The Boring PartsFederalLocal · USLocal · Canada
Trumbull, CT

Trumbull public meetings in 2024

324 substantive meetings from 2024, with official agendas or minutes and plain-English summaries.

Thu Dec 19, 2024

Equity, Diversity and Inclusion Task Force

Task force plans Black History Month events, sets 2025 meeting schedule

The Equity, Diversity and Inclusion Task Force will discuss updates on diversity training, a value statement, and a book club for 'The Good Immigrant' at the Trumbull Library. They will also plan Black History Month events including a screening of 'The Price of a Ticket' and consider a program with the Trumbull Historical Society. The task force will approve minutes from November and set the 2025 meeting calendar with second Thursdays via Zoom.

diversityequityinclusionlibrariespublic-eventsbook-clubblack-history-monthsurveys
✓ Decided: EDI Task Force adopts monthly Zoom meetings, advances diversity initiatives

The Equity, Diversity and Inclusion Task Force approved a new monthly Zoom meeting schedule, set for the second Thursday of each month starting January 9, 2025. The committee also confirmed upcoming events, including a book club discussion and a film screening, and agreed to reach out to the school district about EdSight reports. Minutes from a prior meeting were approved with one abstention.

Wed Dec 18, 2024

Civil Service Board

Civil Service Board to consider recruiting for Maintainer II and Deputy Building Official

The Civil Service Board will decide whether to approve advertising and recruitment for two vacant positions: Maintainer II in the Highway & Parks Department ($26.94/hour) and Deputy Building Official in the Building Department ($38.47–$45.93/hour). They will also review and approve the 2025 meeting schedule and receive the Civil Service New Hire Report. Approval of minutes from the November 20 and December 4, 2024 meetings is also on the agenda.

civil-service-boardhiringrecruitmentmaintainer-iideputy-building-officialmeeting-schedule
✓ Decided: Civil Service Board approves hiring for Maintainer II and Deputy Building Official

The Trumbull Civil Service Board approved requests to advertise and recruit for a non-competitive entry-level Maintainer II in the Highway & Parks Dept. and to advertise, test, and recruit for a Deputy Building Official in the Building Dept. (open and competitive). The board also approved the November 20 and December 4 meeting minutes and the 2025 meeting schedule. All votes were 3-0.

Wed Dec 18, 2024

Town Council

Trumbull Town Council to vote on appointments, $17,509 school transport, and Veterans Center manager

The Town Council will consider eight resolutions at a special videoconference meeting, including appointments to the Hillcrest Middle School Building Committee and Golf Commission, a $17,509 appropriation for non-public school transportation, selection of a construction manager for the Trumbull Veterans & First Responders Center, settlement of a workers compensation claim, and adoption of a Town Value Statement.

town-councilappointmentsappropriationsveteransworkers-compensationvalue-statementtrumbull
✓ Decided: Town Council adopts Trumbull Value Statement 16-1

The Town Council adopted the Trumbull Value Statement, which formalizes the town's commitment to diversity, dignity, and welcoming atmosphere, with a 16-1 vote. The council also approved several appointments, a supplemental appropriation for non-public school transportation, and a construction manager for the Veterans & First Responders Center. A workers' compensation settlement was authorized after an executive session.

Wed Dec 18, 2024

Planning & Zoning Commission

Trumbull P&Z to consider zoning changes for age-restricted and workforce housing

The Planning and Zoning Commission will hold public hearings on three proposed text amendments to the town's zoning regulations. The commission will also review a pre-application for a mixed-use development and elect officers for 2025.

zoninghousingmixed-useworkforce-housingage-restricted-housing
✓ Decided: PZC approves state-law compliance text amendment, continues two housing overlay hearings

The Planning and Zoning Commission approved a text amendment (File #24-19) to ensure town regulations comply with Connecticut law, effective December 30, 2024. The commission continued public hearings for two proposed age-restricted and workforce housing overlay zone amendments (Files #24-18 and #24-21) to January 15, 2025, for further review. Officers were elected, 2025 meeting dates approved, and prior minutes accepted.

Wed Dec 18, 2024

Water Pollution Control Authority

WPCA to discuss contract negotiations for Wildwood, Whitney, Merritt pump station upgrades

The Water Pollution Control Authority will hold a regular meeting on December 18, 2024, via videoconference. Key items include an executive session for contract negotiations on preliminary design for pump station upgrades at Wildwood, Whitney Avenue, and Merritt Boulevard. The board will also receive updates on the Old Town Road/Reservoir Avenue pump stations, Old Town force-main, and Trumbull Town Center. Previous meeting minutes from November 20, 2024, are up for approval.

water-pollution-control-authoritypump-station-upgradescontract-negotiationsinfrastructuretrumbull
✓ Decided: WPCA approves $415,070 pump station design contract

The Water Pollution Control Authority approved a $415,070 contract with Arcadis for preliminary design of upgrades to the Wildwood, Whitney Avenue, and Merritt Boulevard pump stations. The board also approved the November 20, 2024 meeting minutes. Updates were provided on the Old Town Road pump station and force-main, and the Trumbull Town Center sewer line, but no other decisions were made.

Tue Dec 17, 2024

Trumbull Nature & Arts Commission

Nature Commission to discuss capital plan, building updates, and 2025 meeting dates

The Trumbull Nature & Arts Commission will meet to approve minutes from September 17, 2024, discuss the director’s report, and receive updates on building/grounds and the Five-Year Capital Plan. New business includes setting meeting dates for 2025. The agenda is largely procedural with no major funding decisions or policy changes.

nature-commissiontrumbullcapital-planbuilding-groundsmeeting-datesminutes-approval
✓ Decided: Commission approves 2025 meeting dates, tables minutes review

The Trumbull Nature & Arts Commission approved quarterly meeting dates for 2025 and discussed updates on the building feasibility study, ARPA funding, and grant applications. Approval of the September 2024 minutes was tabled until March 2025. No public comment was made, and the meeting adjourned at 7:22 pm.

Mon Dec 16, 2024

Golf Course Commission

Golf Commission to vote on FY 2025-2026 budget and elect officers

The Golf Course Commission will hold its December meeting to approve the FY 2025-2026 budget and set the 2025 ID rate. The commission will also elect officers for the coming year and discuss the 2025 meeting schedule. Committee reports will cover course maintenance, capital projects, and concession operations.

golfbudgetelectionsfeesmaintenancecapital-projectstrumbull
✓ Decided: Golf Commission approves $3.04M FY2025-26 budget

The Golf Course Commission unanimously approved a $3,042,370 budget for fiscal year 2025-26, with possible adjustments to salary, utility, and reimbursable accounts by the Town. It also approved a $2,700 addition for the Golf Genius app and set 2025 golf ID application fees. Officers for 2025 were elected, and prior minutes were approved.

Thu Dec 12, 2024

Town Council

Town Council to appoint members and approve $17,509 for school transport

The Trumbull Town Council will vote on eight resolutions, including appointments to the Hillcrest Middle School Building Committee and Golf Course Commission, a $17,509 appropriation for non-public school transportation, and the adoption of the Town Value Statement. The meeting also includes a workers compensation settlement authorization and selection of a construction manager for the Veterans & First Responders Center project.

appointmentsbudgeteducationgovernanceveterans
Thu Dec 12, 2024

Board of Finance

Board of Finance to vote on $14.1M bond for town capital improvements

The Board of Finance will consider two bonding resolutions totaling $20.6 million for the 2025-2026 capital improvement plans of the Board of Education ($6.48M) and the Town ($14.135M). The board will also receive the Internal Auditor's report on the School Lunch Program and review year-to-date budget reports.

budgetbondsschoolsauditcapital-improvementsfinancelunch-program
✓ Decided: Board approves $710K bond for Veterans and First Responders Center

The Board of Finance unanimously approved a $710,000 bonding resolution for the Trumbull Veterans and First Responders Center, covering $703,000 in project costs plus $7,000 in financing costs. The funds will complete construction, with a $300,000 contingency. The board also heard updates on the pavement preservation program and an internal audit of health benefits administration.

Wed Dec 11, 2024

Library Board of Trustees

Trumbull Library Board of Trustees to meet December 11

The Board of Trustees will meet to review reports from the Director, Treasurer, and Fairchild. The session includes updates from subcommittees on finance, bylaws and policy, and branding and marketing.

librarygovernancefinancepolicy
✓ Decided: Library board approves $2,500 smart panel for boardroom

The Trumbull Library Board of Trustees approved spending $2,500 from board funds to purchase and install a smart panel in the boardroom, supplementing $3,456 in outstanding funds. The board also accepted the November 13, 2024 meeting minutes and received updates on building projects, the annual report, and staffing. No other substantive decisions were made.

Wed Dec 11, 2024

Community Facilities Building Committee

Community Facilities Building Committee to discuss project and invoices

The committee will meet to discuss a project with QA&M Architects and review a walking tour of abutting neighbors. The body will also address invoices from QA&M.

community-facilitiesarchitecturetown-planning
✓ Decided: Committee approves design updates for new Trumbull senior/community center

The Community Facilities Building Committee reviewed the latest design for the proposed senior/community center at the Grace Church property, including a raised gym ceiling and added parking gate. They approved two invoices from QA&M Architecture totaling $5,580.06. The project will proceed with traffic counts and a Traffic Commission review in early 2025.

Wed Dec 11, 2024

Conservation Commission

Commission to discuss Pollinator Pathway planting site and approve 2025 meeting dates

The Conservation Commission will consider approving the 2025 meeting schedule and receive updates on the Pollinator Pathway project, including selection of a planting site with the Parks Department. Commissioners will also discuss the Invasives/Vines Team, tree replanting program, and review any pending IWWC applications. No new applications are currently on file.

conservationenvironmentpollinator-pathwaytree-replantinginvasiveswetlandstrumbull
✓ Decided: Commission approves up to $10,000 for Long Hill Green tree planting

The Trumbull Conservation Commission approved spending up to $10,000 from its FY 2024-2025 budget for the purchase and planting of trees at Long Hill Green, per the presented plan. The commission also approved the minutes of October 30, 2024, and accepted the 2025 meeting dates. Other items were discussed but no further decisions were made.

Tue Dec 10, 2024

Trumbull Housing Authority

Trumbull Housing Authority to discuss commissioner insurance coverage

The board will review reports from the Director of Finance, Property Manager, and Executive Director. New business includes a discussion on THC insurance coverage for commissioners, while old business covers emergency repair funding and a lawsuit update.

housinginsurancegovernment-administrationrepairs
✓ Decided: Housing Authority approves first readings of Tenant Selection Plan and Congregate Lease

The Trumbull Housing Authority approved the first readings of the updated Tenant Selection Plan and the Henry Stern Dwelling Lease, both by unanimous consent. The documents will be open for resident comments for 30 days before being revised and brought back for a second reading. The board also approved prior meeting minutes and the 2025 meeting schedule.

Tue Dec 10, 2024

Police Commission

Commission to discuss changing minimum education/military experience for entry-level officers

The Trumbull Police Commission will discuss and consider changing the minimum education and/or military experience requirement for entry-level police officers. The meeting also includes routine items such as public comment, approval of minutes from the November 12 meeting, and the chief's monthly report.

policehiringeducationmilitary-experiencetrumbullpolice-commission
✓ Decided: Police Commission opens applicant pool to high school graduates

The Trumbull Police Commission voted unanimously to eliminate the requirement that entry-level applicants have 60 college credits and/or 2 years of military experience, opening the applicant pool to high school graduates. The decision was based on low staffing levels and competition with other towns. The commission also approved the November 12, 2024 minutes and received the chief's monthly report.

Thu Dec 5, 2024

Trumbull Education & Government Access Television Commission

Commission to discuss 2024-25 budget update and 2025-26 budget requests

The Trumbull Community Television Commission will meet via Zoom on December 5, 2024. Items include public comment, approval of October minutes, updates on replacing two commissioners, and videographer status. The commission will also discuss the current budget and requests for the next fiscal year, along with programming and technical studio updates.

televisionpublic-accessbudgetprogrammingtechnologycommissionmeetings
✓ Decided: Trumbull TV commission approves October minutes, plans budget work

The Trumbull Community Television Commission met via Zoom and unanimously approved the October 2024 minutes. They discussed filling two commissioner vacancies, covering daytime videographer duties, and rescheduling the January 2025 meeting to approve the 2025-26 budget before it is due to the First Selectman. The budget is on track, and the ARPA grant is funding studio upgrades and new cameras. No formal votes were taken on these items; only the minutes were approved.

Thu Dec 5, 2024

Town Council

Rules & Research Committee to consider $17,509 appropriation for school transportation

The Rules & Research Committee of the Trumbull Town Council will meet December 5, 2024, to consider five resolutions. The most significant item is a $17,509 appropriation from the General Fund to cover an overage in non-public school transportation expenses. Other items include the appointment of a member to the Hillcrest Middle School Building Committee and the reappointment of three members to the Golf Course Commission.

town-councilappointmentsbudgetschoolstransportationgolf-coursecommittees
✓ Decided: Council appoints Gerbert to Hillcrest building committee

The Rules & Research Committee approved four appointments and one appropriation. Robert Gerbert was appointed to the Hillcrest Middle School Building Committee, and Joseph Gaudiano, Michelle Dowling, and Nathan Moyer were reappointed to the Golf Course Commission. The committee also passed a $17,509 appropriation for non-public school transportation to the full council without recommendation. All votes were unanimous.

Thu Dec 5, 2024

Town Council

Council considers construction manager for Veterans & First Responders Center

The Legislation & Administration Committee will consider three resolutions. These include approving a construction manager for a municipal project, settling a workers compensation claim, and adopting a formal Town Value Statement.

constructionlegal-settlementmunicipal-policyveterans-affairs
✓ Decided: Town Council adopts Trumbull Value Statement and approves construction manager

The Legislation & Administration Committee unanimously adopted the Town of Trumbull Value Statement (TC30-107) and approved Downes Construction as construction manager for the Veterans & First Responders Center (TC30-105). The committee also authorized the town attorney to settle a workers compensation claim (TC30-106) after an executive session. All votes were unanimous.

Wed Dec 4, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee to vote on construction manager for Phase 2 of Veterans & First Responders Center

The Trumbull Veterans & First Responders Center Building Committee will discuss and vote on selecting a construction manager for Phase 2, funded entirely by ARPA funds. They will also receive updates on Phase 1 including foundation wall shoring, front entrance revisions, deck design, septic system, and sprinkler system. Additionally, they will review the projected timeline for Phase 2, aiming to go out to bid by March with construction expected to take 9–12 months.

veteransfirst-respondersbuilding-committeeconstructionarpa-fundingphase-2project-updatefundraising
Wed Dec 4, 2024

Civil Service Board

Civil Service Board to hear appeal of James Harriott for General Foreman

The Civil Service Board will vote on approving an eligibility list for the Assistant Director of Finance/Risk Manager position and consider an appeal from applicant James Harriott, who was determined not to meet minimum requirements for the General Foreman, Highway Dept. position. The meeting also includes approval of prior meeting minutes and public comments.

civil-servicehiringappealseligibility-listpublic-worksfinanceboard-meeting
Wed Dec 4, 2024

Health Board

Health Board to discuss director applicants and reappoint medical director

The Trumbull Health Board will discuss applicants for the Director position with Tom McCarthy, consider the reappointment of Dr. Kunkel as Medical Director, and review the November health department activity reports. The board will also review the 2025 meeting schedule and approve prior meeting minutes.

health-boardpersonnelmedical-directorpublic-healthmeetingsappointments
✓ Decided: Board appoints acting health director, forms interview panel

The Trumbull Health Board appointed Sue Jacozzi as acting Director of Health and formed an interview panel to review candidates for the permanent position. The board also reappointed Dr. Joel Kunkel as medical director and approved the November meeting minutes. No public comment was received, and no other substantive decisions were made.

