourg, Braine, Plandowski, Schafer, and Turcotte; Williams at 5:18pm Absent Members: - Misurelli Members Left Early: I. Call To Order II. Acceptance of the Agenda Discussion: (00:02:13) Engelbourg notes the continuances Motion: Motion to accept the agenda (Made by: Plandowski) (Seconded by: Braine) Vote: Vote Carried: 5:0 Engelbourg, Braine, Plandowski, Schafer, and Turcotte (aye) III. Announcements Discussion: (00:04:01) Engelbourg announced that the meeting is being audio and video recorded. IV. Update on Public Comment Questions from Prior Meetings Discussion: (00:04:24) Engelbourg - Noted for the record that the Natural Resources staff answered some questions from D Ann Atherton via email, which will be on record for this meeting. V. Public Comment Chair Engelbourg called for public comment Discussion: (00:04:56) none VI. Public Hearing [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 7, 2026 · 15:00

Council on Aging

Council on Aging to discuss elderly services and hear fire prevention update

The Council on Aging will meet to conduct official business, including a guest speaker from the Nantucket Fire Department, and address other matters. The meeting is hybrid, taking place at the trailer adjacent to the Old Fire Station and via Zoom.

council-on-agingelderly-servicesfire-preventionhybrid-meetingpublic-hearing
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s COUNCIL ON AGING MEETING Day, Date, and Time WEDNESDAY, January 7, 2026, 3:00 P.M. Location / Address TRAILER ADJACENT TO OLD FIRE STATION, 131 PLEASANT STREET (ROOM A) & REMOTE PARTICIPATION VIA ZOOM The meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person ROBERT M KUCHARAVY, CHAIR WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting. This is a hybrid meeting. To join via Zoom: https://zoom.us/j/98426990629?pwd=SGRCeGFhYkxQck41Yk5mdFExci8zUT09 Meeting ID: 984 2699 0629 Passcode: 051117 I. Call to order II. Establish quorum III. Approval of agenda IV. Official business 1. Guest speaker: Captain Chris Holland, Fire Prevention, Nantucket Fire Department V. Other business* 2 VI. Adjournment *For topics not reasonably anticipated 48 hours in advance of the meeting COA Mission ● Identify the total needs of the [Excerpt truncated on this listing page; use the official record for the full text.]
Wed Jan 7, 2026 · 17:30

Select Board

Select Board to hold public hearing on FY 2027 General Fund Budget on Jan 14

The Nantucket Select Board meeting on Jan 7, 2026 will discuss several items, including announcements and contract approvals. It will announce a public hearing on the proposed FY 2027 General Fund Budget to be held on Jan 14, 2026 at 5:30 PM in the Public Safety Facility Community Room, 4 Fairgrounds Road, with Zoom participation. The board will provide updates on the Affordable Housing Trust’s Year‑Round Deed Restriction Pilot Program and the addition of 64 rental units in Ticcoma Green to the town’s subsidized housing inventory. It will also approve pending contracts and grant agreements, and accept gifts/donations from various departments.

