Santa Cruz County, AZ

Wed Nov 18, 2026 · 09:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Wed Dec 2, 2026 · 09:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Wed Dec 16, 2026 · 17:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Wed Jan 6, 2027 · 09:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Wed Jan 20, 2027 · 09:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Wed Feb 3, 2027 · 09:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Wed Feb 17, 2027 · 09:30

Regular Meeting of the Board of Supervisors

2150 N. Congress Dr. Room 120, Nogales

Recent meetings

Wed Oct 21, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board considers $162,744 emergency services audit contract

The Santa Cruz County Board of Supervisors will discuss several public safety contracts and staffing requests. The meeting includes a study session featuring the Santa Cruz Council on Aging and the U.S. Consulate. The Board will also consider appointments for Precinct Committee Persons.

Professional Services Contract with Matrix Consulting Group, Ltd. for an Emergency Services Readiness and Coordination Audit for $162,744
Agreement with GovWorx for public safety telecommunications software for $9,950
Service Agreement with ConfirmOk, LLC for automated daily check-ins starting at $300 per month
Authorization to create and fill two Detention Officer positions and one Public Safety Telecommunicator position
Special Event License Application for St. Ann's Community Hall in Tubac for November 11, 2026

public-safetycontractsstaffingemergency-servicesappointments

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County AGENDA October 21, 2026 at 9:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on October 21, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the efficient conduct of business. C. CALL TO THE PUBLIC: This is the time for the public to comment. Members of the Board may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to A.R.S. § 38-431.01(H), action taken as a result of public comment will be limited to directing staff to study the matter, responding to any criticism or scheduling the matter for further consideration and decision at a later date. D. CURRENT EVENTS Board members may present brief summaries of current events, including updates on meetings, conferences, or other official ac …

Excerpt truncated on this listing page. Full text →

Tue Oct 20, 2026 · 16:00

Victim Compensation Board

Victim Compensation Board to review eligibility and claims for three cases

The Board will determine eligibility for cases VC-26-015 and VC-26-016. It will also consider specific assistance requests for medical and work loss expenses. The meeting includes a budget update on compensation and restitution balances.

Eligibility determination for case VC-26-015
Eligibility determination for case VC-26-016
Medical assistance request of $485.66 for case VC-26-016
Work loss assistance request of $4,090.50 for case VC-26-016
Budget update: Crime Victim Compensation balance of $51,476.00 and Restitution balance of $61,920.00

victim-servicesbudgetpublic-assistance

Santa Cruz County Attorney's Office located at 2150 N. Congress Dr., Conference Room, , Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

MEETING NOTICE AND AGENDA Pursuant to ARIZONA Revised Statutes §38-431, et. Seq. and amendments thereto, A REGULAR SESSION of the SANTA CRUZ COUNTY VICTIM COMPENSATION BOARD Will be held on October 20, 2026 at 4:00 p.m. Santa Cruz County Attorney’s Office, 2150 N. Congress Dr., Conference Room, Nogales, Arizona CALL TO ORDER: Call to order and roll call of Board members. APPROVAL OF MINUTES FOR 09/22/2026 GENERAL DISCUSSION: During this segment of the agenda board members may discuss items of interest related to Board business. Board members may include staff in these general discussions. Board members may not discuss nor act on specific items identified on this agenda. Scheduled Meetings: Meeting Date Time Location 11/17/2026- Approved on 08/25/26 4:00 P.M. 2170 N. Congress Dr. Nogales AZ. 82621 12/22/2026 4:00 P.M. 2170 N. Congress Dr. Nogales AZ. 82621 01/12/2027 4:00 P.M. 2170 N. Congress Dr. Nogales AZ. 82621 CALL TO THE PUBLIC: Call to the Public is held for public benefit to allow individuals to address issues(s) within the Board’s jurisdiction. Board members may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to Arizona Revised Statute §38-431.01G, action taken as a result of public comment will be limited to directing staff to study the matter, responding to criticism, or scheduling the matter for further discussion and decision at a future date. BUDGET UPDATE Crime Victim C …

Excerpt truncated on this listing page. Full text →

Fri Oct 16, 2026 · 11:30

Courtesy Postings

Wed Oct 14, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board to consider $400,000 road safety grant and various county contracts

The Santa Cruz County Board of Supervisors will discuss several personnel authorizations, liquor licensing, and tax valuation decisions. The meeting includes a large consent agenda covering multiple professional service contracts, grant agreements, and software licenses.

Grant Agreement with U.S. Department of Transportation for Safe Streets and Roads for All program in the amount of $400,000
Liquor License Application for Firesky Farms in Elgin
Professional Services Contract with Michael Townsend for Financial Planning Advisory Services not to exceed $80,000
Authorization to fill vacant positions including five Detention Officers and two Deputy Sheriffs
Change Order No. 1 for Pierson Field Playground CDBG Project in the amount of $10,000

roadsbudgetpublic-safetygrantslicensingpersonnel

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County AGENDA October 14, 2026 at 9:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on October 14, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the efficient conduct of business. C. CALL TO THE PUBLIC: This is the time for the public to comment. Members of the Board may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to A.R.S. § 38-431.01(H), action taken as a result of public comment will be limited to directing staff to study the matter, responding to any criticism or scheduling the matter for further consideration and decision at a later date. D. CURRENT EVENTS Board members may present brief summaries of current events, including updates on meetings, conferences, or other official ac …

Excerpt truncated on this listing page. Full text →

Tue Oct 6, 2026 · 08:00

Courtesy Postings

201 West Butler Avenue, Flagstaff

Thu Oct 1, 2026 · 16:00

Victim Compensation Board

Santa Cruz County Attorney's Office located at 2150 N. Congress Dr., Conference Room, , Nogales

Wed Sep 30, 2026 · 14:30

Courtesy Postings

2150 N. Congress Dr., Room 120, Nogales

Sun Sep 27, 2026 · 10:30

Courtesy Postings

Tumacacori

Sat Sep 26, 2026 · 18:00

Courtesy Postings

Nogales

Tue Sep 22, 2026 · 15:30

Special Meeting of the Board of Supervisors

Board to vote on authorizing treasurer to collect 2026-27 property taxes

The Santa Cruz County Board of Supervisors is holding a special meeting with one action item: a discussion and possible vote on Resolution No. 2026-18, which would authorize the Treasurer to collect and disburse property taxes for the 2026-2027 fiscal year. The agenda also includes public comment time and standard procedural items.