Wed Dec 4, 2024

Zoning Board of Appeals

ZBA to consider front setback variances for deck at 18 Sunny Ridge Parkway

The Zoning Board of Appeals will hold a public hearing and vote on a single application for front lot setback variances to build a deck at 18 Sunny Ridge Parkway. The board will also accept November meeting minutes, elect officers, and approve the 2025 meeting schedule.

zoningvariancesresidentialdeckpublic-hearingtrumbull
Tue Dec 3, 2024

Economic & Community Development Commission

Trumbull commission to elect officers, approve 2025 meeting schedule

The Economic & Community Development Commission will elect officers for the upcoming term and approve the 2025 meeting schedule. The director will provide updates on business, community development, planning, grants, and events. Public input will be accepted during the community comment period.

economic-developmentcommunity-developmentplanninggrantselectionspublic-meeting
Tue Dec 3, 2024

Inland Wetlands & Watercourses Commission

Commission to review permit for 35,350 sq ft commercial building at 1 Trefoil Drive

The Inland Wetlands and Watercourses Commission will hold a videoconference meeting to consider a new application for a commercial building with associated parking and grading in a regulated area, and continue discussion on a previous application for a convenience mart. The commission will also approve minutes, set 2025 meeting dates, and elect officers.

wetlandscommercial-buildingpermitpublic-hearingtrumbullinland-wetlands
Mon Dec 2, 2024

Trumbull Day Commission

Trumbull Day Commission to approve October minutes, discuss 2025 entertainment

The commission will approve minutes from October that detail final reports for Trumbull Day 2025, including signed contracts, profits, and planning discussions. They will also discuss entertainment options for the upcoming event.

trumbull-day-commissiontrumbull-dayentertainmentcontractsprofitsvendor-layoutsponsorshipsvolunteers
Mon Nov 25, 2024

Trumbull Housing Authority

Housing Authority to hold executive session on repair bids

The Trumbull Housing Authority is holding a special meeting primarily to go into executive session to discuss repair bids. The agenda includes only procedural items: pledge, roll call, executive session, and adjournment. No public decisions or votes are scheduled on the open agenda.

housing-authorityexecutive-sessionrepairsspecial-meetingtrumbull
Mon Nov 25, 2024

Golf Course Commission

Commission to review FY 2025-2026 budget draft and 10-year course plan

The Golf Course Commission will hear committee reports on the draft FY 2025-2026 budget, a proposed 10-year capital plan, and an irrigation system replacement cost estimated at $3.02 million. An executive session is scheduled for a personnel matter. The commission will also consider a proposed R&R policy change and updates on bunker renovations ($510,000) and tee expansions.

golf-coursebudgetcapital-projectspersonnelirrigationbunker-renovationpolicy-change
Thu Nov 21, 2024

Hillcrest Middle School Building Committee

Committee to review rules, schedule, and professional RFQ for Hillcrest Middle School

The Hillcrest Middle School Building Committee will hold a meeting to discuss three new business items: a review of committee rules, setting the meeting schedule, and a request for qualifications for professional services. The agenda includes public comment and standard procedural items.

building-committeeschool-constructionrfqtrumbullhillcrest-middle-school
Wed Nov 20, 2024

Golf Course Commission

Golf Course Green Sub-Committee meets for update

This is a procedural meeting of the Golf Commission's Green Sub-Committee. The agenda contains only a call to order, a green update discussion, and adjournment. No specific decisions, proposals, or financial items are listed.

golf-coursegreenssubcommitteetrumbull
Wed Nov 20, 2024

Civil Service Board

Civil Service Board to approve Office Manager eligibility list and recruit Highway, Parks supervisors

The Trumbull Civil Service Board will consider approving the eligibility list for Office Manager in the EMS Department, authorizing recruitment for Senior Supervisor in the Highway Department and Assistant Superintendent of Maintenance in the Parks Department, approving a provisional appointment for Assistant Sewer Administrator, and correcting a date error on the Senior Mechanic list. The board will also review a new hire report covering recent appointments.

civil-servicepersonnelhiringpublic-worksparksemstrumbull
Wed Nov 20, 2024

Planning & Zoning Commission

Trumbull P&Z to consider age-restricted housing overlay in industrial zone

The Planning and Zoning Commission will hold a public hearing and regular meeting to consider two zoning text amendments. One would create an Age Restricted Housing Overlay Zone in the I-L2 Industrial zone, allowing housing for those 55+ on lots over five acres. Another would add regulations to comply with Connecticut law. A mini-golf application at 670 Daniels Farm Road has been withdrawn.

zoningtext-amendmentage-restricted-housingindustrial-zonehousingplanning
Wed Nov 20, 2024

Water Pollution Control Authority

WPCA to review Beardsley force-main inspection and Whitney Ave paving

The Water Pollution Control Authority will discuss inspection results for the Beardsley force-main and the 2025 meeting schedule. The body is also considering a payment for paving a trench on Whitney Avenue.

sewageinfrastructurepavingpump-stations
Tue Nov 19, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to review vehicle, building, and staffing updates

The Trumbull EMS Commission will meet on November 19, 2024, to consider routine administrative items including approval of prior meeting minutes. The commission will hear the Chief's Report and discuss old business covering vehicle, building, staffing, and classroom updates. New business includes a discussion on photograph digitization. The agenda is largely procedural with no specific votes or financial actions listed.

emspublic-safetyoperationsmeetingstrumbull
Mon Nov 18, 2024

Parks & Recreation Commission

Park trail mapping project to be presented to Commission

The Parks and Recreation Commission will receive an update from Robert Velthuizen on the trail mapping project, which has mapped 32.4 miles of trails in five parks. The meeting also includes public comment on park maps and review of October minutes that covered litter remediation, playground damage, and equipment issues. Other business may include updates on basketball leagues and the December Tree Lighting event.

parkstrailsrecreationlitterparkingbasketballtree-lightingplayground
Thu Nov 14, 2024

Board of Finance

Board weighs $50,808 school bus transfer, BOE deficit discussion

The Board of Finance will vote on a supplemental appropriation of $17,509 and a transfer of $33,299 to cover a non-public school transportation overage due to higher gas costs. Two other transfers totaling $26,600 would shift funds from salaries to professional services in the Finance and Building departments. Discussion items include the Board of Education's year-end deficit of $144,538 and planned use of the non-lapsing account, plus year-to-date budget reports.

budgetfinanceschoolstransportationtransfersboard-of-educationdeficit
Wed Nov 13, 2024

Community Facilities Building Committee

Community Facilities Building Committee discusses project with QA&M Architects

The committee will meet to discuss a project with representatives from QA&M Architects. The agenda also includes a walking tour for abutting neighbors.

community-facilitiesarchitectureplanning
Wed Nov 13, 2024

Library Board of Trustees

Trumbull Library Board of Trustees to meet November 13

The Board of Trustees will review reports from the Director, Treasurer, and Fairchild. The board will also discuss end-of-year gifts for staff.

librarystaff-giftsboard-meeting
Tue Nov 12, 2024

Police Pension Board

Police pension board to vote on survivor's pension and discuss retired deputy chiefs' benefits

The Trumbull Police Pension Fund Board of Trustees will hear a quarterly investment report from Principal Asset Management, vote on approving a survivor's pension calculation for Carol Rich, and discuss pension issues for retired deputy chiefs. The board will also approve the 2025 meeting schedule and minutes from August.

policepensionboard-of-trusteesmeetingsurvivor-benefitsretiree-benefitsinvestment-report
Tue Nov 12, 2024

Economic & Community Development Commission

Commission to hear director's reports and routine updates

This meeting consists largely of procedural items: approval of previous minutes, chairman's report, and director's report covering business, community development, planning, grants, and events. No specific proposals, rezonings, or contracts with dollar amounts are listed on the agenda.

economic-developmentcommunity-developmentplanninggrantsbusiness-updatetrumbull
Tue Nov 12, 2024

Police Pension Plan B Board of Trustees

Trumbull Police Pension Plan B trustees to receive plan status update, approve 2025 meeting schedule

The board will hear an update on the pension plan’s status from Human Resources Director Thomas McCarthy, then vote on the minutes from August 8, 2024, and approve the 2025 meeting schedule. No major financial decisions or new policies are on the agenda.

pensionpolicetrusteesmeeting-schedule
Tue Nov 12, 2024

Police Commission

Police Commission to interview lateral transfer officer candidate in executive session

The Trumbull Police Commission will interview one lateral transfer police officer candidate in executive session, consider approving the 2025 meeting schedule, and review the chief's monthly report and correspondence. The meeting also includes approval of minutes from the September 18, 2024 special meeting and public comment.

policepersonnelexecutive-sessionmeeting-schedulemonthly-report
Thu Nov 7, 2024

Inland Wetlands & Watercourses Commission

Commission to review permit for convenience store and gas station at 6159 Main St.

The Inland Wetlands and Watercourses Commission will consider permit application 24-32 for demolition of an existing building and construction of a new convenience mart with fueling station at 6159 and 6175 Main Street, within a regulated area. Old business includes a review of pending litigation (Arendt vs. IWWC). The commission will also approve minutes from September 3, 2024, and schedule a field inspection for the application.

wetlandsdevelopmentpermitslitigationconvenience-storetrumbull
Thu Nov 7, 2024

Town Council

Town Council to vote on accepting $766K grant for Unity Park field reconstruction

The Trumbull Town Council will consider five resolutions, including authorizing the first selectman to accept a $766,000 state Urban Action grant for reconstructing athletic field #4 in Unity Park with new drainage, turf, and fencing. Also up for vote are a $57,000 Youth Cannabis Prevention grant application, two fund balance appropriations totaling about $146,000, and approval of the 5-Year Capital Improvement Plan covering over $531 million in projects through 2029.

town-councilgrantsunity-parkcannabis-preventionfund-balancecapital-improvement-planinfrastructure
Wed Nov 6, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee to approve project invoices and contractor payments for Veterans & First Responders Center

The Trumbull Veterans & First Responders Center Building Committee will consider approval of project invoices and scope of work, including a title search invoice related to a $1.5 million DECD grant and payment requests from Nagy Bros Construction and Wiles Architects. Members will also discuss potential change orders for the front entrance, structural fill, and other items, as well as an update on the audio/visual and IT system and fundraising efforts. The meeting includes public comment, approval of previous minutes, and a financial report.

veteransfirst-respondersbuilding-committeeconstructioninvoicesgrantsfundraisingtrumbull
Wed Nov 6, 2024

Health Board

Trumbull Health Board to review 2025 meeting schedule

The Health Board will meet to review the 2025 meeting schedule and the October Health Department activity reports. The agenda includes a review of the October 9, 2024, meeting minutes.

health-departmentschedulingadministrative
Wed Nov 6, 2024

Zoning Board of Appeals

Zoning Board reviews three property variance requests for garages and pool

The Trumbull Zoning Board of Appeals will hold a regular meeting on November 6, 2024, at 7:00 p.m. in Town Hall Council Chambers to accept minutes from the October 9 meeting and act on three property-variance applications. The board will also consider pending litigation involving the ZBA.

zoningvariancesrezoningproperty-developmentpublic-hearing
Mon Nov 4, 2024

Sustainable Team

Trumbull Advisory Sustainability Team holds launch meeting

The Advisory Sustainability Team is meeting to review waste reduction efforts and outreach collaborations. The body will also determine its 2025 meeting schedule.

waste-reductionrecyclingoutreachenvironment
Wed Oct 30, 2024

Town Council

Town Council, Board of Finance to vote on remaining ARPA fund allocations

The Trumbull Town Council and Board of Finance will hold a special joint meeting to consider Resolution TC30-93, which would approve all remaining unallocated and reallocated American Rescue Plan Act (ARPA) funds. The resolution covers $475,555.58 in total funds, including reallocated balances and new requests from department heads. The meeting will also discuss proposed allocations for projects such as a lightning detection system, EMS equipment, park field refurbishments, police gun optics, and public works vehicle replacements.

arpabudgetfinancepublic-safetyparksinfrastructureemergency-services
Wed Oct 30, 2024

Conservation Commission

Aquarion forester to present on Centennial Watershed State Forest at Conservation Commission meeting

The Trumbull Conservation Commission will hear a presentation from Aquarion forester Robert Turnbull regarding the Centennial Watershed State Forest. They will also discuss updates on several ongoing projects, including the proposed new location of the Senior Center, a grant for the Long Hill Upgrade, and the Plan of Conservation Development. The meeting includes approval of previous minutes and updates on IWWC applications and the Invasives/Vines Team. No decisions are expected; this is primarily an informational and discussion session.

conservationwatershedsenior-centerlong-hill-upgradeiwwcpollinator-pathwaypocd
Wed Oct 30, 2024

Board of Finance

Board of Finance and Town Council to vote on allocating remaining $475k in ARPA funds

The Board of Finance and Town Council are meeting jointly to vote on a recommendation from the First Selectman to allocate remaining unallocated and reallocated American Rescue Plan Act (ARPA) funds totaling approximately $475,555.58 to several projects. Proposed allocations include a lightning detection system ($60,000), four Life Pac units for EMS ($182,337.45), parks field refurbishments ($40,000), police gun optic sights ($29,000), public works vehicle replacements ($62,000), camcorders for TCTV ($4,144.06), and a construction manager for a Veterans and First Responders Center ($75,000). A reserve of $23,074.07 would remain. The meeting is held remotely via Zoom with no in-person public attendance.

arpaamerican-rescue-planbudgetfinancepublic-safetyparksemspolice
Tue Oct 29, 2024

Trumbull Housing Authority

Housing Authority to discuss Sentry/WYND, TD Bank, fire panel, heat pumps, and repair quotes

The Trumbull Housing Authority holds a regular meeting to hear reports from staff, consider new business regarding the Sentry/WYND system, and revisit old business including the TD Bank account, fire panel repairs, heat pump maintenance, and the STIF Account. Public comments will be taken, followed by an executive session to discuss quotes for repairs.

housing-authoritytrumbullpublic-housingmaintenancefinancesrepairsexecutive-session
Mon Oct 28, 2024

Golf Course Commission

Golf Course Commission to discuss maintenance barn expansion and facility upgrades

The Commission will review reports from the Director of Golf and the Green Committee. Discussion items include a $20,000 engineering proposal for a maintenance barn expansion and various facility repairs.

golf-coursecapital-improvementsmaintenancebudget
Mon Oct 28, 2024

Town Council

Council committee to vote on $766K Unity Park field grant and $57K cannabis prevention grant

The Legislation & Administration Committee will consider two resolutions: authorizing the First Selectman to submit a funding application for a $57,000 Youth Cannabis Prevention – Cannabis Coalition Grant, and to accept a $766,000 State of Connecticut DECD Urban Action grant for the reconstruction of athletic field #4 at Unity Park.

town-councilgrantsyouth-cannabis-preventionunity-parkathletic-field-reconstructionurban-action-grant
✓ Decided: Council authorizes $766K Unity Park field grant application

The Legislation & Administration Committee unanimously approved two resolutions. The first authorizes the town to apply for a $57,000 state Youth Cannabis Prevention grant. The second authorizes First Selectman Vicki Tesoro to accept $766,000 in state Urban Action grant funds for the reconstruction of athletic field #4 at Unity Park, with no required town match.

Mon Oct 28, 2024

Town Council

Trumbull Finance Committee to consider $531M 5-Year Capital Plan, including school renovations

The Finance Committee will consider three resolutions: a $14,038 fund balance transfer for ancillary services, a $132,103 year-end supplemental appropriation to cover shortfalls in workers' compensation and pension plan services, and approval of the Town's 5-Year Capital Improvement Plan totaling over $531 million for 2024-2029, including major renovations at Hillcrest and Madison Middle Schools, roadway paving, and public facility upgrades.

financebudgetcapital-improvement-planschoolsroadspublic-facilitiesappropriations
Wed Oct 23, 2024

Civil Service Board

Civil Service Board to review new Transfer List rules and approve highway hiring lists

The Trumbull Civil Service Board will hold a special meeting to approve the eligibility list for Senior Mechanic in the Highway Department (internal promotion) and authorize advertising for General Foremen (open competitive). The board will also review and discuss proposed Transfer List rules and procedures, which would allow classified employees to transfer between departments.

civil-servicehighway-departmenthiringpersonneltransfer-listtrumbull
Wed Oct 23, 2024

Water Pollution Control Authority

WPCA to consider $12,815 change order for Old Town Rd sewer project

The Water Pollution Control Authority will vote on a $12,815 change order for the Old Town Road Pump Station force main replacement and revise the 5-year capital plan. The board will also hear cost estimates for the Trefoil Pump Station, discuss preliminary design proposals for three pump stations, and hold an executive session on enforcing an engineer's order for Trumbull Center owners to repair their sewage pipe.

water-pollution-control-authoritysewageinfrastructurecapital-planpump-stationsenforcementexecutive-session
Tue Oct 22, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to discuss vehicle, building, and staffing updates

The Emergency Medical Service Commission will meet to review the Chief's report and address ongoing business. The body will discuss updates regarding vehicles, the building, staffing, and the classroom. New business includes the digitization of photographs.

emspublic-safetystaffingfacilities
Mon Oct 21, 2024

Parks & Recreation Commission

Commission to consider adding trash bins at Old Mine, Indian Ledge, Twin Brooks parks

The commission will hear a public comment from resident Pam Roman requesting additional trash receptacles at Old Mine Park, Indian Ledge, and Twin Brooks parking lots to reduce litter. Correspondence regarding repair or replacement of basketball hoops at Unity Park will also be discussed. Commissioners will receive updates on park maintenance projects and recreation programs.

parkslittertrash-receptaclesbasketball-hoopsrecreationpickleballdredge
Thu Oct 17, 2024

Equity, Diversity and Inclusion Task Force

EDI Task Force to debrief meetings with school superintendent and police chief

The Equity, Diversity and Inclusion Task Force is meeting to discuss old business, including debriefs of recent discussions with Superintendent of Schools Martin Semmel and Police Chief Michael Lombardo. The agenda also includes a book club debrief, diversity training update, value statement update, and coverage in the Trumbull Times. No new business or binding decisions are listed.

equitydiversityinclusiontask-forcetrumbullschoolspolice
Thu Oct 17, 2024

Trumbull Education & Government Access Television Commission

Trumbull TV Commission reviews ARPA-funded THS Studio project, election programming

The Trumbull Education & Government Access Television Commission holds a regular meeting via Zoom on October 17, 2024. Agenda items include approval of September minutes, status updates on replacements and videographer, 2025 meeting schedule, budget update, programming including election coverage, and technical status of THS Studio (ARPA-funded capital project) and Sling Studio. Public comment will be taken.

televisionpublic-accessbudgetprogrammingarpa-fundingeducationgovernment-accesstrumbull
Wed Oct 16, 2024

Golf Course Commission

Golf Course Green Sub-Committee discusses course conditions

This is a routine sub-committee meeting with only one substantive item: a green update on the golf course. No votes, proposals, or financial matters are on the agenda.

golf-courseparks-and-recreationmaintenancesub-committee
Wed Oct 16, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee to review title search invoice for $1.5M grant

This meeting of the Trumbull Veterans & First Responders Center Building Committee will review and approve project invoices, including a title search required by DECD for a $1.5 million grant. Updates will be provided on the Vision Point audio visual/IT system, Phase 1 construction details (front entrance, deck, sprinkler system), and fundraising efforts.

building-committeeveteransfirst-respondersgrantconstructionfundraisingtrumbull
Wed Oct 16, 2024

Civil Service Board

Civil Service Board to approve Senior Mechanic list, discuss Transfer List rules

The Trumbull Civil Service Board will consider approving an eligibility list for Senior Mechanic (Highway Dept., internal promotional only) and a request to advertise for General Foremen (Highway Dept., open competitive). The board will also review and discuss proposed Transfer List rules and procedures. Previous meeting minutes from September 18, 2024 will be approved.

civil-servicehiringhighway-departmentmechanicsforementransfer-listtrumbull
Wed Oct 16, 2024