housingbudgetcontractspublic-hearingaffordable-housingdonations
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s SELECT BOARD Day, Date, and Time WEDNESDAY, JANUARY 7, 2026 AT 5:30 PM Location / Address PSF COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICIPATION VIA ZOOM WEBINAR Signature of Chair or Authorized Person ERIKA MOONEY WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting YOU TUBE LINK FOR VIEWING ONLY: https://youtube.com/live/bbc3cz61R9A ZOOM WEBINAR REGISTRATION LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/webinar/register/WN_D73NFSRnSKuVK3W6HR1VZA I. CALL TO ORDER II. SELECT BOARD ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. The Select Board Meeting is Being Audio and Video Recorded. 2. Legislative Updates with Nantucket Delegation: Senator Cyr and Representative Moakley. 3. Affordable Housing Trust (AHT) is Seeking Proposals for its Year-Round Deed Restriction Pilot Program: - Designed to Provide Housing Stability, Security and Affordability for Those Living and Working on Nantucket - Offers a Financial Incentive to Nantucket Property Own [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Select Board Minutes of the Meeting of January 7, 2026 at 5:30 PM Page 1 of 5 SELECT BOARD Minutes of the meeting of January 7, 2026. The hybrid meeting took place in person at the Public Safety Facility Community Room at 4 Fairgrounds Road; and, via remote participation using Zoom Webinar. Members of the Board present were Dawn E. Hill, Thomas Dixon, Matt Fee, Dr. Malcolm MacNab and Brooke Mohr. I. CALL TO ORDER Chair Hill called the meeting to order at 5:30 PM following the Pledge of Allegiance. II. SELECT BOARD ACCEPTANCE OF AGENDA The agenda was accepted as presented. III. ANNOUNCEMENTS Town Manager C. Elizabeth Gibson, participating remotely, reviewed some of the announcements and asked that Announcement #2 be moved to the end of Announcements because it is more of an update than an Announcement. 1. The Select Board Meeting is Being Audio and Video Recorded. 3. Affordable Housing Trust (AHT) is Seeking Proposals for its Year-Round Deed Restriction Pilot Program: - Designed to Provide Housing Stability, Security and Affordability for Those Living and Working on Nantucket - Offers a Financial Incentive to Nantucket Property Owners to Place a Permanent Deed Restriction on Their Homes to Limit Sale or Rental to Year-Round Nantucket Residents - Deadline to Submit Questions is January 9, 2026 at 2:00 PM. - Deadline to Submit Applications is January 28, 2026 with Awards Announced on February 27, 2026 - Visit https://nantucket-ma.gov/184/Affordab [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026 · 12:30

Affordable Housing Trust

AHT will approve grant and loan documents for the Sparks Avenue affordable housing project

The Affordable Housing Trust will consider and vote on a memorandum of understanding, grant and loan agreement, promissory note, and mortgage and security agreement for the Sparks Avenue affordable housing project at 18‑26 Sparks Avenue. The meeting also includes updates on the Year‑Round Deed Restriction Pilot Program, the addition of 64 rental units at Ticcoma Green to the State Housing Inventory, and several individual mortgage modification cases under the Closing Cost Assistance Program. Minutes from two prior meetings will be approved, and the board will set dates for future meetings.

affordable-housinggrant-loanhousing-inventorydeed-restrictionmortgage-modificationexecutive-session
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
- 1 - MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Affordable Housing Trust Day, Date, and Time Tuesday, January 6, 2026, at 12:30 PM Location / Address Trailer Meeting Room A, 131 Pleasant Street, Nantucket, MA 02554 and REMOTE PARTICIPATION via ZOOM (See Below) Signature of Chair or Authorized Person Dylan Metsch-Ampel Deputy Housing Director WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF THE MEETING POSTING IS NOT IN COMPLIANCE WITH THE OPEN MEETING LAW STATUTE, NO MEETING MAY BE HELD! AGENDA FOR TUESDAY, JANUARY 6, 2026 YOU TUBE LINK FOR VIEWING ONLY: The meeting will be aired at a later time on the Town Government’s YouTube Channel at https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA ZOOM LINK TO VIRTUALLY ATTEND MEETING: https://us06web.zoom.us/j/88512774722?pwd=YsZ87vv2QcVHed0yXawgDlwcFUc5kz.1 Meeting ID: 885 1277 4722 Passcode: 673357 I. CALL TO ORDER II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA III. ANNOUNCEMENTS 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Affordable Housing Trust has re- released the Request for Proposals (RFP) for the Year-Round Deed Restriction Pilot Program. The Year -Round Deed Restriction Pilot Program aims to provide hous [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 AHT Meeting on January 6, 2026, at 12:30 PM NANTUCKET AFFORDABLE HOUSING TRUST MEETING MINUTES Tuesday, January 6, 2026 Hybrid Meeting; 131 Pleasant Street Trailer A with Participation via Zoom – 12:30 PM T rust Members: Brian Sullivan (Chair), Penny Dey (Vice -Chair), Mary Mack, Abby De Molina, Shantaw Bloise-Murphy, Forest Bell, Brooke Mohr Attending Members in person: Penny Dey (Vice-Chair), Brooke Mohr Attending Members remotely: Forest Bell, Abby De Molina, Mary Mack Staff in Attendance in person: Dylan Metsch-Ampel (Deputy Housing Director), Caroline Ferguson (Administrative Specialist) Staff in Attendance remote: Kristie Ferrantella (Housing Director), Vicki Marsh (Town Counsel) , Brian Turbitt (Municipal Finance Director) Speakers in Attendance: None I. CALL TO ORDER The meeting was called to order at 12:34pm. II. AFFORDABLE HOUSING TRUST ACCEPTANCE OF AGENDA Brooke Mohr made a MOTION to approve the agenda. Mary Mack seconded the motion. Roll call of those participating: 1. Brooke Mohr – Aye 2. Forest Bell – Aye 3. Mary Mack – Aye 4. Penny Dey – Aye III. ANNOUNCEMENTS Penny Dey made the following announcements: 1. This meeting of the Affordable Housing Trust is Being Audio and Video Recorded. 2. The Affordable Housing Trust has re-released the Request for Proposals (RFP) for the Year- Round Deed Restriction Pilot Program. The Year -Round Deed Restriction Pilot Program aims to provide housing stability, security, and affordability for people livin [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026 · 16:00