Resolution No. 2026-18: authorize Treasurer to collect and disburse 2026-2027 property taxes

budgettaxescounty-boardpublic-meeting

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County PUBLIC NOTICE OF MEETING LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Notice is hereby given, pursuant to A.R.S. § 38-431.02, that the Board of Supervisors of Santa Cruz County, State of Arizona will hold a SPECIAL MEETING at 3:30 p.m., on Tuesday, September 22, 2026, at the Santa Cruz County Complex, 2150 N. Congress Drive, Room 120, Nogales, Arizona. Notice is further given that one or more Board members may attend this meeting telephonically or by video conference. Members of the public may view the special meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live To obtain a copy of the agenda go to https://santacruzcoaz.portal.civicclerk.com/. Dated this 21st day of September 2026 Alma Schultz, Clerk Board of Supervisors AGENDA 3:30 PM Special Meeting Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on September 22, 2026, at 3:30 PM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 3:15 p.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure …

Excerpt truncated on this listing page. Full text →

Tue Sep 22, 2026 · 16:00

Victim Compensation Board

Board to decide on two victim compensation claims totaling $7,635.82

The Santa Cruz County Victim Compensation Board will hold a regular session to discuss and act on two compensation claims: one for work loss ($6,605.40) and one for mental health therapy sessions ($1,030.42). The board will also review a tabled claim (VC-26-014) and receive a budget update showing balances for crime victim compensation and restitution. Public comment is limited to items on the agenda.

Claim VC-26-006: work loss, $6,605.40
Claim VC-24-010: mental health therapy sessions, $1,030.42
Tabled claim VC-26-014: claimant letter to board
Budget update: Crime Victim Compensation balance $69,673.00; Restitution balance $61,920.00 (as of 09/17/2026)
Approval of minutes from 08/25/2026

victim-compensationbudgetclaimspublic-meeting

✓ Decided: Board approves $1,030 mental health and $6,607 wage loss claims

The Santa Cruz County Victim Compensation Board approved two compensation claims: $1,030.42 for mental health expenses (VC-24-010) and $6,607.22 for wage loss (VC-26-006), both by unanimous vote. The board also approved the August 25, 2026 minutes and heard public comment from Joanne Lavoie, who received only a general overview of procedures. No other substantive decisions were made.

Approved $1,030.42 mental health expense claim VC-24-010 (unanimous)
Approved $6,607.22 wage loss expense claim VC-26-006 (unanimous)
Approved minutes of 08.25.26 meeting

Santa Cruz County Attorney's Office located at 2150 N. Congress Dr., Conference Room, , Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

MEETING NOTICE AND AGENDA Pursuant to ARIZONA Revised Statutes §38-431, et. Seq. and amendments thereto, A REGULAR SESSION of the SANTA CRUZ COUNTY VICTIM COMPENSATION BOARD Will be held on September 22, 2026 at 4:00 p.m. Santa Cruz County Attorney’s Office, 2150 N. Congress Dr., Conference Room, Nogales, Arizona CALL TO ORDER: Call to order and roll call of Board members. APPROVAL OF MINUTES FOR 08/25/2026 GENERAL DISCUSSION: During this segment of the agenda board members may discuss items of interest related to Board business. Board members may include staff in these general discussions. Board members may not discuss nor act on specific items identified on this agenda. Scheduled Meetings: Meeting Date Time Location 10/20/2026- Approved on 08/25/26 4:00 P.M. 2170 N. Congress Dr. Nogales AZ. 82621 11/17/2026- Approved on 08/25/26 4:00 P.M. 2170 N. Congress Dr. Nogales AZ. 82621 CALL TO THE PUBLIC: Call to the Public is held for public benefit to allow individuals to address issues(s) within the Board’s jurisdiction. Board members may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to Arizona Revised Statute §38-431.01G, action taken as a result of public comment will be limited to directing staff to study the matter, responding to criticism, or scheduling the matter for further discussion and decision at a future date. BUDGET UPDATE Crime Victim Compensation balance $69,673.00 (as of 09 …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

Santa Cruz County Crime Victims Compensation Board Regular Meeting Minutes Santa Cruz County Attorney’s Victim Services Office 2150 N. Congress Dr., suite 201, Conference room 09.22.26 I. Call to Order and Roll Call Santa Cruz County Victim’s Compensation Board Meeting held at 4:38 p.m. in person Members present in person: Isaac Fragoso, Bobby Astengo, Margarita Elias, Ryann Quick, Chris Renteria, Members Absent: Rosie Elias, Sonia Sanchez, Staff Present in person: Jennifer Rayon, and Luis Andrade from the Santa Cruz County Attorney’s office II. Approval of minutes for 08.25.26 a. Approved by, Bobby Astengo and Margarita Elias III. General Discussion: a. No modification to previously scheduled meetings IV. Call to the Public: Joanne Lavoie addressed the Board to request information regarding a claim status and the criminal prosecution process. Because the matter involved a specific file, the Board and Detective Andrade provided only a general overview of investigation procedures and advised that any submitted written correspondence would be reviewed in accordance with standard policy. V. Financial update: a. Account balance i. Crime Victim Compensation Balance $69,673.00 (as of 09/17/26) ii. Restitution Balance $61,920.00 (as of 09/17/26) VI. Discussion Items: VC-24-010 Mr. Isaac Fragoso made motion to approve mental health expense in the amount of $1,030.42. Mr. Chris Renteria seconded motion. Motion passes. VC-26-006 …

Excerpt truncated on this listing page. Full text →

Wed Sep 16, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board to approve $136,990 FAA grant for Nogales airport apron expansion design

The Santa Cruz County Board of Supervisors will consider several action items, including a $136,990 FAA grant for the Nogales International Airport apron expansion design, a $235,000 contract for the Pierson Field playground project, and a professional services agreement for pretrial services. The agenda also includes routine consent items such as a vacation buyback option, appointments, and approvals of reports and minutes.