Planning & Zoning Commission

Applicants request deferral of mini-golf and age-restricted housing hearings

The Planning and Zoning Commission will consider requests to defer two public hearings: a special permit for an 18-hole mini-golf course at 670 Daniels Farm Road and a text amendment to create an Age Restricted Housing Overlay Zone in the I-L2 district. The commission will also take up a third text amendment to comply with Connecticut law and routine items such as minutes and the planner's report.

planningzoningpublic-hearingspecial-permittext-amendmentage-restricted-housingmini-golfdeferral
Tue Oct 15, 2024

Pension Board

Pension Board to vote on benefits for 14 retirees and 2025 meeting dates

The Trumbull Pension Board will receive a third-quarter investment update from Beirne Wealth Consulting, consider approval of 2025 meeting dates (third Tuesday of the month in Jan, Apr, Jul, Oct), and vote on pension benefits for 14 individuals with effective dates from May to September 2024. The board will also approve contribution returns of $2,200 each for four employees and approve minutes from the July 2024 meeting.

pensionbenefitsinvestmentstrumbullretirementpublic-employees
Thu Oct 10, 2024

Board of Finance

Board of Finance to review over $1.4 million in budget transfers and appropriations

The Board of Finance will consider several budget transfers and a supplemental appropriation for the 2023-2024 and 2024-2025 fiscal years. The meeting includes a review of the Town Treasurer's report and year-to-date budget reports for revenues and expenditures.

budgetfinanceappropriationstashua-knolls
Wed Oct 9, 2024

Library Board of Trustees

Trumbull Library Board meets to hear reports and subcommittee updates

This meeting of the Trumbull Library System Board of Trustees is largely procedural. The board will hear reports from the director, treasurer, and Fairchild representatives. Old business includes updates from the Financial, Bylaws and Policy, and Branding and Marketing subcommittees.

libraryboard-of-trusteestrumbullmeetingagenda
Wed Oct 9, 2024

Community Facilities Building Committee

Committee to discuss walking tour and project with architects

The Community Facilities Building Committee will hold a regular meeting to approve minutes from August and September, discuss a walking tour, and engage in project discussion with architects Tom Arcari and Rocco Pettitto of QA&M Architects. The agenda also includes public comment and new business. No specific votes or financial decisions are listed.

community-facilitiesbuilding-committeeproject-updatearchitecturepublic-comment
Wed Oct 9, 2024

Zoning Board of Appeals

Zoning Board to review setback and height variances for residential properties

The Zoning Board of Appeals will consider two applications for variances in Residential Zone A. The requests involve adjusting lot setbacks for a home expansion and a new barn construction.

zoningvariancesresidentialsetbacks
Tue Oct 8, 2024

Police Commission

Trumbull Police Commission to meet October 8

The Police Commission will meet to review the Chief's monthly report and approve minutes from a September 18 special meeting. The agenda consists primarily of procedural items and routine reports.

policepublic-safetygovernment
Tue Oct 8, 2024

Trumbull Day Commission

Trumbull Day Commission receives final reports on event logistics

The Trumbull Day Commission will meet to receive final reports from subcommittees covering carnival and fireworks, entertainment, food trucks, vendors, sponsorships, alcohol sales, rentals, publicity, volunteers, and finances. The meeting is focused on closing out the event's administrative and operational details.

event-planningcommissiontrumbull-dayreportsfinancial
Mon Oct 7, 2024

Town Council

Town Council to consider $842,400 for Whitney Avenue sidewalk improvements

The Town Council will vote on several funding applications, budget appropriations, and a real property sale. The body will also hold public hearings regarding a new sidewalk maintenance ordinance and the sale of land at 6175 Main Street.

infrastructurebudgetzoningpublic-worksgrantslabor-contracts
Thu Oct 3, 2024

Trumbull Day Commission

Trumbull Day Commission to receive final reports on 2024 event

The Trumbull Day Commission will hear final reports from committees and vendors regarding the recent Trumbull Day celebration, covering carnival, fireworks, entertainment, food, vendors, sponsorships, beer and wine sales, rentals, publicity, volunteers, and finances. No decisions or proposals are on the agenda; the meeting is entirely procedural.

trumbull-daycommissionreportseventprocedural
Wed Oct 2, 2024

Trumbull Veterans & First Responders Center Building Committee

Phase 1 design updates, sprinkler system, and AV/IT costs reviewed

The Trumbull Veterans & First Responders Center Building Committee is meeting to review and potentially approve project invoices and scope of work, receive updates on the audio visual and IT system costs, and discuss Phase 1 design changes including front entrance revisions, deck design, and building sprinkler system. The committee will also receive financial reports, discuss fundraising efforts, and track pledges and donations.

building-committeeveteransfirst-respondersphase-1audio-visualsprinkler-systemfundraising
Tue Oct 1, 2024

Economic & Community Development Commission

Economic & Community Development Commission meets for updates

The commission will meet to approve previous minutes and receive reports on business, community development, planning, grants, and events. The agenda consists of procedural updates and an opportunity for community input.

economic-developmentcommunity-developmentplanning
Mon Sep 30, 2024

Town Council

Committee to consider $842,400 state grant for Whitney Avenue sidewalk trail

The Legislation & Administration Committee will consider and act on seven resolutions, including accepting an $842,400 state grant for a sidewalk and trail connection, amending the municipal code to require snow and ice removal from sidewalks, and authorizing the sale of a portion of property at 6175 Main Street. Other items include grants for youth vaping prevention and early voting, a union contract ratification, and a tax appeal settlement.

town-councillegislationinfrastructuresidewalksgrantsvapingsnow-removalproperty-sale
Mon Sep 30, 2024

Town Council

Finance Committee to appropriate $355K from fund balance and contingency

The Trumbull Town Council Finance Committee will consider three resolutions totaling $355,960 in appropriations and transfers. Resolution TC30-88 appropriates $195,171 from the Fund Balance; TC30-89 transfers $120,523 from Contingency; TC30-90 appropriates $39,266 from Fund Balance for equipment/building maintenance. The committee will meet on September 30, 2024, at 7:00 p.m. at Town Hall.

budgetfinancefund-balancecontingencyappropriationtown-counciltrumbull
✓ Decided: Trumbull Finance Committee approves $354,960 in year-end transfers

The Finance Committee unanimously approved three resolutions to close out fiscal year 2024: $195,171 from Fund Balance to various accounts, $120,523 from Contingency for union contract settlements, and $39,266 from Fund Balance for building maintenance. All motions carried unanimously. The committee also discussed election staffing, BOE purchasing, and union contract details.

Mon Sep 30, 2024

Hillcrest Middle School Building Committee

Hillcrest Middle School Building Committee to discuss project and rules

The committee is meeting to discuss the Hillcrest Middle School project and establish operational guidelines. The body will also determine a meeting schedule and elect a Vice-Chairman.

schoolsconstructiongovernment-administration
Wed Sep 25, 2024

Water Pollution Control Authority

Water Pollution Control Authority to review capital plan and repair invoices

The Water Pollution Control Authority will discuss the 5-Year Capital Plan and a year-to-date budget report. The body will also review invoices related to force-main breaks on Whitney Avenue and repairs at the Trefoil Pump Station.

sewerbudgetinfrastructurepublic-works
Wed Sep 25, 2024

Conservation Commission

Conservation Commission to appoint new chairman and new commissioner

The Trumbull Conservation Commission will consider appointing a new chairman and a new commissioner at its September 25 meeting. They will also review an Inland Wetlands and Watercourses (IWWC) application for 139 Canoe Brook Road and receive updates on several ongoing projects, including the proposed new Senior Center location, the 1000 Trees for Trumbull program, and the Pollinator Pathway initiative.

conservationcommissioniwwcsenior-center1000-treespollinator-pathwayinvasivespocd
Tue Sep 24, 2024

Trumbull Housing Authority

Housing Authority to discuss pending litigation in executive session

The Trumbull Housing Authority will hold a regular meeting with reports from the Director of Finance, Congregate Manager, Resident Service Coordinator, Property Manager, and Executive Director, followed by discussion of financials, new and old business, public comments, and an executive session for pending litigation. The agenda is largely procedural with no specific action items listed.

housing-authorityexecutive-sessionfinancecongregatestern-villagepublic-commentregular-meeting
Tue Sep 24, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission discusses vehicle, building, and staffing updates

The Trumbull Emergency Medical Service Commission is meeting to discuss operational updates including vehicles, building renovations, and staffing. They will also review new business items such as a storage/classroom update and EMS Pro. The meeting includes approval of past minutes and public comment.

emsemergency-medical-servicestrumbullcommission-meetingoperationspublic-safety
Mon Sep 23, 2024

Golf Course Commission

Golf Commission to discuss beverage cart deal, bunker consultant transfer

The Trumbull Golf Course Commission will meet on September 23, 2024, to discuss a proposed two-year beverage cart service agreement with concessionaire Domenick Faustini and a fund transfer for a bunker consultant. The commission will also consider a request for retained earnings to install a metal fence along hole #1 and an engineering proposal to expand the maintenance barn. An executive session is scheduled for a contractual matter.

golf-coursecommissionbeverage-cartbunker-consultantfence-installationmaintenance-barncart-paths
Thu Sep 19, 2024

Equity, Diversity and Inclusion Task Force

Task Force to discuss equity initiatives with Economic Development Director

The Equity, Diversity and Inclusion Task Force will hear from Trumbull Economic and Community Development Director Rina Bakalar and review updates on outreach to schools, parks, police, and other initiatives including a book club and diversity training. The meeting also includes public comment and approval of July 18, 2024 minutes.

equitydiversityinclusiontask-forcetrumbullcommunity-outreacheconomic-development
Wed Sep 18, 2024

Civil Service Board

Civil Service Board to discuss Highway and Parks Department recruitment

The Civil Service Board is meeting to consider requests to advertise and recruit for two positions within the Highway and Parks Department. The board will also review minutes from previous August and September meetings.

civil-servicerecruitmenthighway-deptparks-deptemployment
Wed Sep 18, 2024

Planning & Zoning Commission

Zone change and medical office building proposed for 6600 Main Street

The Planning and Zoning Commission will hold a public hearing on four applications: a text amendment to Village Residence District regulations, a special permit for an 18-hole mini-golf course at 670 Daniels Farm Road, a zone change for properties at 6600 Main Street and 107 Broadway from Residence A to B-C Long Hill Green and Town Hall Node, and a special permit for a 12,210-square-foot medical office building on those same properties. The commission will also accept minutes from the August 21, 2024 regular meeting.

zoningpublic-hearingspecial-permitzone-changemedical-officemini-golfhousingplanning
Wed Sep 18, 2024

Police Commission

Police Commission to discuss traffic impact of proposed medical building at 6600 Main Street

The Trumbull Police Commission will discuss and consider the traffic impact of a proposed 12,210-square-foot medical office building at 6600 Main Street. The commission will also vote to approve minutes from the August 13, 2024 meeting and hold an executive session to interview two police officer candidates. The agenda includes routine items such as public comment, correspondence, and the chief's monthly report.

policetrafficdevelopmentmedical-buildingzoningpublic-safety
Tue Sep 17, 2024

Trumbull Nature & Arts Commission

Trumbull Nature & Arts Commission to discuss building updates and ARPA funding

The Commission will meet to review the written Director's report and discuss updates regarding the TNAC building and grounds. The body will also review the status of ARPA funding.

artsnaturebudgetfacilities
✓ Decided: Commission approves prior minutes, hears TNAC funding and program report

The Trumbull Nature & Arts Commission met and approved minutes from September 19, 2023, and June 4, 2024, by unanimous consent. The director reported that the Center will not receive Town ARPA funds, but noted other grants and donations, including $10,000 from Henkel and $2,400 from Werth Foundation. No formal decisions were made beyond the minutes approval; the meeting was informational.

Tue Sep 17, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Roof committee to approve Silktown invoice for Booth Hill Elementary roof project

The Middlebrook and Booth Hill Elementary School Roof Building Committee will meet virtually on September 17, 2024. The agenda includes approval of a Silktown invoice for the period ending August 31, a financial report on the $1,840,000 project, and an update on the Booth Hill roof project. The committee will also approve minutes from the previous meeting and set the next meeting date.

roofschoolconstructionbudgettrumbullpublic-workseducation
✓ Decided: Roof committee approves $210,300 Silktown invoice

The committee approved a $210,300 invoice from Silktown for work on the Middlebrook Elementary School roof project, including labor, flashing, materials, ladders, closing, and cleanup. The project is substantially complete, with skylight installation pending. The committee also approved the August 21, 2024 minutes and reviewed financials showing a total budget of $1,840,000 with $130,785 uncommitted.

Thu Sep 12, 2024

Board of Finance

Board to vote on $357,560 in supplemental appropriations and transfers

The Board of Finance will vote on four financial items: three supplemental appropriations from fund balance and one transfer from contingency, plus an end-of-year transfer within the police department budget. The meeting also includes the town treasurer's report on cash balances and investment income.

financeappropriationsbudgetpolicepublic-workstown-treasurerboard-of-finance
Wed Sep 11, 2024

Library Board of Trustees

Library Board to hear reports, discuss subcommittees

The Trumbull Library Board of Trustees will hold a regular meeting including the approval of minutes from July 10, 2024, reports from the Director and Treasurer, and updates from the Fairchild committee. The Board will also discuss subcommittees on finance, bylaws and policy, and branding and marketing. No new business items are listed.

libraryboard-of-trusteestrumbullmeetingpublic-session
Wed Sep 11, 2024

Golf Course Commission

Golf Course Green Sub-Committee to discuss course conditions

The Green Sub-Committee of the Trumbull Golf Course Commission will meet to discuss updates on course conditions. No votes, financial decisions, or specific proposals are listed on the agenda, which consists solely of a green update and procedural items.

golf-coursegreensmaintenancesubcommitteetrumbull
Wed Sep 11, 2024

Community Facilities Building Committee

Committee to tour Grace Church property at 5958 Main St.

The Community Facilities Building Committee will conduct an outdoor walking tour of the Grace Church property at 5958 Main Street, led by Public Works Director George Estrada. No votes or decisions are scheduled; the meeting is intended for site observation and discussion.

community-facilitiesbuilding-committeeproperty-tourgrace-churchpublic-works
🗳️ How they voted (1 roll-call vote)
Named votes as recorded in the official record.
[context] Meeting Minutes Community Facilities Building Committee September 11, 2024 Present: Lori H
2 yea
O’Brien yea · Dawn Cantafio yea
Wed Sep 11, 2024

Health Board

Trumbull Health Board holds routine meeting with no major decisions

This is a procedural meeting with no specific substantive items. The board will review minutes from June 2024 and activity reports for June, July, and August, along with public comments and old business.

healthpublic-healthboard-meetingtrumbull
✓ Decided: Trumbull Health Board accepts minutes, hears department update

The Trumbull Health Board met on September 11, 2024, and unanimously approved the June 12 meeting minutes. The board received a detailed update from the Director of Health on recent activities, including a renewed emergency preparedness grant, disease surveillance, and community outreach. No old or new business was discussed, and the meeting adjourned at 7:12 p.m.

Mon Sep 9, 2024

Parks & Recreation Commission

Trumbull Parks & Recreation Commission holds procedural meeting with no specific items

The commission is meeting for a regular session with only standard procedural items—call to order, public comment, minutes, correspondence, old and new business, superintendent’s report, division reports, and adjournment. No proposals, public hearings, or budget items are listed on the September 9 agenda.

parksrecreationtrumbullprocedural
Thu Sep 5, 2024

Trumbull Education & Government Access Television Commission

Trumbull Education & Government Access Television Commission to discuss 2025 schedule

The commission is meeting to review administrative updates, including the status of a videographer and replacements for Ed Gillespie. The body will also discuss the 2024-25 budget and election programming.

government-access-tvbudgetelectionspublic-media
✓ Decided: Commission approves July minutes, keeps 6-week meeting cadence

The Trumbull Community Television Commission met via Zoom and approved the July 2024 minutes unanimously. No substantive policy decisions were made; the meeting focused on administrative updates, budget status, programming plans, and staffing. The commission decided to maintain its approximately six-week meeting schedule for 2025.

Thu Sep 5, 2024

Town Council

Trumbull Council to consider $25M bond refunding, hazard plan, sidewalk rules

The Town Council will vote on eight resolutions, including authorizing up to $25 million in general obligation refunding bonds to refinance existing debt, adopting the 2024 Natural Hazard Mitigation Plan to maintain FEMA eligibility, and transferring $365,000 from the fund balance for capital outlay and professional services at Town Hall, EMS, Fleet Maintenance, and Public Works. A public hearing will be held on amending Chapter 17 of the municipal code to require property owners to clear sidewalks of snow, ice, and rubbish within 24 hours.

bondshazard-mitigationfemabudgetappropriationssnow-removalpublic-hearingtown-council
Thu Sep 5, 2024

Board of Assessment Appeals

Board to hear motor vehicle assessment appeals on Sept 5

The Board of Assessment Appeals will hold a session to hear petitions related to assessments on the October 1, 2023 Motor Vehicle Grand List. Hearings run from 3:00 p.m. to 7:00 p.m. in the Nichols Room at Trumbull Town Hall; appointments are not required, but vehicle inspection is requested.

assessment-appealsmotor-vehiclespublic-hearing
✓ Decided: Board of Assessment Appeals rules on 24 vehicle tax appeals

The Board of Assessment Appeals met on September 5, 2024, and voted on 24 motor vehicle assessment appeals. Most petitions were granted in part, several were denied, and some appellants did not appear. One case was deferred pending further information.

Wed Sep 4, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee reviews AV system design and architectural revisions for Veterans Center

The Trumbull Veterans & First Responders Center Building Committee is meeting to review project invoices and architectural proposals. The body will discuss design updates for the front entrance, kitchen, and exterior deck, as well as the installation of an audio visual and IT system.

veterans-centerconstructionarchitectureit-infrastructurefundraising
✓ Decided: Committee approves AV/IT design contract and multiple redesign fees

The Trumbull Veterans & First Responders Center Building Committee approved several contracts and redesign fees, including a $16,100 proposal from VisionPoint for audio-visual and IT system design, and additional services for kitchen, fire suppression, entrance, and deck redesigns. The committee also approved a $62,244 concrete foundation invoice and changed the donation website domain to TrumbullVeteransCenter.com. All votes were unanimous (4-0).