Nantucket Planning & Economic Development Commission

Commission to discuss enabling legislation and 2026 Town Meeting warrant articles

The Nantucket Planning & Economic Development Commission will meet to discuss updates to its enabling legislation. This discussion, facilitated by Julie Fitzgerald, Esq., includes related warrant articles for the 2026 Annual Town Meeting.

legislationtown-meetingeconomic-developmentplanning
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket Planning & Economic Development Commission (NP&EDC) Day, Date, and Time Tuesday, January 6, 2026 at 4:00 pm Location / Address REMOTE PARTICIPATION VIA ZOOM ONLY https://us06web.zoom.us/j/83745114187?pwd=CxFynizx2u6v4NruvraG0hvnC6dlYY.1 Signature of Chair or Authorized Person Megan Trudel, AICP, Deputy Director of Planning WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! NP&EDC AGENDA This meeting is being audio and video recorded and will be uploaded to the Town of Nantucket’s Government TV YouTube page at a later date. I. Call to Order: II. Establishment of Quorum: III. Approval of Agenda: IV. Discussion (facilitated by Julie Fitzgerald, Esq.) of the NP&EDC Enabling Legislation Update and Related Warrant Articles for the 2026 Annual Town Meeting, votes may be taken V. Adjournment
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ NP & EDC – January 6, 2025 @ 4:00PM APPROVED MINUTES Special Meeting Remote Participation via Webinar ▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬▬ ▬▬▬▬▬ LI NK TO MEETING: https://us06web.zoom.us/j/83745114187?pwd=CxFynizx2u6v4NruvraG0hvnC6dlYY.1 YOUTUBE LINK:Nantucket Planning & Economic Development Commission -January 6, 2025 Commissioners: Abby De Molina – Chair, Michael Misurelli – Vice Chair, Nat Lowell, Dave Iverson, Hillary Rayport, Liza Hatton, Bert Johnson, Brooke Mohr, John Kitchener, Kristina Jelleme Staff: Leslie Snell, Director of Planning, Megan Trudel, Senior Planner, Rodlisha Dixon, Administrative Specialist Facilitator: Julie Fitzgerald, Esq. PLEASE LIST BELOW THE TOPICS THE CHAIR REASONABLY ANTICIPATES WILL BE DISCUSSED AT THE MEETING. I. Call to Order: Chair De Molina called the meeting to order at 4:00 PM. The meeting was held remotely via Zoom and was audio and video recorded. II. E stablishment of Quorum Roll call was conducted and a quorum was established. III. Approval of Agenda MOTION/VOTE: Mr. Johnson made a motion to approve the agenda. The motion was seconded by Mr. Lowell and carried unanimously by roll call vote. IV . NP&EDC Enabling Legislation Update and Related Warrant Articles for the 2026 Annual Town Meeting Overview: The Commission held a facilitated discussion regarding proposed updates to the NP&EDC enabling legislation and the existence of both a Commis [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026 · 16:00