Approve $136,990 FAA grant for Nogales International Airport Apron Expansion Design Project
Award $235,000 contract to Arizona Recreation Design, Inc. for Pierson Field Playground Project (CDBG No. 116-26)
Approve Professional Services Agreement with Constructing Circles of Peace for pretrial assessments (July 2026–June 2027)
Approve one-time vacation buyback for up to 40 hours for eligible county employees
Approve appointments to Local Workforce Development Board (Yara Castro, Maria Luis Cota, Manuel Felix)

airportgrantscontractsworkforcebudgetpublic-works

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County AGENDA September 16, 2026 at 9:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on September 16, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the efficient conduct of business. C. CALL TO THE PUBLIC: This is the time for the public to comment. Members of the Board may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to A.R.S. § 38-431.01(H), action taken as a result of public comment will be limited to directing staff to study the matter, responding to any criticism or scheduling the matter for further consideration and decision at a later date. D. CURRENT EVENTS Board members may present brief summaries of current events, including updates on meetings, conferences, or other officia …

Excerpt truncated on this listing page. Full text →

Wed Sep 16, 2026 · 09:30

Public Notice

2150 N. Congress Dr. Room 120, Nogales

Thu Sep 10, 2026 · 16:15

Courtesy Postings

2021 N. Grand Ave, Nogales

Thu Sep 3, 2026 · 11:00

Courtesy Postings

Wed Sep 2, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board to vote on $206,000 South32 Hermosa funding for local school programs

The Santa Cruz County Board of Supervisors will consider a $206,000 Community Investment Agreement with South32 Hermosa, Inc. to support five educational programs for the 2026-2027 school year. The agenda also includes a study session on air quality monitoring and workforce planning, as well as routine consent items such as liquor licenses and staff appointments.

Approve $206,000 Community Investment Agreement with South32 Hermosa, Inc. for school programs
Approve $12,070 contract with WorkED Consulting, LLC to update the Local Workforce Development Plan
Approve $8,680 proposal with Wilder Landscape Architects to document border wall impacts in the Lochiel area
Approve liquor license application for The South 40 in Tubac
Approve partial release of Substitute Assurance Agreement No. 2025-06067 for Tubac Golf Resort Development Unit-2

educationbudgetworkforcelicensingdevelopment

✓ Decided: Board approves $8,680 landscape study of border wall impacts in Lochiel area

The Santa Cruz County Board of Supervisors approved a proposal with Wilder Landscape Architects for $8,680 to document landscape-related impacts from border wall construction in the Lochiel area, with the County Manager authorized to sign. The Board also approved a partial release of a substitute assurance agreement for lots in the Tubac Golf Resort Development Unit-2, and approved the full consent agenda, including a $206,000 community investment agreement with South32 Hermosa, Inc. for school programs and a $12,070 workforce plan update contract. The meeting included a study session on Year-1 AirSMART air quality monitoring by Dr. Chris Lim and a presentation on the county's Strategic Workforce and Wage Growth Plan by WestEd. The Board recognized Cecilia A. Mejia, Public Fiduciary Director, on her retirement after nearly 36 years of service.

Approved $8,680 proposal with Wilder Landscape Architects to document border wall landscape impacts in Lochiel area (3-0)
Approved partial release of Substitute Assurance Agreement No. 2025-06067 for lots 48-61 and 63-78, Tubac Golf Resort Development Unit-2 (3-0)
Approved consent agenda including $206,000 South32 Hermosa community investment agreement for school programs (3-0)
Approved $12,070 agreement with Worked Consulting, LLC to update Local Workforce Development Plan (3-0)
Approved proclamations for Suicide Prevention Awareness Month, National Diaper Need Awareness Week, and Rotary International District 5500 Day (3-0)
Approved authorization to fill vacant Public Safety Telecommunicator and Public Safety Records Clerk positions (3-0)
Approved emergency voting procedure and early ballot drop box locations for November 3, 2026 General Election (3-0)
Approved rescheduling September 16, 2026 meeting to 9:30 AM and moving October 7 meeting to October 14, 2026 (3-0)

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County AGENDA September 2, 2026 at 9:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on September 2, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the efficient conduct of business. C. CALL TO THE PUBLIC: This is the time for the public to comment. Members of the Board may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to A.R.S. § 38-431.01(H), action taken as a result of public comment will be limited to directing staff to study the matter, responding to any criticism or scheduling the matter for further consideration and decision at a later date. D. CURRENT EVENTS Board members may present brief summaries of current events, including updates on meetings, conferences, or other official …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

1 of 7 Board of Supervisors September 2, 2026 9:30 AM The Board met in a Regular Meeting at the Santa Cruz County Complex, 2150 N. Congress Drive, Room #120, Nogales, AZ. Present: John Fanning, Chairman; Luis Carlos Davis, Vice-Chairman; Rudy Molera, Member; Jesus Valdez, County Manager; Mauricio Chavez, Deputy County Manager; Chris Young, Deputy County Manager; Robert May, Civil Bureau Chief; Alma Schultz, Clerk of the Board. CALL TO ORDER/PLEDGE OF ALLEGIANCE Chairman Fanning called the meeting to order, and the Pledge of Allegiance was recited, led by Dr. Victor Diaz. ADOPTION OF AGENDA Supervisor Molera moved to adopt the agenda, requesting that Consent Agenda Item 6 be moved to the Action Items and that the Board deviate from the agenda sequence as necessary. Supervisor Davis seconded the motion. The motion carried unanimously. (Ayes: Davis, Fanning, Molera) CALL TO THE PUBLIC: Ben Lomeli, a resident of Rio Rico, stated that everyone has a right to clean air, clean water, clean food, and peaceful neighborhoods, urging stronger code enforcement to protect public health and safety. He emphasized that science must guide decisions in the upcoming comprehensive plan, noting the interconnectedness of air, water, soil, and watersheds. He warned that groundwater levels are declining and stressed that the community and officials must work together responsibly to safeguard the environment and future. Chris Werkhoven, formerly of Sonoita and now …

Excerpt truncated on this listing page. Full text →

🗳️ How they voted (2 roll-call votes)

Named votes as recorded in the official record.

motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (

2 yea

Davis yea · Fanning yea

motion by Supervisor Molera, seconded by Vice-Chairman Davis. The motion carried unanimously (

3 yea

Davis yea · Fanning yea · Molera) yea

Fri Aug 28, 2026 · 13:45

Courtesy Postings

Nogales

Tue Aug 25, 2026 · 16:00

Victim Compensation Board

Board reviews five victim compensation claims totaling $13,615.75

The Santa Cruz County Crime Victim Compensation Claims Board will review specific claims for medical, dental, ambulance, and work-loss assistance. The agenda includes a budget update showing a Crime Victim Compensation balance of $69,673.00 and a Restitution balance of $61,920.82. The board will also approve minutes from the June 9, 2026 meeting and hold a public comment session.