Wed Sep 4, 2024

Zoning Board of Appeals

ZBA considers lot-size and frontage variance for 89 Strobel Road subdivision

The Trumbull Zoning Board of Appeals will hold a public hearing and vote on three variance applications, including a request to subdivide land at 89 Strobel Road despite a 31% lot-size shortfall and 42% frontage deficiency. A neighbor has submitted a letter opposing that application. The board will also consider a garage height variance at 3 Lafayette Drive and a front setback variance at 87 Grayrock Road.

zoningvariancespublic-hearingsubdivisiontrumbull
✓ Decided: ZBA denies 89 Strobel Road subdivision variance, approves two others

The Trumbull Zoning Board of Appeals denied a variance request to subdivide 89 Strobel Road, citing lack of hardship and survey inaccuracies. The board approved a garage height variance at 3 Lafayette Drive and a front setback variance at 87 Grayrock Road, both with conditions.

Tue Sep 3, 2024

Economic & Community Development Commission

Economic & Community Development Commission meets for updates

The commission will meet to approve previous minutes and receive reports on business, community development, planning, grants, and events. The agenda also includes an update from the BRBC and an opportunity for community input.

economic-developmentcommunity-developmentplanninggrants
✓ Decided: Commission hears updates on Trumbull business openings and projects

The Economic & Community Development Commission met on September 3, 2024, and approved the May 7, 2024 minutes as amended. The meeting consisted of reports from the Chairman and Director, covering new business openings, upcoming events, and ongoing projects. No formal votes were taken on substantive matters; the only action was the unanimous approval of the previous minutes.

Tue Sep 3, 2024

Civil Service Board

Civil Service Board to review Assistant Director of Finance eligibility list

The Civil Service Board is holding a special meeting to address new business. The board will consider the approval of the eligibility list for the Assistant Director of Finance/Risk Manager position.

personnelfinancecivil-service
✓ Decided: Civil Service Board approves eligibility list for Assistant Director of Finance/Risk Manager

The Trumbull Civil Service Board met in a special Zoom meeting and approved the eligibility list for the Assistant Director of Finance/Risk Manager position. The motion passed unanimously with a 3-0 vote. The meeting then adjourned.

Tue Sep 3, 2024

Inland Wetlands & Watercourses Commission

Public hearing on permit for fill and detention galleries at 139 Canoe Brook Road

The Inland Wetlands and Watercourses Commission will hold a public hearing on Application 24-20 from Lawrence Mucherino for permit approval of previously placed fill and installation of detention galleries within a regulated area at 139 Canoe Brook Road. The commission will also vote to approve minutes from July 2 and July 22, 2024, and schedule field inspections.

wetlandspublic-hearingpermitfilldetention-galleriescanoe-brook-roadtrumbull
✓ Decided: Wetlands commission approves Canoe Brook Road fill and drainage project

The Inland Wetlands and Watercourses Commission unanimously approved a permit for Lawrence Mucherino to legalize previously placed fill and install detention galleries at 139 Canoe Brook Road, subject to six conditions including plantings within one year and weekly site monitoring. The public hearing was closed unanimously, and minutes from July 2 and July 22, 2024, were accepted.

Thu Aug 29, 2024

Town Council

Trumbull to consider hazard mitigation plan and sidewalk maintenance rules

The Legislation & Administration Committee will discuss adopting a 2024 Natural Hazard Mitigation Plan to maintain FEMA funding eligibility. The committee is also considering an amendment to the municipal code regarding the removal of snow, ice, and rubbish from sidewalks.

emergency-managementfemapublic-worksordinancessidewalks
✓ Decided: Town Council adopts 2024 Hazard Mitigation Plan; holds sidewalk snow ordinance

The Legislation & Administration Committee unanimously adopted the 2024 Natural Hazard Mitigation Plan Update, which makes Trumbull eligible for FEMA mitigation grants and maintains a 10% flood insurance discount. The committee also held in committee a proposed ordinance that would shift sidewalk snow and ice removal responsibility from the town to property owners, for further discussion.

Thu Aug 29, 2024

Town Council

Finance Committee considers $25M bond refunding and $365K in capital appropriations

The Trumbull Town Council Finance Committee will consider a resolution authorizing up to $25 million in general obligation refunding bonds to refinance existing debt and achieve savings. The committee will also vote on five supplemental appropriations totaling $365,000 from the Fund Balance for capital projects, including Town Hall improvements, an EMS carport, fuel station renovation, sidewalk repairs, and Whitney Trail head design.

financebondscapital-appropriationsfund-balancetown-hallemspublic-workssidewalks
✓ Decided: Council approves $25M bond refinancing, 5 fund appropriations

The Finance Committee approved a resolution authorizing up to $25 million in general obligation refunding bonds to refinance callable bonds from 2014 at a lower interest rate, with estimated net savings of $600,000 to $700,000. The committee also approved five fund balance appropriations for capital projects: $95,000 for Town Hall conference room and Council Chambers chairs (4-1), $25,000 for an EMS chase car port, $70,000 for DPW fuel pump design, $80,000 for townwide sidewalk maintenance, and $95,000 for a Whitney Trailhead parking feasibility study. All other motions carried unanimously.

Wed Aug 28, 2024

Trumbull Housing Authority

Housing Authority to discuss Stern Village repair proposals in executive session

The Trumbull Housing Authority will hold a regular meeting on August 28, 2024 via Zoom, including public comments, reports from staff, and a treasurer's report. The board will then enter executive session to discuss proposals for repairs at Stern Village. Financial documents provided show an operating gain of $18,240 for July, but also note higher-than-budgeted vacancies and cash flow adjustments.

housingfinancerepairsstern-villagevacanciespublic-housingexecutive-session
Wed Aug 28, 2024

Trumbull Housing Authority

Trumbull Housing Authority to discuss Stern Village capital needs

The Trumbull Housing Authority is holding a special meeting to discuss a Capital Needs Assessment for Stern Village.

housingcapital-improvementsstern-village
Wed Aug 28, 2024

Conservation Commission

Conservation Commission to appoint new chairman, discuss Senior Center location

The Conservation Commission will meet to appoint a new chairman following the resignation of the previous chair and consider a proposed new commissioner. They will also discuss updates on the proposed new location of the Senior Center, review Inland Wetlands Watercourses Commission (IWWC) applications, and receive updates on various conservation initiatives. Additionally, they will review the Plan of Conservation Development (POCD) and accept public comments on the SW CT Climate Action Plan.

conservationwetlandssenior-centeriwwcplanningclimate-actionpollinator-pathway
✓ Decided: Commission advances Pollinator Pathway program, co-chairs appointed

The Trumbull Conservation Commission approved moving forward with a Pollinator Pathway program led by Pam Roman, with plans to partner with local groups and identify planting sites. The Commission also agreed to have Tim Coughlin and John Massari serve as co-chairs, and discussed a potential new commissioner, Mark Schroeder. No formal votes were taken on these items; decisions were made by consensus.

Tue Aug 27, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to review vehicle, building, and staffing updates

The Emergency Medical Service Commission will meet to discuss operational updates and new business. The agenda includes reports on staffing and facilities, as well as training supplies.

emspublic-safetystaffingfacilities
✓ Decided: EMS Commission approves July minutes, hears fleet and staffing updates

The Trumbull EMS Commission met on August 27, 2024, and approved the minutes from the July 23 meeting. No substantive decisions were made; the meeting consisted of routine reports and discussions on fleet, building, staffing, and training space. The chief's report noted no fleet issues, full EMT and paramedic staffing, and ongoing initiatives like adding TXA to the formulary.

Mon Aug 26, 2024

Golf Course Commission

Golf Course Commission to discuss $26K fence project and FCIAC championship request

The Trumbull Golf Course Commission will consider a proposed $26,000 metal fence along hole #1 (with a $14,000 donation) and an engineering proposal for a $20,000 maintenance barn expansion. The commission will also review a request from FCIAC to host its boys golf championship on October 17, 2024. Updates from the director of golf, green committee, finance, and other subcommittees are on the agenda. The meeting includes audience participation and approval of prior minutes.

golfparksfacilitiesbudgeteventscommitteestrumbull
✓ Decided: Commission approves $12,925 fence and gate near first tee

The Golf Course Commission approved a $12,925 transfer from the Maintenance Account to the Capital Account for a steel fence and gate along the parking lot near the first tee. They also approved the FCIAC Boys Golf Championship request for October 17 at no charge, and approved a modification agreement for golf course management. No other substantive decisions were made.

Thu Aug 22, 2024

Middlebrook Elementary School HVAC Improvements Building Committee

Middlebrook Elementary School HVAC Committee to review Bismark cost estimate

The building committee is meeting to discuss project updates and financial reports for HVAC improvements. The body will review a cost estimate from Bismark and an invoice from Silver Petrucelli.

schoolshvacbudgetconstruction
✓ Decided: HVAC committee approves $2,640 invoice, advances bid packages

The Middlebrook Elementary School HVAC Improvements Building Committee approved a $2,640 invoice from Silver Petrocelli and discussed project updates, including asbestos abatement costs and bid package timelines. No major construction contracts were awarded; the project remains in the design and bidding phase.

Wed Aug 21, 2024

Civil Service Board

Civil Service Board to approve eligibility lists for two town positions

The board will vote on eligibility lists for Youth Services Coordinator at the library and Police Social Worker for the police department. They will also approve minutes from the previous meeting and hear public comments.

civil-servicehiringyouth-servicespolice-social-workertrumbullpublic-meeting
Wed Aug 21, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review Booth Hill Elementary School roof project costs

The committee is meeting to discuss the status of the Booth Hill Elementary School roof project. The body will consider approving several invoices and change orders for roof work.

schoolsconstructionbudgetroofing
Wed Aug 21, 2024

Planning & Zoning Commission

P&Z to consider zone change and apartment construction at 6567 Main Street

The Planning and Zoning Commission will hold a public hearing to discuss a zoning text amendment and two requests for the property at 6567 Main Street. The commission will also review a pre-application for a commercial use change at 7091 Main Street.

zoninghousingpublic-hearingcommercial-use
✓ Decided: Trumbull P&Z approves rezoning and 3 affordable apartments at 6567 Main St

The Planning and Zoning Commission approved a zone change for 6567 Main Street from Residence A to B-C Long Hill Green and Town Hall Node, and a special permit to legalize three unpermitted second-floor apartments. Both approvals were unanimous (4-0) and conditioned on deed-restricting the apartments as affordable. The public hearing for a separate text amendment (File #24-12) was deferred to September 18.

Wed Aug 14, 2024

Community Facilities Building Committee

Committee discusses Grace Church and Hardy Lane schematic designs, considers architecture invoice

The Community Facilities Building Committee will hold a regular meeting on August 14, 2024, to discuss schematic designs for the Grace Church Property and Hardy Lane projects with QA&M Architecture. The committee will also consider an invoice from QA&M as new business and approve the minutes from the July 10 meeting.

community-facilitiesbuilding-committeeschematic-designgrace-church-propertyhardy-laneinvoicepublic-comment
✓ Decided: Committee reviews Grace Church site for senior center, approves $75K architect invoice

The Trumbull Community Facilities Building Committee held a public hearing on the Grace Church property as a potential senior and community center, hearing resident concerns about traffic, safety, and property values. QA&M Architecture presented a preliminary site suitability assessment, noting the property is suitable but the existing church building is in poor condition and cannot accommodate the senior center programming. The committee unanimously approved a $75,000 payment to QA&M for 90% of the Hardy Lane schematic design work, and the town's purchase of the Grace Church property is scheduled to close on August 15, 2024.

Tue Aug 13, 2024

Police Pension Board

Board to review investment policy, approve officer pension calculations

The Trumbull Police Pension Fund Board of Trustees will discuss a 5-year review of the investment policy statement with Principal Asset Management, approve pension calculations for Officer Thomas Dzurenda and a survivor's pension for Linda Dzurenda, consider escalator increases for retired chiefs, and discuss a request from a retired deputy chief to review his pension.

policepensioninvestmentsretirement
✓ Decided: Police pension board approves Savarese pension review, other benefits

The Trumbull Police Pension Fund Board of Trustees approved pension calculations for Thomas Dzurenda, a monthly benefit for Linda Dzurenda under a QDRO, and escalator increases for retired chiefs. They also approved a request by retired Deputy Chief Thomas Savarese to review and adjust his pension according to his contract, subject to verification by USI. The board received a quarterly investment report and saw no need to change the investment policy statement.

Tue Aug 13, 2024

Police Commission

Police Commission to discuss traffic impact of proposed mini-golf at Plasko’s Farm

The Police Commission will consider the traffic impact of a proposed 18-hole miniature golf course at 670 Daniels Farm Road. The body will also hold an executive session to discuss promotions.

trafficzoningpublic-safetyparkingpromotions
Mon Aug 12, 2024

Parks & Recreation Commission

Trumbull Parks Commission to discuss Indian Ledge Field, Babe Ruth tournament, summer programs

The commission will hear public comment on the CT Rush Tournament, consider minutes from June, and receive updates on old business including Indian Ledge Field improvements, the Farmers Market at Twin Brooks, and the Rails to Trails path. New business may include a request for the Babe Ruth Tournament at Unity Park or Indian Ledge. The superintendent and division reports will cover summer recreation programs, pool hours, park maintenance, and ranger activities.

parksrecreationindian-ledge-fieldbabe-ruth-tournamentfarmers-markettrailssummer-programsmaintenance
✓ Decided: Commission approves CT Rush tournament for Columbus Day weekend

The Parks and Recreation Commission unanimously approved the CT Rush tournament to be held October 11-13 on the best available fields, subject to the field use policy. The commission also discussed tournament policies, with the superintendent proposing a letter requiring all tournaments to pay at the Group 10 level and cover any additional costs. No other substantive decisions were made.

Thu Aug 8, 2024

Board of Finance

Board of Finance to vote on $345K in supplemental appropriations from fund balance

The Board of Finance will vote on five supplemental appropriations totaling $345,000 from the fund balance for capital projects: Town Hall conference room upgrades, an EMS vehicle carport, fuel station renovation, townwide sidewalk repairs, and Whitney Trail head design. The board will also discuss year-to-date budget reports for expenditures and revenues, and the fund balance report.

board-of-financebudgetappropriationscapital-projectspublic-workstown-hallems
✓ Decided: Board of Finance approves $345K in supplemental appropriations from fund balance

The Trumbull Board of Finance approved five supplemental appropriations totaling $345,000 from the fund balance for capital projects previously removed from the bonding resolution, including Town Hall improvements, an EMS carport, fuel station renovation, sidewalk repairs, and Whitney Trail head design. All motions passed unanimously (6-0). The board also approved the July 11, 2024 meeting minutes as amended, and received updates from the Internal Auditor and Treasurer.

Thu Aug 8, 2024

Police Pension Plan B Board of Trustees

Trumbull Police Pension Plan B Board of Trustees holds organizing meeting

The Board of Trustees is meeting to organize the Police Pension Plan B, which became effective July 1, 2024. The session includes an overview of the plan, the election of officers, and the selection of vendors.

policepensionretirementbenefits
Thu Aug 8, 2024

Sustainable Team

Trumbull Advisory Sustainability Team holds launch meeting

The Advisory Sustainability Team is meeting to review previous minutes and discuss environmental initiatives. The group will address waste reduction, nature projects, and community outreach.

environmentwaste-reductionrecyclingcommunity-outreach
✓ Decided: Trumbull sustainability team approves minutes, plans recycling and native plant events

The Trumbull Advisory Sustainability Team approved the 4/1/24 meeting minutes and discussed ongoing initiatives, including a native plant distribution, recycling drives, and a mattress recycling event. No formal votes were taken on new policies; the meeting was primarily informational and planning-focused.

Wed Aug 7, 2024

Trumbull Veterans & First Responders Center Building Committee

Phase 1 update, staff hire proposal, and marketing consultant engagement

The Trumbull Veterans & First Responders Center Building Committee will discuss Phase 1 of the project, including the building sprinkler system and kitchen. They will review financial reports and project invoices, and consider proposals to hire a staff member for tracking pledges and plaques and to engage a marketing consultant. Fundraising and technology updates are also on the agenda.

veteransfirst-respondersbuilding-committeephase-1sprinkler-systemkitchenstaffingmarketing
Wed Aug 7, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review Booth Hill roof update, approve invoices

The Middlebrook and Booth Hill Elementary School Roof Building Committee will meet to approve minutes from July 17, 2024, and receive a financial report. The main focus will be an update on the Booth Hill Elementary School roof project, which is approximately 70% complete. The committee will consider approval of a Silktown invoice and an Antinozzi Associates invoice (#971844605) for $4,130.00 in construction administration fees.

roofschoolconstructionfinancetrumbullelementary-schoolbuilding-committee
✓ Decided: Roof project 95% complete; change orders and invoices tabled

The Middlebrook and Booth Hill Elementary School Roof Building Committee met on August 7, 2024, but lacked a quorum, so no substantive decisions were made. The project is approximately 95% complete, with all work expected to be done by the start of school. Several items, including approval of past minutes, a Silktown invoice, and an Antinozzi invoice, were tabled to the next meeting. Change orders totaling a net add of $19,120.73 were discussed but will be presented for approval at the next meeting.