Historic District Commission

Historic District Commission to review numerous property alterations and new builds

The Historic District Commission will review a large volume of consent applications for home modifications, including roofing, fencing, and pools. The body will also consider several proposals for new dwellings and demolitions. Additionally, the commission will discuss changing Old Business meeting hours to 4pm–7pm starting mid-January 2026.

zoninghistoric-preservationdemolitionhousingsolar
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
o Updated Meeting Posting MEETING POSTING Original Posting Time: 2025 DEC 31 PM 02:14 Original Posting Number: T 1046 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Historic District Commission (HDC) – New Business Day, Date, and Time Tuesday, January 06, 2026, at 4:00pm *HYBRID Location / Address COMMUNITY ROOM @ 4 FAIRGROUNDS ROAD & REMOTE PARTICIPATION VIA ZOOM Information on viewing the meeting can be found at: https://www.nantucket-ma.gov/138/Boards-Commissions-Committees Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. HISTORIC DISTRICT COMMISSION Signature of Chair/Authorized Person: Stephen Welch, Chair To join the Historic District Commission meeting click on the Zoom Webinar link below to register: https://us06web.zoom.us/webinar/register/WN_ReL3FB9lQTqb1A9I7aj0Iw#/registration To watch live feed, click here: Nantucket Historic District Commission - January 6, 2026 Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus, Nicky Sherriff, Fiona Johnson, Sara Johnson To view [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
HDC Minutes January 6, 2026; adopted January 20, 2026 HISTORIC DISTRICT COMISSION Minutes January 6, 2026 2 Fairgrounds Road Nantucket, Massachusetts 02554 New Business Commissioners: Stephen Welch (Chair), Ray Pohl (Vice-Chair), Abby Camp, Val Oliver, Angus MacLeod Associate Commissioners: Carrie Thornewill, Constance Patten, Joe Paul Staff: Cathy Flynn, Holly Backus and Sara Johnson Holly Backus left the meeting at 4:38 pm In person Welch, Oliver, Camp, MacLeod and Patten Remote: Thornewill and Paul Absent: Pohl Early departures: Camp at 7:29pm Meeting called to order at 4:03pm by Stephen Welch Board: Welch, Oliver MacLeod Camp and Patten Oliver made the motion to approve the agenda Motion carries unanimously I. COMMISSIONER DISCUSSION • Welch announced that beginning later in the month, Old Business meetings will be held from 4:00 p.m. to no later than 7:00 p.m. He noted that the change would take effect at the last Old Business meeting of the month, which was identified as January 26, and stated that the updated schedule would be announced again as the date approaches. II. CONSENTS Property owner name Street Address Scope of work Map/Parcel Agent 1. Faros Properties, LLC 13915 23 Madaket Rd Roof change 41/303 T & T Roofing VO 2. NT Property Owner 13955 19 Honeysuckle Dr ODS 68/397 LFW VO 3. Clinton Savings Bank 13901 14-16 Sheep Pond Rd Re-site house on lot 63/29&30 Bracken Engineering VO 4. Aleks Istanbullu 13884 5 [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026 · 17:00

Harbor & Shellfish Advisory Board

Discussion on safe diesel fuel transfer from trucks to boats by fishermen

The Harbor & Shellfish Advisory Board will review reports from the Marine and Natural Resources Departments and discuss several pending issues. Topics include safe diesel‑fuel transfer from trucks to boats, a proposal for priority mooring permits for seasonal residents, a pilot project to install 20 eelgrass‑friendly moorings, and options to compensate for lost commercial bay‑scalloping days. The board will also revisit Chapter 91 licensing requirements, compliance and oversight.