Claim VC-26-014: $11,936.00 for dental assistance
Claim VC-26-006: $10,908.00 for work loss
Claim VC-26-014: $300.00 for medical assistance
Claim VC-26-014: $290.00 for ambulance assistance
Claim VC-26-010: $681.75 for work loss

victim-compensationbudgetclaimspublic-safety

✓ Decided: Board approves $11,589.75 in victim wage-loss claims, tables one claim

The Santa Cruz County Crime Victims Compensation Board approved two wage-loss expense claims totaling $11,589.75 and tabled one claim pending further information. The board also approved the minutes of its 06.09.26 meeting and reviewed account balances. No public comment was offered, and the meeting adjourned at 4:43 p.m., with the next meeting set for September 22, 2026.

Approved wage loss expense of $681.75 for claim VC-26-010 (motion passes)
Approved wage loss expense of $10,908.00 for claim VC-26-006 (motion passes)
Tabled claim VC-26-014 until further information is received (motion passes)
Approved minutes of the 06.09.26 meeting
Adjourned at 4:43 p.m.; next meeting set for September 22, 2026

Santa Cruz County Attorney's Office located at 2150 N. Congress Dr., Conference Room, 201, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

MEETING NOTICE AND AGENDA Pursuant to ARIZONA Revised Statutes §38-431, et. Seq. and amendments thereto, A REGULAR SESSION of the SANTA CRUZ COUNTY VICTIM COMPENSATION BOARD Will be held on August 25, 2026 at 4:00 p.m. Santa Cruz County Attorney’s Office, 2150 N. Congress Dr., Conference Room, Nogales, Arizona CALL TO ORDER APPROVAL OF MINUTES FOR 06/09/2026 GENERAL DISCUSSION: During this segment of the agenda board members may discuss items of interest related to Board business. Board members may include staff in these general discussions. Board members may not discuss nor act on specific items identified on this agenda. Meeting Date Time Location September 22, 2026 4:00 p.m. 2150 N. Congress Dr Suite 201, Nogales AZ. October 20, 2026 4:00 p.m. 2150 N. Congress Dr Suite 201, Nogales AZ. November 17,2026 4:00 p.m. 2150 N. Congress Dr Suite 201, Nogales AZ. CALL TO THE PUBLIC: Call to the Public is held for public benefit to allow individuals to address issues(s) within the Board’s jurisdiction. Board members may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to Arizona Revised Statute §38-431.01G, action taken as a result of public comment will be limited to directing staff to study the matter, responding to criticism, or scheduling the matter for further discussion and decision at a future date. BUDGET UPDATE Crime Victim Compensation balance $69,673.00 (as of 08/21/2026) benefits R …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

Santa Cruz County Crime Victims Compensation Board Regular Meeting Minutes Santa Cruz County Attorney’s Victim Services Office 2150 N. Congress Dr., suite 201, Conference room 08.25.26 I. Call to Order and Roll Call Santa Cruz County Victim’s Compensation Board Meeting held at 4:07 p.m. in person Members present in person: Isaac Fragoso, Bobby Astengo, Sonia Sanchez Members Absent: Margarita Elias, Christian Renteria, Sonia Sanchez, Isaac Fragoso, Staff Present in person: Jennifer Rayon, from the Santa Cruz County Attorney’s office; II. Approval of minutes for 06.09.26 a. Approved by Sonia Sanchez, Bobby Astengo III. General Discussion: Schedule of meetings from September-November IV. Call to the Public: No Public V. Financial update: a. Account balance i. Crime Victim Compensation Balance $69,673.00 (as of 08/21/26) ii. Restitution Balance $61,920.82 (as of 06/30/26) VI. Discussion Items: VC-26-014 Mr. Isaac Fragoso moves to table claim until further information is received Mr. Boby Astengo seconded motion. Motion passes. VC-26-010 Mr. Isaac Fragoso made motion to approve wage loss expense in the amount of $681.75. Ms. Sonia Sanchez s seconded motion. Motion passes. VC-26-006 Mr. Bobby Astengo made motion to approve wage loss expense in the amount of $10,908.00. Mr. Isaac Fragoso seconded motion, motion passes. VII. Adjourn: Ms. Fragoso made the motion to adjourn at 4:43 p.m. Mr. Astengo seconded motion. Motio …

Excerpt truncated on this listing page. Full text →

Wed Aug 19, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board to ratify $244K in monsoon emergency repairs, approve fire district proclamation

The Santa Cruz County Board of Supervisors will consider ratifying two emergency invoices for bank protection and concrete slope work at Hohokam Dr. totaling $244,757.25, and a $12,300 tree removal contract. They will also vote on a proclamation for Sonoita-Elgin Fire District Day, a jail meal price increase, and several consent agenda items including election resolutions and intergovernmental agreements.

Ratify Proforma #108552 with West Coast Arborists for eucalyptus tree removal at Tubac Community Center, $12,300
Ratify Invoice Emergency-26-SCC01 with Innova Engineering for Hohokam Dr. monsoon repairs, $142,917.60
Ratify Invoice Emergency-26-SCC02 with Innova Engineering for Hohokam Dr. monsoon repairs, $101,839.65
Approve 3.5% meal price increase at Adult Detention Center with Trinity Services Group
Approve Resolution 2026-11 abandoning Camino Agua Fria right-of-way for Camino Providencia

public-worksemergency-repairsproclamationjailelectionsconsent-agendacontracts

✓ Decided: Board approves $244,757 in monsoon emergency repair invoices for Hohokam Dr.