Wed Aug 7, 2024

Zoning Board of Appeals

ZBA to weigh parking reduction for restaurant at 123 Monroe Turnpike

The Trumbull Zoning Board of Appeals will hold a regular meeting on August 7, 2024, at 7:00 p.m. to conduct public hearings on seven variance applications. One application (24-18) has been withdrawn. The board will consider and act on requests including commercial parking reductions and residential setback variances.

zoning-board-of-appealsvariancesresidentialcommercialparkingsetbackstrumbull
✓ Decided: Trumbull ZBA approves 7 variances, including 900 White Plains Rd mixed-use project

The Trumbull Zoning Board of Appeals approved all seven variance applications on its August 7, 2024 agenda, each by a 5-0 vote. The most consequential was a set of variances for 900 White Plains Road, allowing reconstruction of retail and office space with conditions, including withdrawal of a pending court appeal. All other applications were approved with conditions, except one that was withdrawn by the applicant.

Tue Aug 6, 2024

Economic & Community Development Commission

Economic & Community Development Commission to hear director’s reports, approve prior minutes

The commission will meet for routine business, including approval of May 7 minutes, chairman’s report, and director’s updates on business, community development, planning, grants, and events. The agenda is primarily procedural with no specific action items listed.

economic-developmentcommunity-developmentplanninggrantscommission-meetingtrumbull
Mon Aug 5, 2024

Town Council

Town Council to consider referendum for new $142.375 million Hillcrest Middle School

The Town Council will discuss a referendum for the construction of a new Hillcrest Middle School and hold a public hearing on the CDBG COVID-19 Local Meals program. The body will also consider several grant applications and fund appropriations.

educationbondsgrantspublic-hearingreal-estatebudget
Mon Jul 29, 2024

Town Council

Town Council to consider putting $142.4M Hillcrest Middle School bond to voters

The Legislation & Administration Committee of the Trumbull Town Council will consider six resolutions at its July 29, 2024 meeting, including a measure to submit a $142,375,000 bond referendum for a new Hillcrest Middle School to voters in November. Other items include approving a five-year lease for town office space at 2 Daniels Farm Rd, authorizing grant applications for a community garden and emergency operations center improvements, and empowering the First Selectman to appoint an assessor without a fixed term.

educationschoolsbondsreferendumleasinggrantsemergency-managementassessor
✓ Decided: Hillcrest Middle School $142.375M bond referendum set for Nov. 5

The Town Council's Legislation & Administration Committee unanimously approved placing the $142,375,000 Hillcrest Middle School bond appropriation on the November 5, 2024 ballot. The committee also authorized the Town Clerk to prepare explanatory text for the referendum. Other actions included approving grant applications for an ADA-accessible community garden and emergency operations improvements, and empowering the First Selectman to appoint an assessor without a fixed term.

Mon Jul 29, 2024

Town Council

Finance Committee to consider $78,000 in fund balance appropriations

The Trumbull Town Council Finance Committee will meet on July 29, 2024, to consider two resolutions appropriating a total of $78,000 from the Fund Balance for professional services. Resolution TC30-72 would allocate $40,000 to Planning & Zoning professional services, and Resolution TC30-73 would allocate $38,000 to Town Council professional services.

financeappropriationsfund-balancetown-councilplanning-and-zoning
✓ Decided: Town Council Finance Committee approves $78K in supplemental funds

The Finance Committee unanimously approved two resolutions appropriating a total of $78,000 from the Fund Balance: $40,000 for the Plan of Conservation and Development rewrite and $38,000 for the external auditor contract. Both items were recommended for emergency legislation. No other substantive decisions were made.

Thu Jul 25, 2024

Trumbull Education & Government Access Television Commission

Commission to review final 2023-24 budget and Ed Gillespie replacement

The Trumbull Community Television Commission will meet to approve June 2024 minutes and receive updates on administrative, finance, programming, technical, and marketing items. Key discussion topics include the final status of the 2023-24 budget and the status of replacing former member Ed Gillespie. The meeting is largely procedural with no major votes or public hearings scheduled.

televisioncommissionbudgetpublic-accessprogrammingadministrative
✓ Decided: Trumbull TV commission approves June minutes, plans ARPA-funded studio upgrades

The Trumbull Community Television Commission met via Zoom and unanimously approved the June 2024 minutes. Members discussed plans to replace the THS Studio headend and Sling Studio, rolling the costs into ARPA funds, and noted the 2023-24 budget came in under budget. No other formal votes were taken; remaining items were status updates and action assignments.

Wed Jul 24, 2024

Water Pollution Control Authority

Public hearing on proposed sewer rate increase for residential customers

The Water Pollution Control Authority will hold a public hearing on proposed sewer user rates for FY2024-2025. The only change is a slight increase in the residential sewage treatment fee from $6.478 to $6.488 per CCF; all other rates remain unchanged. After the hearing, the commission will discuss final adoption of the rates, repairs to the Trefoil Pump Station, updates on ongoing pump station and force-main projects, and a request for a six-month extension to begin construction of a pump station at Trumbull Town Center.

watersewerratespublic-hearinginfrastructurepump-stationtrumbull
✓ Decided: WPCA approves sewer rate increase and $150K emergency pump repair

The Trumbull Water Pollution Control Authority approved the FY 2024-2025 sewer user rates, with the residential rate increasing slightly from $6.478 to $6.488 per CCF to match Bridgeport's rate. The board also approved emergency repairs at the Trefoil pump station with a not-to-exceed cost of $150,000. A six-month extension for the Trumbull Town Center pump station was approved with conditions requiring pipe repair or pump station construction by November 1, 2024.

Tue Jul 23, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to discuss vehicle, building, staffing updates

The commission will review and approve minutes from May 21, 2024, hear the chief's report, and discuss updates on vehicles, facilities, and staffing as old business. New business items include a storage/classroom update, training supplies, and the EMS Pro program. No specific decisions or financial items are on the agenda beyond routine operational updates.

emergency-medical-servicesoperationsstaffingvehiclesfacilities
✓ Decided: EMS Commission approves $8,000 for training supplies and $800 for golf tournament

The Trumbull EMS Commission unanimously approved up to $8,000 for classroom training supplies and up to $800 for a foursome in a golf tournament at the EMS Pro Conference. They also approved the minutes from the previous meeting with an amendment to the March minutes, and changed the August meeting date to August 27, 2024. No other substantive decisions were made.

Mon Jul 22, 2024

Inland Wetlands & Watercourses Commission

Commission to decide permit for home construction in wetlands area on West Mischa Road

The Inland Wetlands and Watercourses Commission will hold a special videoconference meeting to consider a permit application (24-06) from David Arendt to construct a single-family residence within a regulated area at Lot 4 West Mischa Road. The commission will also vote to approve the meeting minutes from July 2, 2024.

wetlandspermitconstructionresidentialland-usetrumbull
✓ Decided: Wetlands commission denies West Mischa Road home permit

The Inland Wetlands & Watercourses Commission denied Application 24-06 to build a single-family home at Lot 4 West Mischa Road, citing adverse wetland impacts and feasible alternatives. The denial was approved unanimously after an amendment referencing specific regulations. Minutes from July 2, 2024 were postponed to the next meeting.

Thu Jul 18, 2024

Equity, Diversity and Inclusion Task Force

Task Force Discusses Diversity Training RFP and Department Outreach

The Equity, Diversity and Inclusion Task Force will discuss old business including a Diversity Training RFP, updates on inviting town departments to attend meetings, and recent coverage in the Trumbull Times. They will also receive a written report from the Superintendent of Schools as new business.

equitydiversityinclusiontrainingrfppublic-hearingschoolscommunity-outreach
✓ Decided: Trumbull EDI task force cancels August meeting, plans September

The Equity, Diversity and Inclusion Task Force voted to cancel its August meeting and scheduled the next meeting for September 19. Members discussed Superintendent Semmel's report on diversity efforts and agreed to meet with him to clarify the task force's role. The task force also declined to endorse a website link request from Rehab.com.

Wed Jul 17, 2024

Civil Service Board

Civil Service Board to discuss recruiting for Parks & Recreation manager roles

The Civil Service Board is meeting to consider requests to advertise, test, and recruit for three positions within the Trumbull Parks & Recreation Department. The board will also review minutes from a previous special meeting.

civil-servicerecruitmentparks-and-recreationhiring
Wed Jul 17, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review Booth Hill roof finances and approve contractor invoices

The Middlebrook and Booth Hill Elementary School Roof Building Committee will meet to discuss financial updates and the status of the Booth Hill roof project, and to consider approving invoices from Silktown and Antinozzi. The Middlebrook Elementary roof project is also on the agenda but no specific action items are listed.

roofschoolstrumbullbuilding-committeeconstructioninvoicesfinancial-update
Tue Jul 16, 2024

Pension Board

Pension Board to review investments, approve $4,905 in benefits & $37,045 contribution

The Pension Board will hear an investment update from Beirne Wealth Consulting, elect officers, and vote on approving pension benefits totaling $4,904.93 and a contribution return of $37,045.20. The board will also approve minutes from April 16, 2024.

pensionboardinvestmentsbenefitscontribution-returnmunicipalfinance
Thu Jul 11, 2024

Board of Finance

Trumbull reports projected unassigned fund balance of $32,529,948

The Board of Finance is reviewing unaudited financial projections through June 30, 2024. The report details the town's unassigned fund balance and supplemental appropriations for various capital projects. It also includes a treasurer's report on cash balances and investments totaling over $60 million.

financebudgetfund-balancetown-administrationparkssenior-center
Wed Jul 10, 2024

Community Facilities Building Committee

Committee to discuss project update and QA&M invoice

The Community Facilities Building Committee will review the minutes from the June 12, 2024 meeting. The agenda also includes a project update and discussion of a QA&M invoice.

buildingfinanceproject-update
Wed Jul 10, 2024

Library Board of Trustees

Trumbull Library Board reviews reports and subcommittee updates

The Trumbull Library System Board of Trustees will review reports from the Director and Treasurer. The meeting also includes updates on financial, bylaws, and branding subcommittees. No specific new business items are listed in this agenda.

libraryreportssubcommittee
Mon Jul 8, 2024

Fair Rent Commission

Fair Rent Commission to review two rental complaints

The Fair Rent Commission will hear two rent-related complaints involving properties at The Royce. The meeting also includes the approval of March 11, 2024 minutes and staff reports.

renthousingcomplaints
Tue Jul 2, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee reviews project invoices and new service proposals for the building project

The committee will review project invoices and discuss updates on Phase 1 of the center's construction. Discussions include the building's required sprinkler system, kitchen redesign, and fundraising efforts. They will also consider several additional service proposals from architects and engineers.

veteransconstructionbudgetfundraisinginfrastructure
Tue Jul 2, 2024

Inland Wetlands & Watercourses Commission

Permit for new residence at Lot 4 West Mischa Road up for review

The Commission will hold a continued public hearing regarding a single-family home on West Mischa Road and consider a new application for work at 139 Canoe Brook Road. The meeting also includes the approval of June 4, 2024 minutes.

wetlandshousingconstructiontrumbullzoning
Mon Jul 1, 2024

Civil Service Board

Trumbull Civil Service Board to review personnel lists and recruitment requests

The Civil Service Board will meet to approve eligibility lists and provisional hires for several town positions. The board will also consider requests to begin recruiting for a Police Social Worker and an Assistant Director of Finance/Risk Manager.

civil-servicehiringpolicefinancerecruitmenttrumbull
Mon Jul 1, 2024

Town Council

Trumbull Town Council considers $142,375,000 for new Hillcrest Middle School

The Town Council will consider a resolution to appropriate $142,375,000 for the construction and renovation of a new Hillcrest Middle School. The agenda also includes proposals for a property acquisition from Grace Episcopal Church and a five-year lease at 2 Daniels Farm Rd.

schoolbudgetconstructionreal estateappointments
Wed Jun 26, 2024

Demolition Review Committee

Public hearing for proposed demolition at 6400 Main Street

The Trumbull Demolition Review Committee will hold a public hearing on June 26, 2024. The committee is scheduled to discuss the proposed demolition of a property located at 6400 Main Street.

demolitionpublic-hearing
Wed Jun 26, 2024

Conservation Commission

Trumbroll Conservation Commission to vote on new Chair following Chair Post's departure

The commission will vote to approve a new Chair and discuss the search for new commissioners. Members will also receive updates on the 1000 Trees for Trumbull project and upcoming IWWC public hearings for 4 Mischa Road. The agenda includes discussions regarding community outreach and website updates.

leadershipenvironmentpublic-hearingcommunity-outreachtrees
Wed Jun 26, 2024

Planning & Zoning Commission

Proposed self-storage development at 6 Cambridge Drive

The Commission will consider a site plan for new self-storage buildings at 6 Cambridge Drive. They will also review a request to extend the prohibition of cannabis establishments for one year. Additionally, the Commission will receive a report regarding property purchases from Grace Episcopal Church.

zoningcannabisself-storagereal estatepublic hearing
Wed Jun 26, 2024

Water Pollution Control Authority

Trumbull WPCA to discuss senior tax relief and utility updates

The Water Pollution Control Authority will consider a senior assessment relief request for 70 Skyview Drive. The meeting also includes updates on pump stations, the Williams Road project, and the Bridgeport WPCA proposed budget.

waterutilitiesbudgetsenior-reliefinfrastructure
Wed Jun 26, 2024

Police Commission

Police Commission holds special meeting to interview officer candidates

The Trumbull Police Commission is holding a special meeting to conduct interviews for police officer candidates. This portion of the meeting will be held in executive session.

policehiringpersonnel
Tue Jun 25, 2024

Trumbull Housing Authority

Trumbull Housing Authority to hold executive session on union negotiations

The Trumbull Housing Authority will conduct its regular meeting via Zoom on June 25, 2024. The agenda includes departmental reports and an executive session to discuss a union issue for negotiation.

housingunionnegotiationslocal-government
Tue Jun 25, 2024

Middlebrook Elementary School HVAC Improvements Building Committee

Committee to discuss hazardous material abatement design for Middlebrook HVAC project

The committee will review a proposal from Eagle Environmental for hazardous building materials abatement design services. Members will also receive an update regarding the project's construction manager and commissioning agent. An invoice from Eagle Environmental is also scheduled for review.

middlebrook-elementaryhvacconstructionhazardous-materialstrumbull
Mon Jun 24, 2024

Golf Course Commission

Trumbull Golf Course Commission manages maintenance and power utility issues

The Commission is overseeing several maintenance projects at Tashua Knolls, including bathroom repairs and entrance upgrades. Officials are also working to address power cable disruptions caused by UI.

golfmaintenancetashua-knollsutilities
Mon Jun 24, 2024

Town Council

Trumbull considers $142 million appropriation for new Hillcrest Middle School

The Legislation & Administration Committee will review resolutions regarding the construction and renovation of a new Hillcrest Middle School. The committee will also consider a property acquisition from Grace Episcopal Church and a five-year lease for space at 2 Daniels Farm Rd.

schoolbudgetreal estateconstructiongovernment
Thu Jun 20, 2024

Equity, Diversity and Inclusion Task Force

Discussion of diversity training RFP and department meeting updates

The Equity, Diversity and Inclusion Task Force will discuss the Diversity Training RFP and updates regarding invitations to town departments for meetings. The agenda also includes acknowledgments for Juneteenth and Pride Month.

equitydiversitytraininggovernmenttrumbull
Thu Jun 20, 2024

Trumbull Day Commission

Trumbull Day event logistics and planning

The Trumbull Day Commission will discuss various logistical items for the upcoming event. Topics include food trucks, entertainment, vendors, sponsorships, and beer and wine sales. The commission will also address field lining and layout.

trumbull-dayevent-planninglogistics
Thu Jun 20, 2024

Trumbull Education & Government Access Television Commission

Trumbull TV Commission to discuss budget updates and leadership changes

The commission will review the May 2024 minutes and discuss finding a replacement for departing member Ed Gillespie. The meeting also includes updates on the 2023-24 and 2024-25 budgets and THS graduation coverage.

trumbulltelevisionbudgeteducationprogramming
Tue Jun 18, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to review vehicle, building, and staffing updates

The Trumbull Emergency Medical Service Commission will receive reports regarding vehicles, buildings, and staffing. The meeting also includes an update on storage and classroom space.

emsstaffingfacilitiestrumbull
Mon Jun 17, 2024

Demolition Review Committee

Public hearing to view a structure proposed for demolition at 6400 Main Street

The Trumbull Demolition Review Committee will hold a public hearing on June 17, 2024. The committee will view a structure at 6400 Main Street that is proposed for demolition.

demolitionpublic-hearingproperty
Thu Jun 13, 2024

Board of Finance

Resolution to appropriate $142,375,000 for a new Hillcrest Middle School

The Board of Finance will consider a resolution to fund the construction and equipping of a new Hillcrest Middle School through bond issuances. The project anticipates receiving $62,023,642 in grants. The meeting also includes reviews of year-to-date budget reports and the Town Treasurer's report.

schoolbondsbudgetconstructionfinance
Wed Jun 12, 2024

Library Board of Trustees

Trumbull Library Board to review reports and subcommittee updates

The meeting consists of routine reports from the Director, Treasurer, and Fairchild members. The board will also receive updates regarding the financial, bylaws and policy, and branding and marketing subcommittees.

libraryreportssubcommitteestrumbull
Wed Jun 12, 2024

Demolition Review Committee

Public hearing for proposed demolition of 6400 Main Street

The Trumbull Demolition Review Committee will hold a public hearing on June 12, 2024. The meeting is to discuss the proposed demolition of the property at 6400 Main Street.

demolitionpublic-hearing
Wed Jun 12, 2024

Community Facilities Building Committee

Committee to review updates on the proposed Senior and Community Center

The Community Facilities Building Committee will receive a project update from QA&M regarding the new Senior/Community Center. The meeting also includes a presentation on the Senior Center and discussion of QA&M invoices.

senior centercommunity centerconstructionbuilding committee
Wed Jun 12, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review financial reports and invoices for school roof projects

The committee will review financial reports for the Middle0brook and Booth Hill Elementary School roof projects. The meeting includes updates on the Booth Hill project and consideration of invoices from Silktown and Antinozzi Associates.