marinefuelmooringsscallopinglicensingnatural-resources
131 Pleasant Street, Trailer Meeting Room, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Harbor & Shellfish Advisory Board Day, Date, and Time Tuesday, Jan. 6, 2026 at 5 p.m. via Zoom Location / Address Meeting trailer – 131 Pleasant St., Nantucket, MA 02554 and Via Zoom: in Zoom Meeting - https://us06web.zoom.us/j/81332167953?pwd=MuFswvUQPXHn7Rxu2SyfJ7BRjTTxcd.1 Meeting ID: 813 3216 7953 Password: 284896 Signature of Chair or Authorized Person Peter B. Brace - Secretary WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Agenda Harbor and Shellfish Advisory Board Tuesday, Jan. 6, 2026 at 5 p.m. Meeting trailer, 131 Pleasant St., Nantucket, MA 02554 To join Zoom Meeting: https://us06web.zoom.us/j/81332167953?pwd=MuFswvUQPXHn7Rxu2SyfJ7BRjTTxcd.1 Meeting ID: 813 3216 7953 Password: 284896 CALL TO ORDER APPROVAL OF AGENDA APPROVAL OF MINUTES Draft minutes of Nov. 18 and Dec. 2, 2025 2 CHAIRMAN’S REPORT Conflict of interest training MARINE DEPARTMENT REPORT General Marine Department Report – Sheila Lucey NATURAL RESOU [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026 · 18:00

Nantucket Public School Committee

School committee meeting cancelled due to quorum issues

The Nantucket Public School Committee meeting scheduled for January 6, 2026, was cancelled because there was no quorum of members present or the meeting posting was not in compliance with the Open Meeting Law statute.

cancelledschoolquorumbudgetfield-tripdonationscalendar
10 Surfside Road, Nantucket High School
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
CANCELLED MEETING POSTING Original Posting Date: January 2, 2026 Original Posting Number __ T007 TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Nantucket School Committee Meeting Day, Date, and Time Tuesday, January 6, 2026, 6:00 PM Location / Address Nantucket High School, Large Group Instruction Room (LGI) 10 Surfside Road Nantucket, MA 02544 Signature of Chair or Authorized Person Katie Bedell WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! CANCELLED MEETING POSTING AGENDA I. Call to order II. Welcome and approval of agenda III. Announcement: this meeting is being audio and video recorded IV. Public Comment V. Superintendent’s Update a. January Student Enrollment b. Transportation Update c. 2026 ACCESS Testing d. Additional Updates VI. Presentations and discussions of issues to the Committee a. Bullying Update - School Principals/Assistant Principals b. YONDR Initiative - Mandy Hilemn, NHS Principal & Michael Horton, CPS Principal c. Budget Development - Martin Anguelov, CFO of Nantucket Public Schools 1. Facilities & Grounds - Charles Clunie, Director of Facilities, 2. IT/Technology - Stephanie Hoban, Director of Technology 3. Athletics - Travis Lombardi, Athletic Di [Excerpt truncated on this listing page; use the official record for the full text.]
Tue Jan 6, 2026 · 09:00

Sign Advisory Council (HDC)

Sign Advisory Council reviews multiple sign projects on Federal and Old South Roads

The council will consider sign proposals for 22 Federal Street, 111B Old South Road, and the Great Harbor Yacht Club at 56 Union Street. It will also discuss a potential partnership with the Nantucket Chamber of Commerce and the codification of construction signs under Chapter 340.