The Santa Cruz County Board of Supervisors approved two Innova Engineering invoices totaling $244,757.20 for bank protection and concrete slope installation at Hohokam Dr. tied to the 2026 monsoon emergency, done in partnership with the City of Nogales. The Board also ratified a $12,300 contract with West Coast Arborists to remove a hazardous eucalyptus tree at the Tubac Community Center, approved a 3.5% jail meal-price increase effective October 1, 2026, and approved the consent agenda covering hiring authorizations, right-of-way changes, grants, and November 3, 2026 election resolutions. Public comment raised concerns about industrial truck idling on Cross Creek Connector, water and air quality near South32 mining, a Liberty Water outage, and trail damage after a storm; no action was recorded on those comments.

Approved Proforma #108552 with West Coast Arborists, Inc. for eucalyptus tree removal and stump grinding at Tubac Community Center, est. $12,300 (3-0)
Approved Invoice EMERGENCY-26-SCC01 with Innova Engineering, LLC for bank protection and concrete slope at Hohokam Dr., $142,917.60 (3-0)
Approved Invoice EMERGENCY-26-SCC02 with Innova Engineering, LLC for bank protection and concrete slope at Hohokam Dr., $101,839.65 (3-0)
Approved Trinity Services Group agreement raising Adult Detention Center meal prices 3.5% per CPI for food away from home, effective October 1, 2026 (3-0)
Approved proclamation declaring September 28, 2026 as Sonoita-Elgin Fire District Day (3-0)
Approved consent agenda: fill Appraiser I and Public Safety Telecommunicator Lead vacancies; transfer furniture and water fountains to Boys & Girls Club (3-0)
Approved Resolution No. 2026-11 abandoning part of Camino Agua Fria right-of-way in exchange for part of Camino Providencia (3-0)
Approved consent agenda items including Job Order Master Agreement PW-FY2027 lowering project threshold from $200,000 to $100,000, grants, and November 3, 2026 election resolutions 2026-12 through 2026-16 (3-0)

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County AGENDA August 19, 2026 at 9:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on August 19, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the efficient conduct of business. C. CALL TO THE PUBLIC: This is the time for the public to comment. Members of the Board may not discuss items that are not specifically identified on the agenda. Therefore, pursuant to A.R.S. § 38-431.01(H), action taken as a result of public comment will be limited to directing staff to study the matter, responding to any criticism or scheduling the matter for further consideration and decision at a later date. D. CURRENT EVENTS Board members may present brief summaries of current events, including updates on meetings, conferences, or other official acti …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

1 of 8 Board of Supervisors August 19, 2026 9:30 AM The Board met in a Regular Meeting at the Santa Cruz County Complex, 2150 N. Congress Drive, Room #120, Nogales, AZ. Present: John Fanning, Chairman; Luis Carlos Davis, Vice-Chairman; Rudy Molera, Member; Jesus Valdez, County Manager; Mauricio Chavez, Deputy County Manager; Chris Young, Deputy County Manager; Robert May, Civil Bureau Chief; Alma Schultz, Clerk of the Board. CALL TO ORDER/PLEDGE OF ALLEGIANCE Chairman Fanning called the meeting to order, and the Pledge of Allegiance was recited, led by Chief Marc Meredith, Sonoita-Elgin Fire District. ADOPTION OF AGENDA Supervisor Molera made a motion to adopt the Agenda and deviate from the Agenda sequence as necessary, seconded by Vice-Chairman Davis; motion carried unanimously. (Ayes: Davis, Fanning, Molera) DEPARTMENT REPORTS AND ACTIVITIES 3. AWARDS, RECOGNITIONS & ACCOMPLISHMENTS: A RECOGNITION OF SUNDT CONSTRUCTION FOR ITS PARTNERSHIP AND COMMITMENT TO IMPROVING OUR COMMUNITY THROUGH PROJECTS THAT ENHANCE INFRASTRUCTURE AND QUALITY OF LIFE FOR OUR RESIDENTS (REQ: VICE-CHAIRMAN DAVIS) B RECOGNITION OF VICTOR MARTÍN DEL CAMPO, PROJECT EXECUTIVE, SUNDT CONSTRUCTION FOR HIS OUTSTANDING PARTNERSHIP AND COMMITMENT TO PROJECTS THAT STRENGTHEN OUR INFRASTRUCTURE AND IMPROVE OUR COMMUNITY (REQ: VICE-CHAIRMAN DAVIS) Vice-Chairman Davis reported on Sundt Construction's ongoing community-support efforts throughout Santa Cruz Count …

Excerpt truncated on this listing page. Full text →

🗳️ How they voted (2 roll-call votes)

Named votes as recorded in the official record.

motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) The Board adjourned as the Jail District Board and reconvened the Regular Meeting…

2 yea

Davis yea · Fanning yea

[context] motion carried unanimously) (

3 yea

Davis yea · Fanning yea · Molera) yea

Fri Aug 7, 2026 · 16:00

Courtesy Postings

Nogales

Wed Aug 5, 2026 · 10:30

Special Meeting of the Board of Supervisors

Board of Supervisors to hold public hearing on Fiscal Year 2026-2027 Budget

The Board of Supervisors will hold a public hearing to present the Fiscal Year 2026-2027 budget. The meeting includes discussions and possible actions to adopt the budget and set tax rates for jurisdictions within the county.

Truth in Taxation Hearing
Resolution No. 2026-09 to adopt the Fiscal Year 2026-2027 Budget
Resolution No. 2026-10 designating the Chief Fiscal Officer for the Expenditure Limitation Report
Adoption of Fiscal Year 2026-2027 Tax Rates for jurisdictions within Santa Cruz County

budgettaxespublic-hearingfinance

✓ Decided: County adopts $155.8M FY 2026-27 budget, cuts tax rates

The Board of Supervisors unanimously adopted the final FY 2026-2027 budget of $155.8 million and approved resolutions to submit the expenditure limitation report and set tax rates. The primary property tax rate was reduced to 3.9465 and the secondary (flood control) rate to 0.7893, though some taxpayers may see higher bills due to increased assessed values. The board also entered executive session to seek legal guidance on the statutory 5% limited property value increase after public concerns.