schoolroofingbudgettrumbullconstruction
Wed Jun 12, 2024

Trumbull Day Commission

Trumbull Day Commission to discuss event logistics and vendor updates

The commission will review preparations for Trumbull Day, including food trucks, vendors, and sponsorships. Discussions will also cover event rentals, volunteer coordination, and field layout.

trumbull-dayevent-planningvendorssponsorshipslogistics
Tue Jun 11, 2024

Police Pension Board

Trumbull Police Pension Board to approve retirement benefits and fee reductions

The Board of Trustees will review pension benefit calculations for several officers and survivors. The meeting also includes approvals for July 1, 2024, escalator increases and a fee reduction from Principal Custody Solutions.

policepensionretirementbenefitsbudget
Tue Jun 11, 2024

Police Commission

Commission to discuss traffic impact of proposed self-storage facility

The Trumbull Police Commission will meet to review the Chief's monthly report and approve minutes from previous special meetings. The commission will also consider the potential traffic impact of a proposed self-storage facility at 6 Cambridge Drive.

policetrafficzoningpublic-safetytrumbull
Tue Jun 11, 2024

Planning & Zoning Commission

Commission to consider POCD consultant contracts and appointments

The commission will meet to discuss updates to the 2024 Plan of Conservation and Development (POCD). The agenda includes consideration for approving the conclusion of a contract with the current consultant and appointing a consultant for the final stages of the process.

planningzoningpocdcontractsconsultants
Mon Jun 10, 2024

Parks & Recreation Commission

Commission approves BMX food vendor and lacrosse event dunk tank

The commission approved a food vendor for the BMX group and a dunk tank for a lacrosse picnic. Members also discussed the potential installation of windscreens at Unity Park pickleball courts, though no motion was made. Additionally, the department reported the hiring of four new part-time park rangers.

parksrecreationpickleballrugbylacrossecommunity
Wed Jun 5, 2024

Trumbull Veterans & First Responders Center Building Committee

Updates on Phase 1 and fundraising for the Veterans & First Responders Center

The committee will discuss updates regarding Phase 1 of the project and building insurance. Members will also review plans for individual and corporate fundraising and marketing communications. The meeting includes the review and approval of invoices.

veteransfirst-respondersconstructionfundraisinginsurancemarketing
Wed Jun 5, 2024

Middlebrook Elementary School HVAC Improvements Building Committee

Committee to select construction manager for Middlebrook HVAC improvements

The committee will evaluate proposals to select a commissioning agent and construction manager for Middlebrook Elementary School HVAC improvements. The meeting also includes a review of project financials for the $3,190,000 total project budget.

hvacconstructionschool-improvementstrumbullbudget
Wed Jun 5, 2024

Zoning Board of Appeals

Trumbull ZBA to consider residential property variance requests

The Zoning Board of Appeals will review applications for building variances in Residential Zone A. These requests involve changes to setbacks and heights for a garage addition, a detached garage, and a front porch.

zoningresidentialvariancetrumbull
Tue Jun 4, 2024

Economic & Community Development Commission

The June 4 Economic and Community Development Commission meeting is cancelled

The regular meeting of the Economic and Community Development Commission scheduled for Tuesday, June 4, 2024, has been cancelled. The notice provides contact information for the Administrative Clerk for further inquiries.

trumbullmeeting cancellation
Tue Jun 4, 2024

Trumbull Nature & Arts Commission

Trumbull Nature & Arts Commission to discuss budget and building updates

The commission will review the written Director's report and provide updates regarding the TNAC building and grounds. The meeting also includes a discussion on a budget update.

naturebudgetbuilding maintenancetrumbull
Tue Jun 4, 2024

Inland Wetlands & Watercourses Commission

Commission to review permits for a new residence and a home addition

The Inland Wetlands and Watercourses Commission will hold a public hearing regarding a single-family residence at Lot 4 West Mischa Road. The commission will also consider a permit for a home addition at 320 Shelton Road and approve minutes from the May 7, 2024 meeting.

wetlandshousingpermitstrumbull
Mon Jun 3, 2024

Town Council

Trumbull Town Council to vote on DPW supervisor contract and grant applications

The Town Council will consider several appointments to building committees and authorize multiple state grant applications. The body will also vote on funding for a DPW supervisors' agreement and the settlement of a pending lawsuit.

contractsgrantslegalappointmentsbudget
Thu May 30, 2024

Board of Finance

Trumbull Board of Finance to set the mill rate

The Board of Finance is holding a special meeting to determine the town's mill rate. No other business items are listed on the agenda.

taxesbudgetfinance
Wed May 29, 2024

Land Acquisition

Land Acquisition Committee to elect officers

The Land Acquisition Committee will meet to elect officers and conduct general business. The agenda consists of procedural items and new business.

land-acquisitionprocedural
Wed May 29, 2024

Trumbull Day Commission

Trumbull Day Commission to discuss event logistics and vendor planning

The commission is meeting to discuss the organization of Trumbull Day. Agenda items include food trucks, entertainment, vendors, sponsorships, and beer and wine sales.

community-eventsvendorspermitsvolunteers
Wed May 29, 2024

Conservation Commission

Trumbull Conservation Commission to discuss leadership and environmental projects

The Conservation Commission is meeting to address leadership changes, including a search for a new commissioner and a new chair. The body will also review updates on the 1000 Trees for Trumbull program and resident outreach efforts.

conservationzoningenvironmenttreeswetlands
Tue May 28, 2024

Trumbull Housing Authority

Trumbull Housing Authority to discuss Congregate security deposits

The board will meet to review financial reports and re-open discussions regarding security deposits for new tenants of the Congregate. The meeting includes reports from the Director of Finance, Property Manager, and Executive Director.

housingbudgetcongregate-housingtenants
Tue May 28, 2024

Town Council

Town Council considers funding for DPW supervisors and various state grant applications

The Legislation & Administration Committee is reviewing several resolutions including a labor agreement for DPW supervisors and a lawsuit settlement. The body is also considering applications for state grants related to traffic enforcement, historic document preservation, and the Neighborhood Assistance Act.

grantslabor-contractslegal-settlementspublic-safetyreal-estate
Tue May 28, 2024

Town Council

Town Council committee to consider building committee appointments and funding

The Rules & Research Committee is meeting to act upon resolutions regarding appointments to the Hillcrest Middle School and Community Facilities building committees. The committee will also consider a $25,000 appropriation for Town Hall sidewalk replacements.

appointmentsschoolsbudgetinfrastructure
Wed May 22, 2024

Community Facilities Building Committee

Community Facilities Building Committee to review Senior Center presentation

The committee will receive a project update from QA&M and a presentation regarding the Senior Center. Members will also discuss the June Town Council meeting and QA&M invoices.

senior-centerpublic-facilitiesinfrastructure
Wed May 22, 2024

Water Pollution Control Authority

Trumbull WPCA to discuss force-main breaks and proposed Bridgeport WPCA budget

The Water Pollution Control Authority will meet to discuss force-main breaks at Whitney Avenue and Merritt Boulevard. The body will also review the proposed FY2024-2025 budget from the Bridgeport WPCA.

sewerinfrastructurebudgetwater-pollution
Tue May 21, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to discuss FY 25 budget

The Emergency Medical Service Commission will meet to review the FY 25 budget. The body will also receive updates on staffing, vehicles, the building, and community service classes.

emsbudgetpublic-safetystaffing
Mon May 20, 2024

Golf Course Commission

Golf Course Commission reviews course maintenance and facility upgrades

The Commission is reviewing reports on course maintenance, including paving projects and tree plantings. Members are also discussing facility upgrades for the Cart Barn and clubhouse, alongside proposed changes to the golf course Rules and Regulations.

golfmaintenancefacilitiesrulestrumbull
Thu May 16, 2024

Equity, Diversity and Inclusion Task Force

Equity, Diversity and Inclusion Task Force to discuss library book club and training RFP

The Equity, Diversity and Inclusion Task Force is meeting to review old business and new business. Discussions include a fall book club event and a request for proposals for diversity training.

equitydiversity-and-inclusionlibrarytrainingpublic-outreach
Wed May 15, 2024

Civil Service Board

Civil Service Board to review EMS Office Manager role and librarian eligibility

The Civil Service Board will discuss the classification and recruitment process for the Trumbull E.M.S. Office Manager. The board is also considering the addition of Juneteenth as a recognized holiday and the approval of a librarian eligibility list.

civil-serviceemploymentemslibraryholidays
Wed May 15, 2024

Golf Course Commission

Golf Course Commission meets for a routine update on course greens.

The Trumbull Golf Course Commission will meet to receive an update regarding the golf course greens before adjourning. No specific votes, contracts, or policy changes are scheduled for this session.

golf-coursetrumbull-ctmunicipal-commissionroutine-meeting
Mon May 13, 2024

Parks & Recreation Commission

Parks & Recreation Commission to discuss Unity Park pickleball windscreens

The Commission will meet to discuss requests for the installation of windscreens at Unity Park pickleball courts. Residents have submitted correspondence arguing that wind interference affects play quality and safety.

parks-and-recreationpickleballunity-parktashuapublic-facilities
Thu May 9, 2024

Board of Finance

Board of Finance considers $25,000 for Town Hall sidewalk replacements

The Board of Finance will review a supplemental appropriation for sidewalk repairs and a fund transfer for road salt. The meeting also includes a follow-up audit report regarding cash handling at the Mary J. Sherlach Counseling Center.

budgetpublic-worksauditinfrastructurefinance
Thu May 9, 2024

Town Council

Town Council to vote on annual budget for fiscal year 2024-2025

The Town Council is holding a special meeting to consider and act upon the adoption of the annual budget. This budget covers the fiscal year beginning July 1, 2024, and ending June 30, 2025.

budgetfinance
Wed May 8, 2024

Library Board of Trustees

Trumbull Library Board of Trustees meeting scheduled for May 8, 2024

The board will review previous minutes and receive reports from the Director, Treasurer, and Fairchild. Discussion includes updates from the Financial, Bylaws and Policy, and Branding and Marketing subcommittees.

librarygovernment-administrationfinance
Wed May 8, 2024

Trumbull Veterans & First Responders Center Building Committee

Building Committee reviews Phase 1 work and foundation bids for Veterans Center

The Trumbull Veterans & First Responders Center Building Committee is meeting to review Phase 1 progress, including foundation and site work. The body will discuss tree removal, a communication plan, and the timetable for future bidding phases.

veterans-affairsfirst-respondersconstructionpublic-worksinfrastructure
Wed May 8, 2024

Health Board

Trumbull Health Board meeting scheduled for May 8, 2024

The board will review the minutes from the April 10, 2024 meeting and the April Health Department Activity Report. The agenda also includes a proposed change to the 2024 meeting schedule for November and December.

healthgovernment-administrationmeeting-schedule
Tue May 7, 2024

Economic & Community Development Commission

Economic & Community Development Commission to accept 2024 goals

The commission will meet to approve previous meeting minutes and accept the 2024 ECDC goals. The agenda includes reports on business, community development, planning, grants, and events.

economic-developmentcommunity-developmentplanning
Tue May 7, 2024

Inland Wetlands & Watercourses Commission

Trumbull Inland Wetlands Commission to review residential and commercial permits

The Inland Wetlands and Watercourses Commission will meet via videoconference to consider permit applications for residential additions and land grading. The body will also review a proposal for electric vehicle charging infrastructure and hold a public hearing regarding a new residence.

wetlandszoningev-chargingresidential-constructionpermits
Mon May 6, 2024

Town Council

Town Council discusses Hillcrest Middle School replacement and caregiver grants

The Town Council is considering several resolutions regarding the Hillcrest Middle School Replacement Project, including forming a building committee. Other items include a Caregiver Services Grant application, workers compensation settlements, and union contract funding.

educationgrantslaborschool constructiongovernment-operations
Thu May 2, 2024

Trumbull Education & Government Access Television Commission

Trumbull Television Commission to discuss budgets and graduation programming

The Commission is meeting to review budget updates for the 2023-24 and 2024-25 periods. Members will discuss original productions, specifically plans for the THS Graduation, and the status of the THS Studio.

budgetpublic-access-tveducationgovernment-operations
Wed May 1, 2024

Zoning Board of Appeals

Zoning Board of Appeals to review residential setback variances

The Zoning Board of Appeals will consider two applications for zoning variances to allow home additions. The board will decide if the requested deviations from required lot setbacks are permissible.

zoningvariancesresidentialhousing
Tue Apr 30, 2024

Trumbull Housing Authority

Trumbull Housing Authority to review finances, rents, and possible litigation

The Trumbull Housing Authority will hold a regular meeting to discuss financial reports, property management updates, and new business including approval of the Congregate rent roll. The board will also enter executive session to discuss possible pending claims and litigation. The agenda is largely routine, with most items being reports and approvals.

housingfinancerentlitigationmeeting
Mon Apr 29, 2024

Town Council

Proposals to establish a committee for Hillcrest Middle School replacement

The Rules & Research Committee is considering several resolutions regarding the Hillcrest Middle School Replacement Project. These include forming a building committee, authorizing project oversight, and allowing the Board of Education to apply for grants. The committee also includes various appointments for members and representatives.

educationschool constructiongovernment-oversighttrumbull
Mon Apr 29, 2024

Town Council

Trumbull discusses caregiver grants, labor agreements, and legal settlements

The Legislation & Administration Committee will consider several resolutions regarding town funding and legal matters. These include a $20,000 grant application for caregiver services and a contract agreement with UPSEU Trumbull MATE Local 424 – Unit 7.

grantslaborlegalhuman-servicesgovernment-administration
Mon Apr 29, 2024

Board of Assessment Appeals

Board of Assessment Appeals to hear petition for 211 Teller Road

The Board of Assessment Appeals is meeting to hear a specific petition. The session will take place at the Town Hall Council Chambers.

assessment-appealsproperty-taxpublic-hearing
Mon Apr 29, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review Middlebrook roof completion and Booth Hill roof financials

The committee will consider the substantial completion of the Middlebrook Elementary School roof project. The meeting will also focus on the Booth Hill Elementary School roof project, specifically regarding financial approvals.

schoolsroofingcontractsinfrastructure
Thu Apr 25, 2024

Town Council

Town Council to hold FY2024-2025 Budget Public Hearing and Finance Committee vote

The Town Council is conducting a public hearing for the FY2024-2025 budget. This will be followed by a budget voting session by the Finance Committee.

budgetpublic-hearingfinance
Wed Apr 24, 2024

Civil Service Board

Civil Service Board to review Assistant Sewer Administrator eligibility list

The Civil Service Board is holding a special meeting to approve the eligibility list for the Assistant Sewer Administrator position. The list is based on a 100% training and experience assessment.

civil-servicepersonnelsewer-administration
Wed Apr 24, 2024

Trumbull Day Commission

Trumbull Day Commission discusses event logistics and vendor planning

The Commission is coordinating preparations for Trumbull Day, including food truck counts, entertainment bookings, and security plans. Discussions covered sponsorship outreach, beer and wine sale applications, and rental orders for equipment.

communityeventspublic-safetyvendors
Wed Apr 24, 2024

Water Pollution Control Authority

Trumbull WPCA to discuss Old Town Road Pump Station change-order

The Water Pollution Control Authority will meet to discuss a change-order for the Old Town Road Pump Station. The body will also receive updates on the FY2024-2025 budget and pump station projects.

sewageinfrastructurebudgetpump-stations
Thu Apr 18, 2024

Town Council

Trumbull Town Council schedules FY2024-2025 budget hearings

The Town Council is conducting a series of public hearings regarding the fiscal year 2024-2025 budget. These sessions cover various departments including Public Safety, Public Works, and Education.

budgetgovernmentpublic-safetypublic-workseducationsocial-services
Wed Apr 17, 2024

Civil Service Board

Civil Service Board discusses recruitment for fleet mechanic and youth services roles

The Civil Service Board is considering a request to recruit a Fleet Mechanic for the Department of Public Works. The board will also review the eligibility list for a Youth Services Coordinator at the Trumbull Public Library.

employmentpublic-workslibrarygovernment-operations
Tue Apr 16, 2024

Pension Board

Trumbull Pension Board to elect officers and approve pension benefits

The Trumbull Pension Board will meet on April 16 to conduct an election of officers and receive an investment update from Beirne Wealth Consulting. The board is also scheduled to approve specific pension benefits and a contribution return. Additionally, members will review the 2023 First Selectman’s Letter and 2024 valuation assumptions.

pensionfinanceinvestmenttrumbull
Tue Apr 16, 2024

Town Council

Trumbull Town Council sets FY2024-2025 budget hearing and voting schedule

The Town Council has scheduled a series of budget hearings for April and May 2024. These sessions include departmental reviews, a public hearing, and final voting sessions for the FY2024-2025 budget.

budgetpublic-hearingfinancetown-council
Mon Apr 15, 2024

Economic & Community Development Commission

Economic & Community Development Commission meeting on April 15

The commission will meet via videoconference to review various departmental updates. The agenda includes the acceptance of 2024 goals and reports regarding business, community development, planning, grants, and events.

economic-developmentcommunity-developmentplanninggrants
Mon Apr 15, 2024

Golf Course Commission

Golf Course Commission updates ID rules, adjusts tee times, and reviews facility plans

The Trumbull Golf Course Commission reviewed performance data showing strong revenue and round increases at Tashua Knolls and Glen courses ahead of the spring season. Members approved updates to resident ID applications, including removing a car registration requirement and adding penalties for falsified information. The commission also adjusted tee times by one hour starting April 1 and discussed beverage cart operations alongside planned irrigation and facility upgrades.

golf-coursebudgetfacilities-maintenancecontractsresident-servicesrecreation
Wed Apr 10, 2024

Golf Course Commission

Green Sub-Committee meeting regarding a green update

The agenda is procedural and consists of a single item regarding a green update. No specific decisions, contracts, or ordinances are listed for this meeting.

golfgreen-sub-committeetrumbull
Wed Apr 10, 2024

Library Board of Trustees

Trumbull Library Board of Trustees meeting scheduled for April 10

The Board of Trustees will meet to review reports from the Director and Treasurer. The agenda includes updates from the Financial, Bylaws and Policy, and Logo subcommittees.