signsplanningchamber-of-commerceconstruction-signs
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/Board/s Sign Advisory Council (HDC) – NEW BUSINESS Day, Date, and Time Tuesday, January 6, 2026 9:00am Location / Address Remote Participation via Zoom. The meeting will be aired at a later time on the Town’s Government TV YouTube Channel: https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA Signature of Chair or Authorized Person Cathy Flynn; Land Use Specialist Please note: If there is no quorum of members present, or if meeting posting is not in compliance with the OML statute, no meeting may be held. SIGN ADVISORY COUNCIL - SAC SAC Members: Chris Young (Chair), Paul Wolf, Mark Cutone, Kevin Kuester, Ben Normand 2 Fairgrounds Road Nantucket, Massachusetts 02554 www.nantucket-ma.gov AGENDA Join Zoom Meeting https://us06web.zoom.us/j/81200382018?pwd=8avihi8PTeSkJre0MvTLTkF6pPof14.1 Meeting ID: 812 0038 2018 Passcode: 139867 To join by phone (audio only): +1 646 558 8656 US (New York) Meeting ID: 883 5400 5057 Password: 011693 To View the Sign Viewpack, click here. Listed below are the topics the chair reasonably anticipates will be discussed at the meeting. I. PROCEDURAL BUSINESS 1. Call to Order 2. Members Present: 3. Audio Recorded Announcement 4. Adoption of [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
Minutes January 6, 2025; adopted January 20, 2026 Page 1 of 3 Historic District Commission Sign Advisory Council Commissioners: Chris Young (Chair), Kevin Kuester, Paul Wolf, Mark Cutone, Ben Normand MINUTES Tuesday January 6, 2025 Remote participation via Zoom. I. Procedural Business Call to order at 9:00 am. Attending members: Chris Young, Ben Normand, Paul Wolf, Staff in attendance: Cathy Flynn, Land Use Specialist; Rodlisha Dixon, Administrative Specialist. Absent members: Kevin Kuester & Mark Cutone Late arrivals: None Early Departures: None Motion to Adopt Agenda made by made by Wolf; seconded by Normand. Vote: carried unanimously. Approval of Minutes: December 9, 2025 (motion by Normand; seconded by Wolf). Vote: carried unanimously. II. Public Comment- none III. Commissioner Comments-none IV. New Business Property owner name Street Address Scope of work Map/Parcel Agent Minutes January 6, 2025; adopted January 20, 2026 Page 2 of 3 1. 22 Federal St LLC-13953 22 Federal Street Master Plan 42.4.2/31 Jonas Baker Discussion: The Council reviewed two applications proposing replacement projecting signs at existing bracket locations. Members discussed overall size compliance, material authenticity, sign thickness, and the presence of other signage at the property. Questions were raised regarding the thickness of the signs, confirmation that the signs are wood (not MDO), and consistency with previously approved signage [Excerpt truncated on this listing page; use the official record for the full text.]
Mon Jan 5, 2026 · 16:00

Planning Board

Planning Board to hold public hearings on multiple zoning map and bylaw amendments

The Planning Board will conduct public hearings on several proposed zoning map amendments and bylaw changes. These include requests to move various properties into Commercial Neighborhood districts and updates to definitions for apartment buildings and community land trusts.

zoningland-usepublic-hearingshousingcommercial-development
PSF COMMUNITY ROOM; 4 FAIRGROUNDS ROAD, NANTUCKET
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
MEETING POSTING Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed, and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays, and Holidays) *The Planning Board meeting will be audio and video recorded Board Members: David Iverson (Chair), Nat Lowell (Vice-Chair), Joseph Topham, John Kitchener and Hillary Hedges Rayport Alternates: Stephen Welch, Abby De Molina, and Howard Matz Staff: Leslie Snell (Director of Planning), Meg Trudel (Deputy Director of Planning), William Saad (Zoning Administrator/Land Use Specialist), and Catherine Ancero (Administrative Specialist) PLANNING BOARD AGENDA 01-05-2026 (Subject to change) The complete text and map (if applicable) for each article is available at Planning & Land Use Services, 2 Fairgrounds Road, Nantucket, MA Monday- Friday 7:30am -4:00pm, or may be reviewed digitally by emailing a request to [email protected]. Please list below the topics the chair anticipates will be discussed at the meeting. Webinar Registration Link: https://us06web.zoom.us/webinar/register/WN_yrsUH75MTZCn1rI-7EUGyg#/registration To view the meeting only, see link below: https://www.youtube.com/watch?v=6j0nNUWiXBA Committee/Board/s PLANNING BOARD Day, Date, and Time Monday, January 05, 2026, at 4:00PM Location / Address HYBRID – PUBLIC SAFETY FACILITY - COMMUNITY ROOM, 4 FAIRGROUNDS ROAD AND REMOTE PARTICI [Excerpt truncated on this listing page; use the official record for the full text.]
Fri Jan 2, 2026 · 16:00

Commission on Disability

Commission to appoint representative to new transportation advisory committee

The Commission on Disability will meet to approve minutes from November 2025 and appoint a representative to a new Transportation and Public Access Advisory Committee. The body will also discuss accessibility features at the town's football stadiums.