Adopted FY 2026-2027 final budget of $155.8M (unanimous)
Approved Resolution 2026-09 adopting the final budget (unanimous)
Approved Resolution 2026-10 designating Chief Fiscal Officer for expenditure limitation report (unanimous)
Adopted FY 2026-2027 tax rates for jurisdictions (unanimous)
Reduced primary property tax rate to 3.9465
Reduced secondary (flood control) tax rate to 0.7893
Requested legal guidance on limited property value authority and entered executive session

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County NOTICE OF PUBLIC HEARING & SPECIAL MEETING LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Notice is hereby given, pursuant to A.R.S. § 38-431.02, that the Board of Supervisors of Santa Cruz County, State of Arizona will hold a PUBLIC HEARING to present Fiscal Year 2026 -2027 Budget at 10:30 a.m. , on Wednesday, August 5, 2026, followed by a SPECIAL MEETING at the Santa Cruz County Complex, 2150 N. Congress Drive, Room 120, Nogales, Arizona. Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live Doors will open at 10:15 AM for the public. To obtain a copy of the agenda go to https://santacruzcoaz.portal.civicclerk.com/. Alma Schultz, Clerk Board of Supervisors AGENDA 10:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 A. PUBLIC HEARING The purpose of the Public Hearing is to formally present the matter to the Board and the public, and to allow for public comm ents. Public Hearings are part of the decision-making process, and the input received may be considered before Board action is taken. 1. Truth in Taxation Hearing 2. Presentation of the Santa Cruz County for Fiscal Year 2026-2027 B. SPECIAL MEETING ACTION TAKEN Special meetings may include matters for the Board’s consideration, di …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

1 of 3 Board of Supervisors August 5, 2026 10:30 AM The Board met in a Special Meeting at the Santa Cruz County Complex, 2150 N. Congress Drive, Room #120, Nogales, AZ. Present: John Fanning, Chairman; Luis Carlos Davis, Vice-Chairman; Rudy Molera, Member; Jesus Valdez, County Manager; Mauricio Chavez, Deputy County Manager; Chris Young, Deputy County Manager; Robert May, Civil Bureau Chief; Alma Schultz, Clerk of the Board. PUBLIC HEARING 1. TRUTH IN TAXATION HEARING Vice-Chairman Davis made a motion to convene into the Public Hearing seconded by Supervisor Molera; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) Deputy County Manager Mauricio Chavez presented the Truth-in-Taxation information required under A.R.S. §§ 42-17107 and 48-254. He reported that the Board’s multi-year tax-rate reduction plan continues for FY 2026–2027, lowering the primary property tax rate by three cents from 4.0065 to 3.9465, and lowering the secondary (flood control) tax rate from 0.7953 to 0.7893. He explained that although rates are decreasing, some taxpayers may still see an increase in their total tax bill due to countywide increases in assessed property values. Assessor Pablo Ramos provided an overview of valuation methods, describing how full cash value and limited property value are calculated using market data, cost components, and statutory formulas. He clarified the statutory 5% limited property value increase, noting its relationship to …

Excerpt truncated on this listing page. Full text →

🗳️ How they voted (2 roll-call votes)

Named votes as recorded in the official record.

motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (

2 yea

Davis yea · Fanning yea

that the Board remains open to questions from the public at any time and that both the Assessor’s Office and Board members are available to provide clarification when needed. The Board reiterated…

3 yea

Davis yea · Fanning yea · Molera) yea

Wed Aug 5, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board considers multiple health and safety grants and staffing authorizations

The Santa Cruz County Board of Supervisors will discuss various personnel authorizations and several grant agreements. The meeting includes reviews of flood control reports and a proposal for a community landfill disposal policy.

Professional Services Agreement with EPIC for Early Child Care Strategic Action Plan for $98,130
Grant Agreement with City of Tucson for HIDTA program and Investigative Task Force for $490,533
Grant Agreement for Arizona Parents Commission on Drug Education and Prevention for $193,753
Proposed Community Benefit Support Policy for free landfill disposal at Rio Rico, Sonoita-Elgin, and Tubac sites
Remote Tasting Room Application for Rancho Castillo in Sonoita

public-healthgrantsstaffingwaste-managementpublic-safety

✓ Decided: Board approves consent agenda with 14 items, including new hires and grants

The Santa Cruz County Board of Supervisors unanimously approved the consent agenda, which included authorizations to fill four vacant positions, appointment of a part-time judge pro tempore, adoption of a pension funding policy, and approval of multiple grants and agreements. The board also approved the creation and filling of a Disclosure & Redaction Specialist and a Maintenance Worker position in the Jail District. No substantive decisions were made outside of these approvals; the meeting was largely procedural with reports and updates.

Approved creation and filling of Disclosure & Redaction Specialist and Maintenance Worker positions (Jail District) (unanimous)
Approved consent agenda including 4 position fills, judge pro tempore appointment, pension policy, landfill disposal policy, and multiple grants (unanimous)
Approved demands totaling $3,066,188.46 across all funds (unanimous)

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County AGENDA August 5, 2026 at 9:30 AM Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Members of the public may view the meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on August 5, 2026, at 9:30 AM in the Board of Supervis ors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the efficient conduct of business. C. CALL TO THE PUBLIC: This is the time for the public to comment. Members of the Board may not discuss items that are not specifically identified o n the agenda. Therefore, pursuant to A.R.S. § 38-431.01(H), action taken as a result of public comment will be limited to directing staff to study the matter, responding to any criticism or scheduling the matter for further consideration and decision at a later date. D. CURRENT EVENTS Board members may present brief summaries of current events, including updates on meetings, conferences, or other official activiti …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