libraryboard-of-trusteesmunicipal-government
Wed Apr 10, 2024

Health Board

Trumbull Health Board to review department activity reports

The Health Board will meet to review minutes from February 7, 2024. The board will also review Health Department activity reports for February and March.

health-departmentpublic-healthadministrative
Wed Apr 10, 2024

Community Facilities Building Committee

Community Facilities Building Committee to receive project update from QA&M

The committee will meet to review a project update provided by QA&M. Other business includes the approval of meeting minutes from March 13, 2024.

community-facilitiesbuilding-committeeinfrastructure
Mon Apr 8, 2024

Parks & Recreation Commission

Parks & Recreation Commission approves LIVFREE movie night and tree maintenance

The Commission is meeting to discuss park operations and new business. Previous actions include approving a movie night for childhood cancer awareness and volunteer maintenance for a maple tree.

parksrecreationcommunity-eventsmaintenanceparking
Mon Apr 8, 2024

Town Council

Town Council to consider $10 million bond for land acquisition

The Town Council will discuss an auditor's report and vote on two resolutions. These include a proposal to borrow $10 million for land acquisition and the approval of funding for a police union agreement.

bondsopen-spacepoliceland-acquisitionbudget
Wed Apr 3, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee to review Phase 1 bids for Veterans & First Responders Center

The Trumbull Veterans & First Responders Center Building Committee will review and approve Phase 1 bids for foundation and site work. Members will also discuss the distribution of bond funds, earmarks, and grants, and select a date for the ground-breaking ceremony.

veterans-affairsfirst-respondersconstructionbudget
Wed Apr 3, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review bids for Middlebrook and Booth Hill school roof projects

The committee is meeting to review bids and select a contractor for the Middlebrook and Booth Hill Elementary School roof projects. The body will also discuss project financials, timelines, and an invoice from Antinozzi Associates.

schoolsinfrastructurecontractsbudget
Wed Apr 3, 2024

Zoning Board of Appeals

Trumbull Zoning Board of Appeals to review three setback variance requests

The Zoning Board of Appeals will consider three applications for setback variances to allow for new construction and home additions. The board will also act on applications from the evening's public hearing.

zoningvariancesresidentialsetbacks
Tue Apr 2, 2024

Middlebrook Elementary School HVAC Improvements Building Committee

Committee approves asbestos survey and solicitation for HVAC project managers

The Middlebrook Elementary School HVAC Improvements Building Committee discussed a project budget of $3,190,000 and potential state reimbursement. The body decided to solicit for a Construction Manager as an agent (CMA) and a Commissioning Agent. The committee also approved an initial asbestos survey to identify materials in demolition areas.

schoolshvacconstructionasbestosbudget
Tue Apr 2, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee approves plans for Middlebrook Elementary School HVAC improvements

The committee approved the project plans, specifications, and cost estimates for new ventilation systems at Middlebrook Elementary. The work includes electrical upgrades and a new transformer to support the system. The project is expected to span two summers, with work potentially continuing into 2026.

hvacschool-constructionbudgetmiddlebrook-elementaryinfrastructure
Tue Apr 2, 2024

Town Council

Town Council to consider $10 million bond for land acquisition

The Legislation & Administration Committee will discuss appropriating $10 million for the purchase of real property for open space, recreation, and municipal purposes. The committee will also consider funding for an amended agreement with the Trumbull Police Union Local 1745 Council 15.

bondsopen-spacepolicelabor-agreementreal-estate
Tue Apr 2, 2024

Inland Wetlands & Watercourses Commission

Commission to review five permit applications for regulated areas

The Inland Wetlands and Watercourses Commission will meet via videoconference to discuss several permit applications. The body will consider requests for residential construction, home additions, and commercial equipment installations within regulated areas.

wetlandspermitsev-chargingresidential-constructionenvironmental-regulation
Mon Apr 1, 2024

Sustainable Team

Trumbull Advisory Sustainability Team holds launch meeting

The team is discussing nature projects, waste reduction efforts, and community outreach collaborations. The meeting includes planning for public education events and organizing team leadership.

environmentrecyclingpublic-educationcommunity-outreach
Thu Mar 28, 2024

Board of Finance

Board of Finance holds potential budget voting session

The Board of Finance is conducting a series of budget hearings for FY 2024-2025 with various town departments. The process concludes with a potential voting session on March 28 before the approved budget is submitted to the Town Council.

budgetpublic-hearingfinance
Wed Mar 27, 2024

Water Pollution Control Authority

WPCA to consider $63,742 change order for Old Town Road and Reservoir Avenue project

The Water Pollution Control Authority will discuss a contract change order for sewer upgrades and provide updates on the FY2024-2025 budget. The body will also review the status of the Old Town force-main and pump station projects.

sewerbudgetinfrastructurecontractswater-pollution
Wed Mar 27, 2024

Conservation Commission

Conservation Commission to review wetland applications and tree planting updates

The Conservation Commission will discuss several Inland Wetlands and Watercourses (IWWC) applications and property status updates. The body is also reviewing the 2024 budget and the progress of the 1000 Trees for Trumbull project.

conservationwetlandsenvironmentbudgettree-planting
Wed Mar 27, 2024

Trumbull Day Commission

Trumbull Day Commission to plan carnival, fireworks, and vendors

The commission is meeting to discuss the organization of Trumbull Day. The body will review requirements for the carnival, entertainment, and various event logistics.

community-eventscarnivalpublic-safetyvendors
Tue Mar 26, 2024

Trumbull Housing Authority

Trumbull Housing Authority approves unit renovations and community room rental ban

The Board approved $25,000 for unit updates using SSHP funds and authorized up to $5,000 for entry door repairs. Additionally, the Board voted to prohibit the rental of the Community Room and Congregate Dining area by tenants or outside groups.

housingbudgetrentmaintenancecommunity-facilities
Tue Mar 26, 2024

Board of Finance

Board of Finance to meet March 26 for FY 2024-2025 budget review

The Board of Finance is conducting a series of hearings and meetings to review the FY 2024-2025 budget. This process includes department presentations, public hearings, and a potential voting session.

budgetfinancepublic-hearingtown-government
Tue Mar 26, 2024

Planning & Zoning Commission

P&Z Commission to hold workshop on Plan of Conservation and Development

The Planning and Zoning Commission will hold a special meeting via videoconference. The session consists of a workshop and presentation by BFJ Planning regarding the Trumbull Plan of Conservation and Development.

planningconservationdevelopmentzoning
Mon Mar 25, 2024

Golf Course Commission

Golf Course Commission reviews budget updates, facility repairs, and seasonal staffing.

The Trumbull Golf Course Commission will review committee reports on course maintenance, seasonal hiring, and the fiscal year budget for Tashua Knolls Golf Course. Commissioners are also scheduled to discuss potential amendments to the facility’s rules and regulations, which require a two-thirds vote to change. An executive session will address a specific customer issue. These updates affect local golfers regarding tee times, course conditions, and seasonal operations.

golf-coursebudgetmaintenancestaffingrules-regulationstrumbull-ct
Sat Mar 23, 2024

Town Council

Trumbull Town Council holds public budget hearing

The Town Council is conducting a series of budget hearings for the FY 2024-2025 cycle. This specific session is a public hearing to discuss the proposed budget before a final voting session.

budgetpublic-hearingfinance
Sat Mar 23, 2024

Board of Finance

Board of Finance holds public hearing for FY 2024-2025 budget

The Board of Finance is conducting a series of budget hearings for the 2024-2025 fiscal year. This process includes departmental reviews and public hearings to determine the final budget for submission to the Town Council.

budgetpublic-hearingfinancegovernment
Thu Mar 21, 2024

Trumbull Housing Authority

Trumbull Housing Authority holds special meeting

The agenda for this special meeting consists of procedural boilerplate. No specific decisions or discussion topics are listed beyond an executive session.

housing-authorityprocedural
Thu Mar 21, 2024

Equity, Diversity and Inclusion Task Force

Equity, Diversity and Inclusion Task Force to discuss programming and equity profile

The task force is meeting to review a public hearing and discuss the Trumbull Library book club. Members will discuss a Diversity Training RFP and next steps for the Trumbull Equity Profile across several sectors including housing, education, and health.

diversityequityinclusioncommunity-programmingpublic-healthhousing
Thu Mar 21, 2024

Board of Finance

Board of Finance budget hearing for March 21 cancelled

The scheduled second Board of Education hearing for March 21, 2024, was cancelled on March 19, 2024. This is part of a broader FY 2024-2025 budget hearing schedule.

budgetboard-of-education
Thu Mar 21, 2024

Town Council

Town Council budget hearing for March 21 is cancelled

The scheduled second Board of Education hearing for March 21, 2024, has been cancelled. This is part of a broader FY 2024-2025 budget hearing schedule.

budgeteducation
Thu Mar 21, 2024

Trumbull Education & Government Access Television Commission

Trumbull Television Commission reviews budget and technical updates

The Commission is meeting to discuss budget updates for the 2023-24 and 2024-25 cycles. Members will review programming, studio status, and the development of a station archiving policy.

budgetpublic-televisiontechnologyarchiving
Wed Mar 20, 2024

Golf Course Commission

The Green Sub-Committee will receive a green update.

This meeting agenda is sparse and contains only procedural items. The committee will receive a green update.

golfgreen-updatetrumbull
Wed Mar 20, 2024

Civil Service Board

Civil Service Board considers recruitment for Adult Services Librarian

The Civil Service Board will meet to discuss a request to advertise, test, and recruit for an Adult Services Librarian at the Trumbull Public Library. The board also reviewed minutes from the February 21, 2024, meeting.

governmentemploymentlibrarycivil-service
Wed Mar 20, 2024

Planning & Zoning Commission

Trumbull P&Z to review 5-story mixed-use building at 900 White Plains Road

The Planning and Zoning Commission will hold a public hearing to consider several site plan modifications and zone changes. Key items include a proposal for a five-story mixed-use building and a new zoning district for multi-family housing.

zoningmixed-usehousingsite-planpublic-hearing
Tue Mar 19, 2024

Trumbull Nature & Arts Commission

Nature Commission to discuss ARPA funding and building updates

The Commission will review the Director's report and discuss the status of ARPA funding and building and grounds updates. The meeting includes a budget update and a recap of the Board of Finance meeting.

budgetarpa-fundingfacilitieseducationnature-center
Tue Mar 19, 2024

Board of Finance

Board of Finance holds FY 2024-2025 budget hearings for town departments

The Board of Finance is conducting a series of budget hearings for the 2024-2025 fiscal year. On March 19, the board will hear from various town departments, including Public Works, EMS, and Social Services.

budgetpublic-workspublic-safetysocial-servicesparks-and-recreation
Tue Mar 19, 2024

Board of Finance

Board of Finance to review school facilities capital plan and Hillcrest Middle School

The Board of Finance is holding a special meeting concurrently with the Town Council. The body will receive a presentation from the Board of Education regarding the School Facilities Long Term Capital Improvement Plan and a proposed project for Hillcrest Middle School.

educationcapital-improvementsschoolsfinance
Tue Mar 19, 2024

Town Council

Town Council holds budget hearings for FY 2024-2025

The Town Council is conducting a series of budget hearings with various town departments. These sessions are part of the approved budget hearing schedule for the 2024-2025 fiscal year.

budgetpublic-workspublic-safetyparks-and-recreationsocial-services
Tue Mar 19, 2024

Town Council

Town Council to discuss school facilities capital plan and Hillcrest Middle School

The Town Council will hold a special meeting to review the Board of Education's School Facilities Long Term Capital Improvement Plan. The discussion focuses on several options for the Hillcrest Middle School project and the renewal of Tier 1 elementary schools.

schoolscapital-improvementsconstructionbudgeteducation
Tue Mar 19, 2024

Emergency Medical Services (EMS) Commission

Trumbull EMS Commission to swear in new member

The Emergency Medical Service Commission is meeting to review the Chief's report and approve February minutes. The body will discuss an update on classroom furniture and swear in a new Commissioner.

emspublic-safetyappointments
Thu Mar 14, 2024

Town Council

Trumbull Town Council to hold public hearing on FY 2024-2025 budget

The Town Council is conducting a series of budget hearings for the 2024-2025 fiscal year. This includes a public hearing and a regular monthly meeting on March 14, as well as departmental budget reviews.

budgetpublic-hearingfinance
Thu Mar 14, 2024

Board of Finance

Board of Finance considers $10 million bond for land acquisition

The Board of Finance will discuss a resolution to appropriate $10 million for the purchase of land, easements, and development rights for municipal, recreational, and conservation purposes. The meeting will also include reports on the town's current fiscal year budget and fund balance.

bondsopen-spacebudgetland-acquisitionfinance
Thu Mar 14, 2024

Board of Finance

Board of Finance to hold public hearing on FY 2024-2025 budget

The Board of Finance is conducting a series of budget hearings for the 2024-2025 fiscal year. This meeting includes a public hearing and the regular monthly meeting.

budgetpublic-hearingfinance
Wed Mar 13, 2024

Library Board of Trustees

Trumbull Library Board of Trustees to meet March 13

The Board of Trustees will meet to review reports from the Director and Treasurer. The agenda includes updates from the Financial, Bylaws and Policy, and Logo subcommittees.

libraryboard-of-trusteesgovernment-administration
Wed Mar 13, 2024

Police Commission

Police Commission holds special meeting for candidate interviews

The Trumbull Police Commission will hold a special meeting on March 13, 2024. The primary purpose of the meeting is an executive session to interview police officer candidates.

policehiringpublic-safety
Wed Mar 13, 2024

Community Facilities Building Committee

Community Facilities Building Committee to review project Q&A and invoice

The committee will meet to conduct a project review Q&A and discuss next steps. The agenda also includes the review of a QA&M invoice.

community-facilitiesinfrastructuretown-administration
Tue Mar 12, 2024

Town Council

Town Council conducts FY 2024-2025 budget hearings

The Town Council is holding a series of budget hearings for the 2024-2025 fiscal year. These sessions involve reviews of various town departments, public safety, and public works.

budgetpublic-safetypublic-worksfinance
Tue Mar 12, 2024

Board of Finance

Board of Finance conducts FY 2024-2025 budget hearings

The Board of Finance is holding a series of departmental hearings to review the FY 2024-2025 budget. These sessions involve presentations from town department heads, public safety officials, and public works directors.

budgetpublic-safetypublic-worksfinance
Mon Mar 11, 2024

Parks & Recreation Commission

Parks & Recreation Commission reviews seasonal reports and park maintenance

The Commission is meeting to receive reports from the Superintendent and Ranger Division. Discussions include summer program registration, ongoing construction at Indian Ledge Park, and park enforcement activities.

parksrecreationinfrastructurepublic-safetysummer-programs
Mon Mar 11, 2024

Fair Rent Commission

Fair Rent Commission to review complaint #2024-001

The Fair Rent Commission will meet to discuss a specific rental complaint and review administrative processes. The body is also setting its regular meeting schedule.

renthousingtenant-rights
Thu Mar 7, 2024

Town Council

Trumbull budget hearing schedule for fiscal year 2024-2025

The Town of Trumbull has released the approved budget hearing schedule for the 2024-2025 fiscal year. Hearings will be held via Zoom and in person to discuss various town departments, public safety, and public works.

budgetgovernmentpublic-safetypublic-worksfinance
Thu Mar 7, 2024

Board of Finance

Board of Finance begins FY 2024-2025 budget hearings

The Board of Finance is conducting a series of hearings to review the FY 2024-2025 budget. This process includes testimony from the Board of Education and various town departments.

budgetpublic-hearingfinancetown-government
Wed Mar 6, 2024

Zoning Board of Appeals

Zoning Board to consider setback variances for two residential properties

The Zoning Board of Appeals will hold a public hearing to consider two applications for side lot setback variances in Residential Zone A. The board will decide if these requests meet the requirements for exceptional difficulty or unusual hardship.

zoningvariancesresidentialsetbacks
Tue Mar 5, 2024

Inland Wetlands & Watercourses Commission

Tesla seeks permit for EV charging stations at 120/140 Hawley Lane

The Inland Wetlands and Watercourses Commission is reviewing several permit applications for residential construction and landscaping. A notable new business item includes a proposal by Tesla to install electric vehicle charging infrastructure within a regulated area.

zoningelectric-vehicleswetlandsresidential-constructionpermits
Mon Mar 4, 2024

Town Council

Town Council considers property sale at 6175 Main Street and school HVAC project

The Town Council is deciding on the sale of real property at 6175 Main Street and approving plans for HVAC improvements at Middlebrook Elementary School. The body is also considering funding applications for senior and disability transit services and various fund balance appropriations.

real-estateschoolstransportationbudgetappointments
Wed Feb 28, 2024

Water Pollution Control Authority

Water Pollution Control Authority to discuss FY2024-2025 budget

The Water Pollution Control Authority is meeting to discuss the FY2024-2025 budget and a vacancy for the Assistant Sewer Administrator. The body will also receive updates on the Old Town Force-main and the Old Town and Reservoir Avenue pump stations.

budgetsewerinfrastructurepersonnel
Wed Feb 28, 2024

Conservation Commission

Conservation Commission to discuss Senior Center site and 2024 budget

The Conservation Commission will meet to review the budget status and the Hardy Lane Senior Center site, including plume modeling. The body will also discuss 2024 goals and updates on the 1000 Trees for Trumbull project.

conservationbudgetenvironmentzoningtrees
Wed Feb 28, 2024

Trumbull Day Commission

Trumbull Day Commission plans carnival, entertainment, and vendors

The commission is discussing the organization of Trumbull Day, including contracts for rides and entertainment. Members are coordinating logistics for food trucks, security, and sponsorships.