disabilitytransportationpublic-worksparksadvisory-committees
REMOTE PARTICIPATION VIA ZOOM
📄 From the agenda
Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).
1 MEETING POSTING TOWN OF NANTUCKET Pursuant to MGL Chapter 30A, § 18-25 All meeting notices and agenda must be filed and time stamped with the Town Clerk’s Office and posted at least 48 hours prior to the meeting (excluding Saturdays, Sundays and Holidays) Committee/ Board Commission on Disability Day, Date, and Time Friday, January 2, 2026, at 4:00 PM Location / Address https://us06web.zoom.us/j/85805528411?pwd=HQFrmxuMhmubVYFcPg6sbFmy5G9ueB.1 Signature of Chair or Authorized Person Brenda McDonough WARNING: IF THERE IS NO QUORUM OF MEMBERS PRESENT, OR IF MEETING POSTING IS NOT IN COMPLIANCE WITH THE OML STATUTE, NO MEETING MAY BE HELD! AGENDA Please list below the topics the chair reasonably anticipates will be discussed at the meeting Open Session To Join Zoom Meeting  Invite Link  https://us06web.zoom.us/j/85805528411?pwd=HQFrmxuMhmubVYFcPg6sbFmy5G9ueB.1 Meeting ID: 858 0552 8411 Passcode: 923957 I. Call to Order for Open Session II. Adopt Agenda III. Public Comment IV. Approve Open Session Minutes for November 21, 2025 V. New Business • Bicycle and Pedestrian Advisory Committee (BPAC) and Roads and Right of Way Committee are being “merged” to advise on broader mobility issues for both the Select Board and Nantucket Planning and Economic Development (NP&EDC). The NP&EDC has recommended the SB form a Transportation and Public Access Advisory Committee (TPAC) with 1 representative from COMDIS. The town wo [Excerpt truncated on this listing page; use the official record for the full text.]
📄 From the minutes
Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).
1 Nantucket Commission on Disability Minutes Open Session Friday, January 2, 2026 This meeting was conducted remotely by video conference via Zoom and the meeting will be aired at a later time on the Town’s Government TV YouTube Channel https://www.youtube.com/channel/UC-sgxA1fdoxteLNzRAUHIxA” Present: Mickey Rowland, Georgia Snell, Maribeth Maloney, August Chotkowski, Rocky Fox, and Brenda McDonough. Absent: Jeanette Topham and Nancy Swain Guests: Public Comment: None Call to Order: 4:01 p.m. Mr. Rowland called the meeting to order. All members present via Zoom responded affirmatively as Mr. Rowland called their names. Agenda: 4:01 p.m. Mr. Rowland stated that the Commission adopts the agenda. Note: Minutes 4:02 p.m. Ms. Snell motioned to approve November 21, 2025, minutes, which Ms. Maloney seconded, and all the present, eligible Commission members unanimously approved this motion by roll call: Mr. Rowland- Aye Mr. Fox- Aye Ms. Snell- Aye 2 Ms. Maloney- Aye Mr. Chotkowski- Aye Open Session: 4:03 p.m. New Business: • Bicycle and Pedestrian Advisory Committee (BPAC) and Roads and Right of Way Committee are being “merged” to advise on broader mobility issues for both the Select Board and Nantucket Planning and Economic Development (NP&EDC). The NP&EDC has recommended the SB form a Transportation and Public Access Advisory Committee (TPAC) with 1 representative from Commission on Disability. Our Commission mu [Excerpt truncated on this listing page; use the official record for the full text.]

Meeting archives

🔗 Embed this city · use the data

Free to reuse under CC BY 4.0 — a link back is appreciated. Paste this into your site:

<iframe src="https://mytown.theboringparts.com/city/nantucketma/embed/" width="100%" height="640" loading="lazy" style="border:1px solid #ddd;border-radius:8px" title="Nantucket County government meetings"></iframe>
<p>Local government meetings via <a href="https://mytown.theboringparts.com/city/nantucketma/">MyTown</a></p>

The credit line under the iframe is a real link back — keep it and you help others find us (and it satisfies the CC BY attribution). Prefer JSON? meetings.json · full embed & API guide.