1 of 6 Board of Supervisors August 5, 2026 9:30 AM The Board met in a Regular Meeting at the Santa Cruz County Complex, 2150 N. Congress Drive, Room #120, Nogales, AZ. Present: John Fanning, Chairman; Luis Carlos Davis, Vice-Chairman; Rudy Molera, Member; Jesus Valdez, County Manager; Mauricio Chavez, Deputy County Manager; Chris Young, Deputy County Manager; Robert May, Civil Bureau Chief; Alma Schultz, Clerk of the Board. CALL TO ORDER/PLEDGE OF ALLEGIANCE Chairman Fanning called the meeting to order, and the Pledge of Allegiance was recited, led by Edgardo. ADOPTION OF AGENDA The County Manager announced that the GSA (U.S. General Services Administration) would not be presenting, and that slides had been provided for Deputy County Manager Christopher Young to present under Department Updates. He also noted the installation of a new “On Air” indicator sign for live meetings and thanked the IT Department. Following this update, the Board proceeded with adoption of the agenda. Vice-Chairman Davis made a motion to adopt the agenda and allow the Chair to deviate from the sequence as necessary. Supervisor Molera seconded the motion, and it carried unanimously. (Ayes: Davis, Fanning, Molera) CALL TO THE PUBLIC: Ryann Quick and Luis Gaxiola, speaking on behalf of Mariposa Community Health Center and Hope, announced that August is Overdose Awareness Month. They invited the community to an Overdose Awareness Day Car Show on August 22 and noted …

Excerpt truncated on this listing page. Full text →

🗳️ How they voted (2 roll-call votes)

Named votes as recorded in the official record.

motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) The Board adjourned as the Jail District Board and reconvened into the Regular…

2 yea

Davis yea · Fanning yea

[context] motion carried unanimously) (

3 yea

Davis yea · Fanning yea · Molera) yea

Fri Jul 31, 2026 · 08:00

Courtesy Postings

590 Camino Lito Galindo, Rio Rico

Wed Jul 29, 2026 · 09:30

Special Meeting of the Board of Supervisors

Santa Cruz County supervisors to certify July 21 primary election results

The Santa Cruz County Board of Supervisors will hold a special meeting to discuss and possibly certify the official results of the July 21, 2026, Primary Election. The meeting is scheduled for 9:30 a.m. at the Santa Cruz County Complex in Nogales, Arizona.

Certify July 21, 2026, Primary Election Official Results

electionscertificationboard-of-supervisorslocal-governmentarizona

✓ Decided: Board certifies July 21 primary election results

The Board of Supervisors met in a special session and unanimously approved and certified the official canvass of the July 21, 2026, primary election results. The agenda was adopted with a deviation from sequence as needed. The meeting adjourned shortly after, at 9:33 a.m.

Adopted agenda and allowed deviation from sequence (unanimous)
Approved and certified July 21, 2026 primary election official results (unanimous)

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County PUBLIC NOTICE OF MEETING LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Notice is hereby given, pursuant to A.R.S. § 38-431.02, that the Board of Supervisors of Santa Cruz County, State of Arizona will hold a SPECIAL MEETING at 9:30 a.m., on Wednesday, July 29, 2026, at the Santa Cruz County Complex, 2150 N. Congress Drive, Room 120, Nogales, Arizona. Notice is further given that one or more Board members may attend this meeting telephonically or by video conference. Members of the public may view the special meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live To obtain a copy of the agenda go to https://santacruzcoaz.portal.civicclerk.com/. Dated this 28th day of July 2026 Alma Schultz, Clerk Board of Supervisors AGENDA 9:30 AM Special Meeting Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on July 29, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the effic …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

1 of 1 Board of Supervisors July 29, 2026 9:30 AM The Board met in a Special Meeting at the Santa Cruz County Complex, 2150 N. Congress Drive, Room #120, Nogales, AZ. Present: John Fanning, Chairman; Luis Carlos Davis, Vice-Chairman; Rudy Molera, Member; Jesus Valdez, County Manager; Mauricio Chavez, Deputy County Manager; Chris Young, Deputy County Manager; Robert May, Civil Bureau Chief; Alma Schultz, Clerk of the Board. CALL TO ORDER/PLEDGE OF ALLEGIANCE Chairman Fanning called the meeting to order, and the Pledge of Allegiance was recited, led by Robert May. ADOPTION OF AGENDA Vice-Chairman Davis made a motion to adopt the Agenda and deviate from the Agenda sequence as necessary; seconded by Supervisor Molera; motion carried unanimously. (Ayes: Davis, Fanning, Molera) ACTION ITEMS 1. DISCUSSION/POSSIBLE ACTION TO APPROVE AND CERTIFY THE CANVASS OF JULY 21, 2026, PRIMARY ELECTION OFFICIAL RESULTS (REQ: ELECTIONS) Supervisor Molera made a motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) ADJOURNMENT The meeting adjourned at 9:33 a.m. (motion: Vice-Chairman Davis; second: Supervisor Molera; motion carried unanimously) (Ayes: Davis, Fanning, Molera)

🗳️ How they voted (1 roll-call vote)

Named votes as recorded in the official record.

motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) ADJOURNMENT The meeting adjourned at 9:33 a.m. (motion: Vice-Chairman Davis; second…

3 yea

Davis yea · Fanning yea · Molera) yea

Mon Jul 27, 2026 · 08:00

Courtesy Postings

2150 N. Congress Dr. , Nogales

Thu Jul 23, 2026 · 09:30

Special Meeting of the Board of Supervisors

Board considers emergency proclamation for July 2026 monsoon flooding

The Santa Cruz County Board of Supervisors is holding a special meeting to discuss and potentially approve an emergency proclamation. This action aims to address the July 2026 monsoon flooding crisis across all areas of the county.

Discussion/possible action to approve Proclamation declaring an emergency for July 2026 Monsoon flooding

emergency-managementfloodingpublic-safety

✓ Decided: County declares emergency over July 2026 monsoon flooding

The Board of Supervisors unanimously approved a proclamation declaring an emergency in all areas of Santa Cruz County to address the July 2026 monsoon flooding crisis. The meeting was otherwise procedural, with the agenda adopted and the meeting adjourned without further substantive decisions.

Approved emergency proclamation for monsoon flooding (unanimous)
Adopted agenda with permission to deviate from sequence (unanimous)
Adjourned meeting at 9:45 a.m. (unanimous)

2150 N. Congress Dr. Room 120, Nogales

📄 From the agenda

Extracted text of the official agenda document (automated extraction — may contain OCR/formatting errors).