community-eventscarnivalentertainmentvendors
Wed Feb 28, 2024

Community Facilities Building Committee

Community Facilities Building Committee to review project Q&A and invoice

The committee will hold a special meeting to conduct a project review Q&A and discuss next steps. The agenda also includes the review of a QA&M invoice.

community-facilitiesinfrastructuretown-administration
Tue Feb 27, 2024

Trumbull Housing Authority

Trumbull Housing Authority to consider community room rental policy

The Trumbull Housing Authority will meet to discuss a new rental policy for the community room and receive updates on unit renovations. The board will also hold an executive session regarding an employee accommodation.

housingpolicymaintenancepersonnel
Tue Feb 27, 2024

Planning & Zoning Commission

P&Z Commission to hold workshop on Plan of Conservation and Development

The Planning and Zoning Commission is holding a special meeting via videoconference. The session consists of a workshop and presentation by BFJ Planning regarding the Trumbull Plan of Conservation and Development.

planningconservationdevelopmentworkshop
Mon Feb 26, 2024

Golf Course Commission

New driver's license requirements and ID expiration policies for Tashua Knolls

The Commission reviewed maintenance projects, clubhouse updates, and upcoming seasonal operations. Discussions included new identification procedures for golfers and budget adjustments following changes to equipment leasing rules.

golftashua-knollstrumbullbudgetmaintenancepolicy
Mon Feb 26, 2024

Town Council

Trumbull discusses senior transit grants, school HVAC upgrades, and property sale

The Legislation & Administration Committee is considering several resolutions including federal grant applications for senior and disability transportation. The committee will also review the Middlebrook Elementary School HVAC project and a real property sale at 6175 Main Street.

senior servicestransportationeducationschool facilitiesreal estategrants
Mon Feb 26, 2024

Town Council

Town Council to consider $135,424 for Storage Area Network upgrade

The Rules & Research Committee will consider a supplemental appropriation to upgrade the town's Storage Area Network (SAN) before current data packs reach end-of-life on April 30, 2024. The committee will also act on two commission appointments.

it-infrastructurebudgetappointmentsgovernment-administration
Thu Feb 22, 2024

Middlebrook Elementary School HVAC Improvements Building Committee

Building Committee to review Middlebrook Elementary School HVAC project costs

The Building Committee is meeting to review the project process, timeline, and cost estimates for HVAC improvements at Middlebrook Elementary School. The committee will consider the approval of plans and specifications for the upgrade.

schoolshvacconstructionbudget
Wed Feb 21, 2024

Civil Service Board

Civil Service Board to review eligibility lists and recruitment requests

The board is meeting to approve eligibility lists for specific driver and operator roles. They will also consider requests to advertise and recruit for positions in Public Works, the Public Library, and Engineering.

civil-servicehiringpublic-workslibraryengineering
Wed Feb 21, 2024

Planning & Zoning Commission

Commission to consider farm definition changes and martial arts studio permit

The Planning and Zoning Commission will hold a public hearing to discuss a zoning text amendment regarding the definition of farms. The body will also review a special permit application for a business and a property sale report.

zoningland-usefarmsspecial-permitsproperty-sale
Tue Feb 20, 2024

Police Commission

Police Commission to discuss Veterans’ Center traffic impact

The Police Commission will meet to discuss how the new Veterans’ Center will affect traffic in the surrounding area. The body will also review the Police Department’s recruiting strategy.

trafficpublic-safetyrecruitingveterans-center
Tue Feb 20, 2024

Emergency Medical Services (EMS) Commission

EMS Commission to discuss fund reallocation and EMS Week funding

The Trumbull Emergency Medical Service Commission will meet to review the Chief's report and a vehicle update. The body will also discuss the reallocation of funds from an office furniture purchase and funding for EMS Week.

emsbudgetpublic-safetyvehicles
Thu Feb 15, 2024

Equity, Diversity and Inclusion Task Force

Equity, Diversity and Inclusion Task Force to discuss training RFP and library events

The task force is meeting to discuss upcoming programming and a Request for Proposals (RFP) for diversity training. Members will also review the Trumbull 2021 Equity Profile and a planned book club event at the Trumbull Library.

diversityequityinclusiontraininglibrarypublic-programming
Wed Feb 14, 2024

Library Board of Trustees

Trumbull Library Board of Trustees meeting scheduled for February 14

The Board of Trustees will meet to review reports from the Director, Treasurer, and Fairchild representatives. The agenda includes updates from the Financial and Bylaws and Policy subcommittees.

libraryboard-of-trusteesgovernance
Tue Feb 13, 2024

Police Pension Board

Trumbull Police Pension Board meets February 13, 2024

The Board of Trustees will review a quarterly client report regarding market outlook and fund performance. The agenda also includes the approval of previous meeting minutes and a survivor's pension for Linda Richard.

policepensionfinancegovernment-administration
Tue Feb 13, 2024

Police Commission

Police Commission to discuss Veterans’ Center traffic and recruiting strategy

The Trumbull Police Commission will meet to discuss the impact of the new Veterans’ Center on local traffic. The body will also review the Police Department's recruiting strategy and receive the Chief's monthly report.

policetrafficrecruitingpublic-safety
Tue Feb 13, 2024

Community Facilities Building Committee

Community Facilities Building Committee to review project expenditures

The committee will hold a special meeting to conduct a project review Q&A. Members will also discuss a comparison of recurring expenditures.

facilitiesbudgetexpenditures
Mon Feb 12, 2024

Pension Board

Trumbull Pension Board holds special meeting on February 12, 2024

The Pension Board will conduct a special meeting to elect officers and review the investment policy. The board will also receive an investment update for the 4th quarter and discuss the 2023 Annual First Selectman’s Letter.

pensionfinancegovernment-operationsinvestment
Mon Feb 12, 2024

Parks & Recreation Commission

Parks & Recreation Commission discusses park mapping and summer program registration

The Commission is reviewing reports on park ranger activities, OSHA compliance remediation, and current maintenance projects. The body is also discussing the creation of new, accurate trail maps for Twin Brooks and Beach Memorial Parks.

parksrecreationmappingmaintenancesummer-camps
Thu Feb 8, 2024

Board of Finance

Board of Finance discusses supplemental appropriation and engineering audit

The Board of Finance will consider a $135,424 supplemental appropriation to upgrade the town's Storage Area Network. The meeting also includes a report on an internal audit regarding the Engineering Department's financial and operational processes.

budgettechnologyengineeringauditfinance
Wed Feb 7, 2024

Zoning Board of Appeals

Zoning Board of Appeals to review four variance applications

The Zoning Board of Appeals will meet to consider several requests for variances from town zoning regulations. The board will decide on applications regarding property setbacks, lot area, and garage square footage for residential projects.

zoningvariancesresidentialsetbacks
Tue Feb 6, 2024

Booth Hill / Jane Ryan Building Committee

Committee discusses roof updates for Middlebrook and Booth Hill elementary schools

The committee reviewed the completed Middlebrook School roof project and discussed potential solar panel additions. Members also reviewed progress on the Booth Hill School roof project, including upcoming bidding timelines.

schoolsroofingsolarconstructionbudget
Tue Feb 6, 2024

Economic & Community Development Commission

Economic & Community Development Commission to review goals and updates

The commission will meet to approve previous minutes and review commission goals. The agenda includes reports on business, community development, planning, grants, and events.

economic-developmentcommunity-developmentplanningsustainability
Tue Feb 6, 2024

Inland Wetlands & Watercourses Commission

Commission to consider settlement for Lot 5 West Mischa Road appeal

The Inland Wetlands & Watercourses Commission will review a settlement agreement to resolve a legal appeal regarding a denied home construction application. The body will also consider permit applications for residential work at 22 Great Brook Road and 201 Old Dike Road.

wetlandsresidential-permitslegal-settlementlandscaping
Mon Feb 5, 2024

Town Council

Town Council to consider $1.6M Williams Road culvert project and new Veterans Center

The Town Council will vote on several capital appropriations and infrastructure projects, including roof work for Booth Hill Elementary School. The body will also discuss an update from the Equity, Diversity & Inclusion Task Force.

infrastructureschoolsbudgetveterans-affairspublic-works
Wed Jan 31, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee to review Phase 1 bid package and Wiles Associates invoice

The Trumbull Veterans and First Responders Center Building Committee will vote on the Phase 1 bid package and a specific architectural services invoice. Members will also discuss the distribution of state and federal grant funds and the procurement of furniture and equipment.

veterans-servicesfirst-respondersconstructiongrantspublic-works
Wed Jan 31, 2024

Trumbull Day Commission

Trumbull Day Commission plans 2024 event logistics

The commission is meeting to set the 2024 meeting schedule and review financial data from 2023. Members will discuss planning for the Trumbull Day event, including vendors, security, and entertainment.

community-eventstrumbull-daybudgetpublic-safety
Wed Jan 31, 2024

Conservation Commission

Conservation Commission to elect new chair and review 2023 goals

The Conservation Commission will introduce new and existing members and elect a new chair. The body will discuss its responsibilities, the New Trees Initiative, and new zoning steep slope regulations.

conservationzoningbudgetenvironmenttrees
Mon Jan 29, 2024

Town Council

Town Council considers $1.64 million Williams Road reconstruction project

The Legislation & Administration Committee is meeting to act on several infrastructure resolutions. Key items include funding for road reconstruction and approvals for school and community facility projects.

roadsschoolspublic-safetybudgetinfrastructure
Mon Jan 29, 2024

Town Council

Finance Committee to consider $595,000 in supplemental appropriations

The Finance Committee is reviewing six resolutions to appropriate funds from the Fund Balance for various town projects. These items were previously removed from a bonding resolution and cover infrastructure, facility upgrades, and professional services.

budgetinfrastructuresenior-centertown-hallada-compliancepublic-works
Wed Jan 24, 2024

Water Pollution Control Authority

WPCA to discuss Island Brook E.coli evaluation and sewer upgrades

The Water Pollution Control Authority will review a proposal for E.coli source evaluation at Island Brook. The body will also consider a change order for sewer upgrades at Old Town Road and Reservoir Avenue and discuss the Trumbull Center development.

sewerswater-qualityinfrastructurezoningcontracts
Tue Jan 23, 2024

Trumbull Housing Authority

Trumbull Housing Authority to vote on new Village lease and tenant selection process

The board will discuss and vote on a new lease for the Village and the Tenant Selection Process. Members will also consider funding for an on-site assessment of the Village and the use of reserves to pay for it.

housingleasestenant-selectionbudgetvillage
Tue Jan 23, 2024

Emergency Medical Services (EMS) Commission

EMS Commission to discuss staffing, vehicles, and conference funding

The Trumbull Emergency Medical Service Commission will meet to review reports from the Chief and discuss updates on staffing and vehicles. The body will also consider funding for conference admission and personnel updates for the commission.

emspublic-safetystaffingfunding
Mon Jan 22, 2024

Golf Course Commission

Golf Course Commission approves $2.6 million budget and seasonal rate increases

The Golf Course Commission approved a $2,667,422 budget for the 2024/25 fiscal year. The commission also voted to implement specific price increases for 18-hole and 9-hole golf rounds for the upcoming season.

golfbudgetfinancetashua-knollsrates
Thu Jan 18, 2024

Trumbull Housing Authority

Trumbull Housing Authority to discuss 2021 Capital Needs Assessment Report

The Trumbull Housing Authority is holding a special meeting to review ongoing projects and action items. The body will continue its review and discussion of the 2021 Capital Needs Assessment Report for the Congregate.

housingcapital-needscongregate-housing
Thu Jan 18, 2024

Equity, Diversity and Inclusion Task Force

Task Force to discuss NSC leaflets with Police Chief Lombardo

The Equity, Diversity and Inclusion Task Force will meet to discuss NSC leaflets with Police Chief Lombardo. The body will also review updates on the Town Value statement, library programs, and a Diversity Training RFP.

equitydiversity-and-inclusionpolicetown-valuescommunity-programming
Thu Jan 18, 2024

Trumbull Education & Government Access Television Commission

Trumbull Television Commission to vote on 2024-25 budget

The Trumbull Education & Government Access Television Commission is meeting to approve the 2024-25 budget and discuss technical upgrades. The body will also review programming for winter sports and original productions.

budgetgovernment-access-tvtechnologypublic-media
Wed Jan 17, 2024

Civil Service Board

Civil Service Board to discuss recruiting for bus driver and equipment operator roles

The Civil Service Board is meeting to consider requests to advertise and recruit for two specific town positions. The board will review the requirements for a full-time lead bus driver and an internal promotional opening for a senior equipment operator.

employmentcivil-servicehiringtransportationpublic-works
Wed Jan 17, 2024

Planning & Zoning Commission

P&Z to consider Senior and Community Center location on Hardy Lane

The Planning and Zoning Commission will review a report regarding the location of a new Senior and Community Center. The body will also hold public hearings on two zoning text amendments and a site plan modification.

zoningsenior-centerhousingland-usepublic-facilities
Tue Jan 16, 2024

Pension Board

Trumbull Pension Board to review investment updates and approve benefits

The Trumbull Pension Board will meet to elect officers and review the 4th quarter investment update from Beirne Wealth Consulting. The board will also consider approving specific pension benefits and contribution refunds.

pensionfinanceinvestmentstrumbullgovernment-administration
Thu Jan 11, 2024

Board of Finance

Board of Finance considers supplemental appropriations for town projects

The Board of Finance is reviewing several supplemental appropriations from the fund balance for projects previously removed from the bonding resolution. The body will also consider transferring uncollectible 2021 property taxes to the suspense tax book.

budgetpublic-workstaxessenior-centerinfrastructure
Wed Jan 10, 2024

Library Board of Trustees

Trumbull Library Board of Trustees to meet January 10

The Board of Trustees will meet to review reports from the Director and Treasurer. The agenda includes updates from the Financial and Bylaws and Policy subcommittees.

libraryboard-of-trusteestrumbull
Wed Jan 10, 2024

Community Facilities Building Committee

Community Facilities Building Committee meets to introduce new members

The committee is meeting to approve previous minutes and introduce new members. The agenda consists primarily of procedural items and the assignment of committee roles.

governmentcommitteeadministration
Wed Jan 10, 2024

Middlebrook and Booth Hill Elementary School Roof Building Committee

Committee to review Booth Hill Elementary School roof project plans and costs

The committee will discuss financial updates for the Middlebrook and Booth Hill Elementary School roof projects. For Booth Hill, the body will review state approval results and consider approving final plans, the project manual, and cost estimates.

schoolsroofingbudgetpublic-works
Wed Jan 10, 2024

Health Board

Trumbull Health Board to consider reappointment of Medical Director

The Health Board will meet to discuss the reappointment of Dr. Kunkel as Medical Director. The board will also review the minutes from December 13, 2023, and the December Health Department Activity Reports.

health-departmentappointmentsadministration
Tue Jan 9, 2024

Trumbull Housing Authority

Trumbull Housing Authority to vote on animal assistance policy

The Trumbull Housing Authority will hold a special meeting to discuss and vote on an animal assistance policy. The body will also discuss the renovation of remaining units and hold an executive session regarding staff performance and a possible arbitration settlement.

housingpolicypersonnel
Tue Jan 9, 2024

Trumbull Veterans & First Responders Center Building Committee

Committee discusses Phase 1 construction and $250K grant for foundation

The Trumbull Veterans & First Responders Center Building Committee is reviewing a proposal to bid on foundation construction using a $250K grant. The body is also discussing a $1.2 million State bond request and the selection of a new vice chairman.

veterans-affairsfirst-respondersconstructiongrantsmunicipal-funding
Tue Jan 9, 2024

Economic & Community Development Commission

Economic & Community Development Commission meets for departmental updates

The commission will meet to review reports from the Director and the Sustainable Trumbull Team. The agenda consists of procedural updates and reports rather than specific votes or new proposals.

economic-developmentcommunity-developmentsustainabilityplanning
Tue Jan 9, 2024

Planning & Zoning Commission

P&Z Commission to hold workshop on Plan of Conservation and Development

The Planning and Zoning Commission is holding a special meeting via videoconference. The session consists of a workshop and presentation by BFJ Planning regarding the Trumbull Plan of Conservation and Development.

planningconservationdevelopmentworkshop
Mon Jan 8, 2024

Sustainable Team

Trumbull Advisory Sustainability Team holds launch meeting

The Advisory Sustainability Team is meeting to discuss waste reduction, outdoor nature projects, and public outreach. The body is reviewing initiatives related to recycling and community education.

sustainabilityrecyclingenvironmentpublic-education
Mon Jan 8, 2024

Police Commission

Trumbull Police Commission to discuss pension plan status

The Police Commission will meet to review the Chief's monthly report and discuss the status of the pension plan. The meeting also includes the approval of minutes from September and December 2023.

policepensionspublic-safety
Mon Jan 8, 2024

Parks & Recreation Commission

Parks and Recreation Commission to review park mapping and department reports

The Commission is meeting to discuss department reports and correspondence regarding park trail mapping. The session includes updates on winter recreation programs and ranger division activities.

parksrecreationmappingpublic-safetyyouth-sports
Thu Jan 4, 2024

Town Council

Trumbull Town Council considers over $18 million in capital appropriations

The Town Council is reviewing appropriations for the 2024-2025 Capital Improvement Plans for both the town and the Board of Education. The meeting also includes several commission appointments and a grant application for early voting.

budgetcapital-improvementseducationroadsappointmentsvoting
Wed Jan 3, 2024

Zoning Board of Appeals

Zoning Board of Appeals to review setback variances for two residential properties

The Zoning Board of Appeals will consider two applications for zoning variances in Residential Zone A. The board will decide whether to grant these requests to allow construction or placement closer to property lines than regulations permit.

zoningvariancesresidentialland-use
Tue Jan 2, 2024

Inland Wetlands & Watercourses Commission

Commission to review residence restoration permit at 201 Old Dike Road

The Inland Wetlands and Watercourses Commission will meet via videoconference to discuss old business and administrative items. The primary agenda item is a permit application for property restoration at 201 Old Dike Road.

wetlandspermitslandscapingresidential-construction