Board of Supervisors Santa Cruz County PUBLIC NOTICE OF MEETING LUIS CARLOS DAVIS District 1 RUDY MOLERA District 2 JOHN FANNING District 3 Notice is hereby given, pursuant to A.R.S. § 38-431.02, that the Board of Supervisors of Santa Cruz County, State of Arizona will hold a SPECIAL MEETING at 9:30 a.m., on Thursday, July 23, 2026, at the Santa Cruz County Complex, 2150 N. Congress Drive, Room 120, Nogales, Arizona. Notice is further given that one or more Board members may attend this meeting telephonically or by video conference. Members of the public may view the special meeting by clicking the following link: www.youtube.com/@santacruzcountyarizona/live To obtain a copy of the agenda go to https://santacruzcoaz.portal.civicclerk.com/. Dated this 22nd day of July 2026 Alma Schultz, Clerk Board of Supervisors AGENDA 9:30 AM Special Meeting Santa Cruz County Complex 2150 N. Congress Drive, Room 120 Nogales, AZ 85621 (520) 375-7812 ● FAX (520) 761-7843 ● TDD (520) 375-7934 A. CALL TO ORDER/PLEDGE OF ALLEGIANCE The Santa Cruz County Board of Supervisors calls this meeting to order on July 23, 2026, at 9:30 AM in the Board of Supervisors Meeting Room 120, located at 2150 N. Congress Dr., Nogales, AZ 85621. The doors to the meeting room open at 9:15 a.m. Please join us for the Pledge of Allegiance. B. ADOPTION OF AGENDA The Board may change the order of items, remove or postpone items, as needed to ensure the ef …

Excerpt truncated on this listing page. Full text →

📄 From the minutes

Extracted text of the official minutes document (automated extraction — may contain OCR/formatting errors).

1 of 1 Board of Supervisors July 23, 2026 9:30 AM The Board met in a Special Meeting at the Santa Cruz County Complex, 2150 N. Congress Drive, Room #120, Nogales, AZ. Present: John Fanning, Chairman; Luis Carlos Davis, Vice-Chairman; Rudy Molera, Member; Jesus Valdez, County Manager; Mauricio Chavez, Deputy County Manager; Chris Young, Deputy County Manager; Robert May, Civil Bureau Chief; Alma Schultz, Clerk of the Board. CALL TO ORDER/PLEDGE OF ALLEGIANCE Chairman Fanning called the meeting to order, and the Pledge of Allegiance was recited, led by Juan Balderas. ADOPTION OF AGENDA Vice-Chairman Davis made a motion to adopt the Agenda and deviate from the Agenda sequence as necessary; seconded by Supervisor Molera; motion carried unanimously. (Ayes: Davis, Fanning, Molera) ACTION ITEMS 1. DISCUSSION/POSSIBLE ACTION TO APPROVE PROCLAMATION DECLARING AN EMERGENCY IN ALL AREAS OF SANTA CRUZ COUNTY TO ADDRESS THE JULY 2026 MONSOON FLOODING CRISIS (REQ: COUNTY MANAGER) Supervisor Molera made a motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) check the motion. ADJOURNMENT The meeting adjourned at 9:45 a.m. (motion: Supervisor Molera; second: Vice-Chairman Davis; motion carried unanimously) (Ayes: Davis, Fanning, Molera)

🗳️ How they voted (1 roll-call vote)

Named votes as recorded in the official record.

motion to approve, seconded by Vice-Chairman Davis; the motion carried unanimously. (Ayes: Davis, Fanning, Molera) check the motion. ADJOURNMENT The meeting adjourned at 9:45 a.m. (motion: Supervisor…

3 yea

Davis yea · Fanning yea · Molera) yea

Wed Jul 22, 2026 · 16:00

Courtesy Postings

1500 Hohokam Dr., Nogales

Fri Jul 17, 2026 · 08:00

Courtesy Postings

900 Convention Center Blvd., New Orleans

Wed Jul 15, 2026 · 09:30

Regular Meeting of the Board of Supervisors

Board of Supervisors to consider Fiscal Year 2026-2027 Tentative Budget

The Board of Supervisors will discuss the tentative budget for the 2026-2027 fiscal year and the retention of outside counsel for a specific court case. The meeting includes a study session for a South32 Hermosa quarterly update and various contract approvals.

Possible adoption of the Fiscal Year 2026-2027 Tentative Budget
Funding Agreement No. 117-26 for Robert Damon Recreation Complex Improvements in the amount of $592,756
Intergovernmental Agreement Contract No. CTR082503 for the Rural Health Transformation Program with yearly funding of $397,692.20
Agreement with HDR Engineering, Inc. for I-19 Rio Rico Frontage Road BUILD Grant application in the amount of $74,050
Agreement with APIC Solutions for Adult Detention Division security cameras in the amount of $22,672.51

budgetpublic-workshealth-serviceslegalcontractspublic-safety

✓ Decided: County adopts $156M tentative budget for FY 2026-2027

The Board unanimously adopted the Fiscal Year 2026-2027 Tentative Budget of approximately $156 million, which supports 417 full-time employees and includes a proposed 3% cost-of-living adjustment. The Board also unanimously approved a bid for legal publications and advertising, and approved the possible retention of outside counsel for current or former employees named in the Auditor General's lawsuit. All items on the Consent Agenda were approved in a single unanimous vote.

Adopted the Fiscal Year 2026-2027 Tentative Budget of approximately $156 million.
Awarded Bid No. B-05-26-CO79 for legal publications to Nogales International at $7.29 per column inch.
Approved the possible retention of outside counsel for employees named in Auditor General v. Acuna, et al.
Approved the Consent Agenda, including a proclamation for Child Support Awareness Month and four position fills.
Approved a $592,756 CDBG funding agreement for Robert Damon Recreation Complex improvements.
Approved a $135,000 9-1-1 program funding agreement with the Arizona Department of Administration.
Approved a $397,692.20 yearly rural health transformation program agreement with the Arizona Department of Health Services.
Approved demands totaling $1,811,089.48 for all funds.

2150 N. Congress Dr. Room 120, Nogales